NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|3402121|pdb|1SWG|A]
View 

Chain A, Circular Permuted Streptavidin E51/a46 In Complex With Biotin

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Avidin super family cl03190
Avidin family;
5-82 4.32e-12

Avidin family;


The actual alignment was detected with superfamily member pfam01382:

Pssm-ID: 307508  Cd Length: 115  Bit Score: 58.11  E-value: 4.32e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SWG_A          5 YVLTGRydsaPATDGSGTALGWTVAWKNnyrnAHSATTWSGQY-VGGAEARINTQWLLTS-GTTEANAWKSTLVGHDTFT 82
Cdd:pfam01382  44 SPLVGW----QSNANDGPTFGFSVNWDN----GDSTTSWTGQCfVCDGKEVLKTTWLLRSeVDSCDDDWKATRVGQDTFT 115
Avidin super family cl03190
Avidin family;
99-128 1.45e-04

Avidin family;


The actual alignment was detected with superfamily member pfam01382:

Pssm-ID: 307508  Cd Length: 115  Bit Score: 38.46  E-value: 1.45e-04
                          10        20        30
                  ....*....|....*....|....*....|.
1SWG_A         99 ITGTWYNQLGSTFIVTA-GADGALTGTYESA 128
Cdd:pfam01382   2 LSGTWYNELGSTMTITQvSTTGEITGTYRTA 32
 
Name Accession Description Interval E-value
Avidin pfam01382
Avidin family;
5-82 4.32e-12

Avidin family;


Pssm-ID: 307508  Cd Length: 115  Bit Score: 58.11  E-value: 4.32e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SWG_A          5 YVLTGRydsaPATDGSGTALGWTVAWKNnyrnAHSATTWSGQY-VGGAEARINTQWLLTS-GTTEANAWKSTLVGHDTFT 82
Cdd:pfam01382  44 SPLVGW----QSNANDGPTFGFSVNWDN----GDSTTSWTGQCfVCDGKEVLKTTWLLRSeVDSCDDDWKATRVGQDTFT 115
Avidin pfam01382
Avidin family;
99-128 1.45e-04

Avidin family;


Pssm-ID: 307508  Cd Length: 115  Bit Score: 38.46  E-value: 1.45e-04
                          10        20        30
                  ....*....|....*....|....*....|.
1SWG_A         99 ITGTWYNQLGSTFIVTA-GADGALTGTYESA 128
Cdd:pfam01382   2 LSGTWYNELGSTMTITQvSTTGEITGTYRTA 32
 
Name Accession Description Interval E-value
Avidin pfam01382
Avidin family;
5-82 4.32e-12

Avidin family;


Pssm-ID: 307508  Cd Length: 115  Bit Score: 58.11  E-value: 4.32e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SWG_A          5 YVLTGRydsaPATDGSGTALGWTVAWKNnyrnAHSATTWSGQY-VGGAEARINTQWLLTS-GTTEANAWKSTLVGHDTFT 82
Cdd:pfam01382  44 SPLVGW----QSNANDGPTFGFSVNWDN----GDSTTSWTGQCfVCDGKEVLKTTWLLRSeVDSCDDDWKATRVGQDTFT 115
Avidin pfam01382
Avidin family;
99-128 1.45e-04

Avidin family;


Pssm-ID: 307508  Cd Length: 115  Bit Score: 38.46  E-value: 1.45e-04
                          10        20        30
                  ....*....|....*....|....*....|.
1SWG_A         99 ITGTWYNQLGSTFIVTA-GADGALTGTYESA 128
Cdd:pfam01382   2 LSGTWYNELGSTMTITQvSTTGEITGTYRTA 32
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH