NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6137486|pdb|1QK2|A]
View 

Chain A, Wild Type Cel6a With A Non-hydrolysable Cellotetraose

Protein Classification

glycoside hydrolase family 6 protein (domain architecture ID 10474417)

glycoside hydrolase family 6 protein similar to Humicola insolens endoglucanase-6B that cuts internal beta-1,4-glucosidic bonds, and to Podospora anserina exoglucanase CEL6B that cuts the non-reducing end beta-1,4-glucosidic linkages in cellulose and cellotetraose to release cellobiose

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Glyco_hydro_6 pfam01341
Glycosyl hydrolases family 6;
24-326 7.76e-170

Glycosyl hydrolases family 6;


:

Pssm-ID: 334499  Cd Length: 303  Bit Score: 475.18  E-value: 7.76e-170
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A         24 VSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSI 103
Cdd:pfam01341   1 VDSAAAPQSDAALAAKAAKVADVPTFVWLDTIAAIPGLRDHLADARAQAKAGGNRTVVLVVYNLPDRDCAALASNGELSS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A        104 ADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNL-PNVAMYLDAGH 182
Cdd:pfam01341  81 ADAGLARYKEYIDPIAAIIGDYSDLRAVVVIEPDSLANLVTNLSVPKCANAASAYEEGIAYALKQLNAlPNVYVYLDAGH 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A        183 AGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWsNAF 262
Cdd:pfam01341 161 AGWLGWDANLGPAAQLLAKVYKDAGGPASVRGFATNVSNYNPTDETTSPSYTQWNPNFDEKHYGQALSPLLVAAGF-PAH 239
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
1QK2_A        263 FITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPR 326
Cdd:pfam01341 240 FIIDTSRNGNGGTGRPEWGDWCNPPGAGFGERPTTNTGDPLVDAFVWVKPPGESDGTSDTSAPR 303
 
Name Accession Description Interval E-value
Glyco_hydro_6 pfam01341
Glycosyl hydrolases family 6;
24-326 7.76e-170

Glycosyl hydrolases family 6;


Pssm-ID: 334499  Cd Length: 303  Bit Score: 475.18  E-value: 7.76e-170
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A         24 VSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSI 103
Cdd:pfam01341   1 VDSAAAPQSDAALAAKAAKVADVPTFVWLDTIAAIPGLRDHLADARAQAKAGGNRTVVLVVYNLPDRDCAALASNGELSS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A        104 ADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNL-PNVAMYLDAGH 182
Cdd:pfam01341  81 ADAGLARYKEYIDPIAAIIGDYSDLRAVVVIEPDSLANLVTNLSVPKCANAASAYEEGIAYALKQLNAlPNVYVYLDAGH 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A        183 AGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWsNAF 262
Cdd:pfam01341 161 AGWLGWDANLGPAAQLLAKVYKDAGGPASVRGFATNVSNYNPTDETTSPSYTQWNPNFDEKHYGQALSPLLVAAGF-PAH 239
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
1QK2_A        263 FITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPR 326
Cdd:pfam01341 240 FIIDTSRNGNGGTGRPEWGDWCNPPGAGFGERPTTNTGDPLVDAFVWVKPPGESDGTSDTSAPR 303
CelA1 COG5297
Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism];
7-361 5.63e-49

Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism];


Pssm-ID: 227616 [Multi-domain]  Cd Length: 544  Bit Score: 172.54  E-value: 5.63e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A        7 NPFVGVTPWANAYYASEV-SSLAIPSLTGAMATAAAAVAKvPSFMWLDTLD------KTPLMEQTLADIRTA---NKNGG 76
Cdd:COG5297  24 NPFVGATPYTNPDYAKCRdRSIAKVELRSLKAKMMSSKIY-PTAVWLDPILavaggaKNGGRLDLVRHLDAAlaqKKDNA 102
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A       77 NYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKN-YIDTIRQIVV--EYSDIRTLLVIEPDSLANLVTNLGTPKCAN 153
Cdd:COG5297 103 PITAGFVIYDIPGRDCHALASNGELPLTEEGLQRYKReYIDTIASIFNnpKYKDIRIVNAIEPDTLPNTVTNYSGAACAA 182
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A      154 AQSA--YLECINYAVTQLN-LPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRAL-RGLATNVAN------YN 223
Cdd:COG5297 183 AKMTgiYEYGIKYALNKSSaIPNVYTYMDIGHSGWLGWDDNRASALGLYTATIQVTTAGFASvNGFATDTANrtplvePN 262
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A      224 GWNITSPPsytqGNAVYNE------KLYIHAIGPLLANH------GW-SNAFFITDQGRSG----KQPTG---------- 276
Cdd:COG5297 263 LPNPDRNP----GGQPIRSakfyewNRYFEEMDARENLYgdfvaaGWpSNIGFYIDTGRNGwggaIRPTTngghdvndyv 338
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A      277 -------QQQWGDWCNVIGTGFGIRPSANTGdSLLDSFVWVKPGGECDGTSDSSAPR----FDSHC---------ALPDA 336
Cdd:COG5297 339 nsgrgdrRDHRGNWCNQSGAGLGLPPTATPG-GHADAFLWIKPPGESDGSSGLIPNQqgkgFDQYCdplfhtadgVLTGA 417
                       410       420
                ....*....|....*....|....*
1QK2_A      337 LQPAPQAGAWFQAYFVQLLTNANPS 361
Cdd:COG5297 418 LPDAPLSGDWFHAQFVKLINNAYPD 442
 
Name Accession Description Interval E-value
Glyco_hydro_6 pfam01341
Glycosyl hydrolases family 6;
24-326 7.76e-170

Glycosyl hydrolases family 6;


Pssm-ID: 334499  Cd Length: 303  Bit Score: 475.18  E-value: 7.76e-170
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A         24 VSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSI 103
Cdd:pfam01341   1 VDSAAAPQSDAALAAKAAKVADVPTFVWLDTIAAIPGLRDHLADARAQAKAGGNRTVVLVVYNLPDRDCAALASNGELSS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A        104 ADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNL-PNVAMYLDAGH 182
Cdd:pfam01341  81 ADAGLARYKEYIDPIAAIIGDYSDLRAVVVIEPDSLANLVTNLSVPKCANAASAYEEGIAYALKQLNAlPNVYVYLDAGH 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A        183 AGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWsNAF 262
Cdd:pfam01341 161 AGWLGWDANLGPAAQLLAKVYKDAGGPASVRGFATNVSNYNPTDETTSPSYTQWNPNFDEKHYGQALSPLLVAAGF-PAH 239
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
1QK2_A        263 FITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPR 326
Cdd:pfam01341 240 FIIDTSRNGNGGTGRPEWGDWCNPPGAGFGERPTTNTGDPLVDAFVWVKPPGESDGTSDTSAPR 303
CelA1 COG5297
Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism];
7-361 5.63e-49

Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism];


Pssm-ID: 227616 [Multi-domain]  Cd Length: 544  Bit Score: 172.54  E-value: 5.63e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A        7 NPFVGVTPWANAYYASEV-SSLAIPSLTGAMATAAAAVAKvPSFMWLDTLD------KTPLMEQTLADIRTA---NKNGG 76
Cdd:COG5297  24 NPFVGATPYTNPDYAKCRdRSIAKVELRSLKAKMMSSKIY-PTAVWLDPILavaggaKNGGRLDLVRHLDAAlaqKKDNA 102
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A       77 NYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKN-YIDTIRQIVV--EYSDIRTLLVIEPDSLANLVTNLGTPKCAN 153
Cdd:COG5297 103 PITAGFVIYDIPGRDCHALASNGELPLTEEGLQRYKReYIDTIASIFNnpKYKDIRIVNAIEPDTLPNTVTNYSGAACAA 182
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A      154 AQSA--YLECINYAVTQLN-LPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRAL-RGLATNVAN------YN 223
Cdd:COG5297 183 AKMTgiYEYGIKYALNKSSaIPNVYTYMDIGHSGWLGWDDNRASALGLYTATIQVTTAGFASvNGFATDTANrtplvePN 262
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A      224 GWNITSPPsytqGNAVYNE------KLYIHAIGPLLANH------GW-SNAFFITDQGRSG----KQPTG---------- 276
Cdd:COG5297 263 LPNPDRNP----GGQPIRSakfyewNRYFEEMDARENLYgdfvaaGWpSNIGFYIDTGRNGwggaIRPTTngghdvndyv 338
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QK2_A      277 -------QQQWGDWCNVIGTGFGIRPSANTGdSLLDSFVWVKPGGECDGTSDSSAPR----FDSHC---------ALPDA 336
Cdd:COG5297 339 nsgrgdrRDHRGNWCNQSGAGLGLPPTATPG-GHADAFLWIKPPGESDGSSGLIPNQqgkgFDQYCdplfhtadgVLTGA 417
                       410       420
                ....*....|....*....|....*
1QK2_A      337 LQPAPQAGAWFQAYFVQLLTNANPS 361
Cdd:COG5297 418 LPDAPLSGDWFHAQFVKLINNAYPD 442
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH