NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|159164302|pdb|2E19|A]
View 

Chain A, Transcription factor 8

Protein Classification

homeobox domain-containing protein (domain architecture ID 10647766)

homeobox domain-containing protein may be involved in the transcriptional regulation of key eukaryotic developmental processes

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
15-51 4.63e-08

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


:

Pssm-ID: 197696  Cd Length: 57  Bit Score: 44.16  E-value: 4.63e-08
                          10        20        30
                  ....*....|....*....|....*....|....*..
2E19_A         15 LSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 51
Cdd:smart00389 13 LEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWF 49
 
Name Accession Description Interval E-value
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
15-51 4.63e-08

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 44.16  E-value: 4.63e-08
                          10        20        30
                  ....*....|....*....|....*....|....*..
2E19_A         15 LSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 51
Cdd:smart00389 13 LEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWF 49
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
15-51 6.12e-08

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 43.77  E-value: 6.12e-08
                       10        20        30
               ....*....|....*....|....*....|....*..
2E19_A      15 LSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 51
Cdd:cd00086 12 LEELEKEFEKNPYPSREEREELAKELGLTERQVKIWF 48
Homeobox pfam00046
Homeobox domain.
15-51 2.26e-05

Homeobox domain.


Pssm-ID: 365835  Cd Length: 55  Bit Score: 37.08  E-value: 2.26e-05
                         10        20        30
                 ....*....|....*....|....*....|....*..
2E19_A        15 LSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 51
Cdd:pfam00046 10 LEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWF 46
 
Name Accession Description Interval E-value
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
15-51 4.63e-08

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 44.16  E-value: 4.63e-08
                          10        20        30
                  ....*....|....*....|....*....|....*..
2E19_A         15 LSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 51
Cdd:smart00389 13 LEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWF 49
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
15-51 6.12e-08

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 43.77  E-value: 6.12e-08
                       10        20        30
               ....*....|....*....|....*....|....*..
2E19_A      15 LSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 51
Cdd:cd00086 12 LEELEKEFEKNPYPSREEREELAKELGLTERQVKIWF 48
Homeobox pfam00046
Homeobox domain.
15-51 2.26e-05

Homeobox domain.


Pssm-ID: 365835  Cd Length: 55  Bit Score: 37.08  E-value: 2.26e-05
                         10        20        30
                 ....*....|....*....|....*....|....*..
2E19_A        15 LSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 51
Cdd:pfam00046 10 LEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWF 46
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH