NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6980388|pdb|1QII|A]
View 

Chain A, Specific Chemical And Structural Damage At Nine Time Points (point F) Caused By Intense Synchrotron Radiation To Torpedo Californica Acetylcholinesterase

Protein Classification

Esterase_lipase domain-containing protein (domain architecture ID 10085203)

Esterase_lipase domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Esterase_lipase cd00312
Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on ...
7-514 0e+00

Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.


:

Pssm-ID: 238191  Cd Length: 493  Bit Score: 638.22  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        7 LVNTKSGKVMGTRVpvlsSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGfsgsemWNP 86
Cdd:cd00312   1 LVVTPNGKVRGVDE----GGVYSFLGIPYAEPPVGDLRFKEPQPYEPWSDVLDATSYPPSCMQWDQLGGGL------WNA 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A       87 NREMSEDCLYLNIWVPSPR--PKSTTVMVWIYGGGFYSGSSTLDVYNGkyLAYTEE-VVLVSLSYRVGAFGFLALHGSqE 163
Cdd:cd00312  71 KLPGSEDCLYLNVYTPKNTkpGNSLPVMVWIHGGGFMFGSGSLYPGDG--LAREGDnVIVVSINYRLGVLGFLSTGDI-E 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      164 APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWAsvSVAEGRR 243
Cdd:cd00312 148 LPGNYGLKDQRLALKWVQDNIAAFGGDPDSVTIFGESAGGASVSLLLLSPDSKGLFHRAISQSGSALSPWA--IQENARG 225
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      244 RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV 323
Cdd:cd00312 226 RAKRLARLLGCNDTSSAELLDCLRSKSAEELLDATRKLLLFSYSPFLPFGPVVDGDFIPDDPEELIKEGKFAKVPLIIGV 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      324 NKDEGSFFLLYGAPGFSKdsESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDnnGIKNRDGLDDIVGDHNVICP 403
Cdd:cd00312 306 TKDEGGYFAAMLLNFDAK--LIIETNDRWLELLPYLLFYADDALADKVLEKYPGDVDD--SVESRKNLSDMLTDLLFKCP 381
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      404 LMHFVNKYTKF-GNGTYLYFFNHRASNLV--WPEWMGVIHGYEIEFVFGLPLVKELNYtAEEEALSRRIMHYWATFAKTG 480
Cdd:cd00312 382 ARYFLAQHRKAgGSPVYAYVFDHRSSLSVgrWPPWLGTVHGDEIFFVFGNPLLKEGLR-EEEEKLSRTMMKYWANFAKTG 460
                       490       500       510
                ....*....|....*....|....*....|....
1QII_A      481 NPNEPHSQEsKWPLFTTKEQKFIDLNTEPMKVHQ 514
Cdd:cd00312 461 NPNTEGNLV-VWPAYTSESEKYLDINIEGTEIKQ 493
 
Name Accession Description Interval E-value
Esterase_lipase cd00312
Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on ...
7-514 0e+00

Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.


Pssm-ID: 238191  Cd Length: 493  Bit Score: 638.22  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        7 LVNTKSGKVMGTRVpvlsSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGfsgsemWNP 86
Cdd:cd00312   1 LVVTPNGKVRGVDE----GGVYSFLGIPYAEPPVGDLRFKEPQPYEPWSDVLDATSYPPSCMQWDQLGGGL------WNA 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A       87 NREMSEDCLYLNIWVPSPR--PKSTTVMVWIYGGGFYSGSSTLDVYNGkyLAYTEE-VVLVSLSYRVGAFGFLALHGSqE 163
Cdd:cd00312  71 KLPGSEDCLYLNVYTPKNTkpGNSLPVMVWIHGGGFMFGSGSLYPGDG--LAREGDnVIVVSINYRLGVLGFLSTGDI-E 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      164 APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWAsvSVAEGRR 243
Cdd:cd00312 148 LPGNYGLKDQRLALKWVQDNIAAFGGDPDSVTIFGESAGGASVSLLLLSPDSKGLFHRAISQSGSALSPWA--IQENARG 225
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      244 RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV 323
Cdd:cd00312 226 RAKRLARLLGCNDTSSAELLDCLRSKSAEELLDATRKLLLFSYSPFLPFGPVVDGDFIPDDPEELIKEGKFAKVPLIIGV 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      324 NKDEGSFFLLYGAPGFSKdsESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDnnGIKNRDGLDDIVGDHNVICP 403
Cdd:cd00312 306 TKDEGGYFAAMLLNFDAK--LIIETNDRWLELLPYLLFYADDALADKVLEKYPGDVDD--SVESRKNLSDMLTDLLFKCP 381
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      404 LMHFVNKYTKF-GNGTYLYFFNHRASNLV--WPEWMGVIHGYEIEFVFGLPLVKELNYtAEEEALSRRIMHYWATFAKTG 480
Cdd:cd00312 382 ARYFLAQHRKAgGSPVYAYVFDHRSSLSVgrWPPWLGTVHGDEIFFVFGNPLLKEGLR-EEEEKLSRTMMKYWANFAKTG 460
                       490       500       510
                ....*....|....*....|....*....|....
1QII_A      481 NPNEPHSQEsKWPLFTTKEQKFIDLNTEPMKVHQ 514
Cdd:cd00312 461 NPNTEGNLV-VWPAYTSESEKYLDINIEGTEIKQ 493
COesterase pfam00135
Carboxylesterase family;
8-524 0e+00

Carboxylesterase family;


Pssm-ID: 333868  Cd Length: 507  Bit Score: 616.63  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A          8 VNTKSGKVMGTRVPVLSS-HISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEMwnp 86
Cdd:pfam00135   3 VTTSLGRVRGRRVKVTGGdPVDAFLGIPYAEPPVGELRFQPPQPPEPWTGVRDATKFPPRCPQNGDLTDPGFSGLEG--- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A         87 nremSEDCLYLNIWVPSPRPKST-TVMVWIYGGGFYSGSSTLdvYNGKYLAYTEEVVLVSLSYRVGAFGFLALhGSQEAP 165
Cdd:pfam00135  80 ----SEDCLYLNVYTPKNLNKNKlPVMVWIHGGGFMTGSASL--YDGSYLAARGNVIVVTINYRLGILGFLST-GDDEAP 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        166 GNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAegRRRA 245
Cdd:pfam00135 153 GNYGLLDQVLALRWVQENIASFGGDPNNVTLFGESAGAASVSLLLLSPLSKGLFHRAILMSGSALSPWAIQSNP--RKRA 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        246 VELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVlPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGVNK 325
Cdd:pfam00135 231 KKLAKLVGCPTSDSAELVECLRSKPAEELLDAQLKV-VYGSVPFVPFGPVVDGDFLPDHPEELLKSGNFPKVPLLIGVNK 309
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        326 DEGSFFLLYGAPGFS--KDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP 403
Cdd:pfam00135 310 DEGLYFLAYILDNPDivKKLLEDFSNSLLVDLLYLYLEGRPEEISEAIKEEYTDWADRDDPETSRDALVDLLTDYLFNCP 389
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        404 LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN 483
Cdd:pfam00135 390 VLRFARLHASRGSPVYLYSFDYRGSSLRWPPWMGVDHGDELPYVFGTPFLGPFLFTKEDRKLSRKMMTYWTNFAKTGNPN 469
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|.
1QII_A        484 epHSQESKWPLFTTKEQKFIDLNTEPmKVHQRLRVQMCVFW 524
Cdd:pfam00135 470 --GEGLPKWPPYTDEDQQYLSIDLKP-RVKRGLKAEDCAFW 507
PnbA COG2272
Carboxylesterase type B [Lipid transport and metabolism];
7-525 1.60e-107

Carboxylesterase type B [Lipid transport and metabolism];


Pssm-ID: 225181  Cd Length: 491  Bit Score: 330.16  E-value: 1.60e-107
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        7 LVNTKSGKVMGTRVpvlsSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQyvdeqfpGFSGSEMWNP 86
Cdd:COG2272   4 VAETTTGKVEGITV----NGVHSWLGIPYAAPPVGELRFRRPVPPEPWSGVRDATQFGPACPQ-------PFNRMGSGED 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A       87 NREmSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQEAPG 166
Cdd:COG2272  73 FTG-SEDCLYLNIWAPEVPAEKLPVMVYIHGGGYIMGSGSEPLYDGSALAARGDVVVVSVNYRLGALGFLDLSSLDTEDA 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      167 ---NVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPwasVSVAEGRR 243
Cdd:COG2272 152 fasNLGLLDQILALKWVRDNIEAFGGDPQNVTLFGESAGAASILTLLAVPSAKGLFHRAIALSGAASRV---TSREEARE 228
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      244 RAVELGRNLNCnlnsDEELIHCLREKKPQELIDVewnVLPF--DSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILL 321
Cdd:COG2272 229 KAAAFARALGI----PEATLDKLRALSAEDLVKA---RLPLigRTFGAVPYGPVLGDSLLPRDPLEAIAQGRSHGVPLMI 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      322 GVNKDEGSFFLlygAPGFSKDSESKISREDFMSGVKLSvphandlGLDAVTLQYtdwmDDNNGIKNRDGLddIVGDHNVI 401
Cdd:COG2272 302 GTNHDEGSLFI---NFNPDSPPGLRDKVAARLPGKELI-------NAERVPAAY----PGVSAAAAAFGA--LVTDRLFK 365
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      402 CPLMHFVNKYTKfGNGTYLYFFNHRASNLVWPEwMGVIHGYEIEFVFGLP--LVKELNYTAEEEALSRRIMHYWATFAKT 479
Cdd:COG2272 366 APSIRLAQAQSA-GAPTWLYRFDYAPDTVRVPG-FGAPHATELSLVFGNLvaLGSAAQTARATAKLSRQMQDAWANFART 443
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*.
1QII_A      480 GNPNEPhsQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWN 525
Cdd:COG2272 444 GSPNGL--GLPDWPAYTEERRATLVLDPEIKVENDPRRDRREAWGR 487
 
Name Accession Description Interval E-value
Esterase_lipase cd00312
Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on ...
7-514 0e+00

Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.


Pssm-ID: 238191  Cd Length: 493  Bit Score: 638.22  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        7 LVNTKSGKVMGTRVpvlsSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGfsgsemWNP 86
Cdd:cd00312   1 LVVTPNGKVRGVDE----GGVYSFLGIPYAEPPVGDLRFKEPQPYEPWSDVLDATSYPPSCMQWDQLGGGL------WNA 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A       87 NREMSEDCLYLNIWVPSPR--PKSTTVMVWIYGGGFYSGSSTLDVYNGkyLAYTEE-VVLVSLSYRVGAFGFLALHGSqE 163
Cdd:cd00312  71 KLPGSEDCLYLNVYTPKNTkpGNSLPVMVWIHGGGFMFGSGSLYPGDG--LAREGDnVIVVSINYRLGVLGFLSTGDI-E 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      164 APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWAsvSVAEGRR 243
Cdd:cd00312 148 LPGNYGLKDQRLALKWVQDNIAAFGGDPDSVTIFGESAGGASVSLLLLSPDSKGLFHRAISQSGSALSPWA--IQENARG 225
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      244 RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV 323
Cdd:cd00312 226 RAKRLARLLGCNDTSSAELLDCLRSKSAEELLDATRKLLLFSYSPFLPFGPVVDGDFIPDDPEELIKEGKFAKVPLIIGV 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      324 NKDEGSFFLLYGAPGFSKdsESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDnnGIKNRDGLDDIVGDHNVICP 403
Cdd:cd00312 306 TKDEGGYFAAMLLNFDAK--LIIETNDRWLELLPYLLFYADDALADKVLEKYPGDVDD--SVESRKNLSDMLTDLLFKCP 381
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      404 LMHFVNKYTKF-GNGTYLYFFNHRASNLV--WPEWMGVIHGYEIEFVFGLPLVKELNYtAEEEALSRRIMHYWATFAKTG 480
Cdd:cd00312 382 ARYFLAQHRKAgGSPVYAYVFDHRSSLSVgrWPPWLGTVHGDEIFFVFGNPLLKEGLR-EEEEKLSRTMMKYWANFAKTG 460
                       490       500       510
                ....*....|....*....|....*....|....
1QII_A      481 NPNEPHSQEsKWPLFTTKEQKFIDLNTEPMKVHQ 514
Cdd:cd00312 461 NPNTEGNLV-VWPAYTSESEKYLDINIEGTEIKQ 493
COesterase pfam00135
Carboxylesterase family;
8-524 0e+00

Carboxylesterase family;


Pssm-ID: 333868  Cd Length: 507  Bit Score: 616.63  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A          8 VNTKSGKVMGTRVPVLSS-HISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEMwnp 86
Cdd:pfam00135   3 VTTSLGRVRGRRVKVTGGdPVDAFLGIPYAEPPVGELRFQPPQPPEPWTGVRDATKFPPRCPQNGDLTDPGFSGLEG--- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A         87 nremSEDCLYLNIWVPSPRPKST-TVMVWIYGGGFYSGSSTLdvYNGKYLAYTEEVVLVSLSYRVGAFGFLALhGSQEAP 165
Cdd:pfam00135  80 ----SEDCLYLNVYTPKNLNKNKlPVMVWIHGGGFMTGSASL--YDGSYLAARGNVIVVTINYRLGILGFLST-GDDEAP 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        166 GNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAegRRRA 245
Cdd:pfam00135 153 GNYGLLDQVLALRWVQENIASFGGDPNNVTLFGESAGAASVSLLLLSPLSKGLFHRAILMSGSALSPWAIQSNP--RKRA 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        246 VELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVlPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGVNK 325
Cdd:pfam00135 231 KKLAKLVGCPTSDSAELVECLRSKPAEELLDAQLKV-VYGSVPFVPFGPVVDGDFLPDHPEELLKSGNFPKVPLLIGVNK 309
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        326 DEGSFFLLYGAPGFS--KDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP 403
Cdd:pfam00135 310 DEGLYFLAYILDNPDivKKLLEDFSNSLLVDLLYLYLEGRPEEISEAIKEEYTDWADRDDPETSRDALVDLLTDYLFNCP 389
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        404 LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN 483
Cdd:pfam00135 390 VLRFARLHASRGSPVYLYSFDYRGSSLRWPPWMGVDHGDELPYVFGTPFLGPFLFTKEDRKLSRKMMTYWTNFAKTGNPN 469
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|.
1QII_A        484 epHSQESKWPLFTTKEQKFIDLNTEPmKVHQRLRVQMCVFW 524
Cdd:pfam00135 470 --GEGLPKWPPYTDEDQQYLSIDLKP-RVKRGLKAEDCAFW 507
PnbA COG2272
Carboxylesterase type B [Lipid transport and metabolism];
7-525 1.60e-107

Carboxylesterase type B [Lipid transport and metabolism];


Pssm-ID: 225181  Cd Length: 491  Bit Score: 330.16  E-value: 1.60e-107
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        7 LVNTKSGKVMGTRVpvlsSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQyvdeqfpGFSGSEMWNP 86
Cdd:COG2272   4 VAETTTGKVEGITV----NGVHSWLGIPYAAPPVGELRFRRPVPPEPWSGVRDATQFGPACPQ-------PFNRMGSGED 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A       87 NREmSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQEAPG 166
Cdd:COG2272  73 FTG-SEDCLYLNIWAPEVPAEKLPVMVYIHGGGYIMGSGSEPLYDGSALAARGDVVVVSVNYRLGALGFLDLSSLDTEDA 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      167 ---NVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPwasVSVAEGRR 243
Cdd:COG2272 152 fasNLGLLDQILALKWVRDNIEAFGGDPQNVTLFGESAGAASILTLLAVPSAKGLFHRAIALSGAASRV---TSREEARE 228
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      244 RAVELGRNLNCnlnsDEELIHCLREKKPQELIDVewnVLPF--DSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILL 321
Cdd:COG2272 229 KAAAFARALGI----PEATLDKLRALSAEDLVKA---RLPLigRTFGAVPYGPVLGDSLLPRDPLEAIAQGRSHGVPLMI 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      322 GVNKDEGSFFLlygAPGFSKDSESKISREDFMSGVKLSvphandlGLDAVTLQYtdwmDDNNGIKNRDGLddIVGDHNVI 401
Cdd:COG2272 302 GTNHDEGSLFI---NFNPDSPPGLRDKVAARLPGKELI-------NAERVPAAY----PGVSAAAAAFGA--LVTDRLFK 365
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A      402 CPLMHFVNKYTKfGNGTYLYFFNHRASNLVWPEwMGVIHGYEIEFVFGLP--LVKELNYTAEEEALSRRIMHYWATFAKT 479
Cdd:COG2272 366 APSIRLAQAQSA-GAPTWLYRFDYAPDTVRVPG-FGAPHATELSLVFGNLvaLGSAAQTARATAKLSRQMQDAWANFART 443
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*.
1QII_A      480 GNPNEPhsQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWN 525
Cdd:COG2272 444 GSPNGL--GLPDWPAYTEERRATLVLDPEIKVENDPRRDRREAWGR 487
Aes COG0657
Acetyl esterase/lipase [Lipid transport and metabolism];
99-252 3.18e-11

Acetyl esterase/lipase [Lipid transport and metabolism];


Pssm-ID: 223730 [Multi-domain]  Cd Length: 312  Bit Score: 64.19  E-value: 3.18e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A       99 IWVPSPRPKSTT-VMVWIYGGGFYSGS-STLDVYNGKYLAYTEEVVlVSLSYRVgafgflalhgSQEAPGNVGLLDQRMA 176
Cdd:COG0657  68 VYRPDRKAAATApVVLYLHGGGWVLGSlRTHDALVARLAAAAGAVV-VSVDYRL----------APEHPFPAALEDAYAA 136
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
1QII_A      177 LQWVHDNIQFFGGDPKTVTIFGESAGG--ASVGMHILSPGSRDLFRRAILqsgspNCPWASVSVAEGRRRAVELGRNL 252
Cdd:COG0657 137 YRWLRANAAELGIDPSRIAVAGDSAGGhlALALALAARDRGLPLPAAQVL-----ISPLLDLTSSAASLPGYGEADLL 209
Abhydrolase_3 pfam07859
alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.
112-203 2.26e-07

alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.


Pssm-ID: 336840 [Multi-domain]  Cd Length: 205  Bit Score: 51.43  E-value: 2.26e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QII_A        112 MVWIYGGGFYSGS-STLDVYNGKYLAYTEEVVlVSLSYRvgafgfLALhgsqEAPGNVGLLDQRMALQWVHDNIQFFGGD 190
Cdd:pfam07859   1 LVYFHGGGFVLGSaDTHDRLCRRLAARLGAVV-VSVDYR------LAP----EHPFPAAYDDAYAALRWLAEQAWELGAD 69
                          90
                  ....*....|...
1QII_A        191 PKTVTIFGESAGG 203
Cdd:pfam07859  70 PSRIAVAGDSAGG 82
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH