NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4139655|pdb|2OAT|B]
View 

Chain B, Ornithine Aminotransferase Complexed With 5-Fluoromethylornithine

Protein Classification

aspartate aminotransferase family protein (domain architecture ID 10797575)

aspartate aminotransferase family protein such as glutamate-1-semialdehyde 2,1-aminomutase or succinylornithine transaminase, involved in transamination or decarboxylation of various substrates

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Orn_aminotrans TIGR01885
ornithine aminotransferase; This model describes the final step in the biosynthesis of ...
40-437 0e+00

ornithine aminotransferase; This model describes the final step in the biosynthesis of ornithine from glutamate via the non-acetylated pathway. Ornithine amino transferase takes L-glutamate 5-semialdehyde and makes it into ornithine, which is used in the urea cycle, as well as in the biosynthesis of arginine. This model includes low-GC bacteria and eukaryotic species. The genes from two species are annotated as putative acetylornithine aminotransferases - one from Porphyromonas gingivalis (OMNI|PG1271), and the other from Staphylococcus aureus (OMNI|SA0170). After homology searching using BLAST it was determined that these two sequences were most closely related to ornithine aminotransferases. This model's seed includes one characterized hit, from Bacillus subtilis (SP|P38021).


:

Pssm-ID: 273853 [Multi-domain]  Cd Length: 401  Bit Score: 761.48  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         40 SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNV 119
Cdd:TIGR01885   1 SEEAIERENKYGAHNYHPLPVVFSKAEGVHVWDVEGKRYLDFLSAYSAVNQGHCHPKIVKALTEQAQKLTLSSRAFYNDV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        120 LGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGP 199
Cdd:TIGR01885  81 FGEFAEYVTKLFGYDKVLPMNTGAEAVETAIKLARKWGYKVKGIPENQAIIVSAKGNFHGRTLGAISMSTDPDSRTNFGP 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        200 FMPGFDIIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLA 277
Cdd:TIGR01885 161 YVPGFKKIPYNNLEALEEALEDhgPNVCAFIVEPIQGEAGVVVPDDGYLKKVRELCTKHNVLLIADEIQTGLGRTGKLLC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        278 VDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILR 357
Cdd:TIGR01885 241 VDHENVKPDIVLLGKALSGGVYPVSAVLADDDVMLTIKPGEHGSTYGGNPLACAVAVAALEVLEEEKLAENAEKLGEIFR 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        358 NELMKLPSDVVTAVRGKGLLNAIVIKETKDW-DAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:TIGR01885 321 DQLKKLPKPIITEVRGRGLLNAIVIDESKTGrTAWDLCLKLKEKGLLAKPTHGNIIRLAPPLVITEEQLDEGLEIIKKVI 400

                  .
2OAT_B        437 L 437
Cdd:TIGR01885 401 D 401
 
Name Accession Description Interval E-value
Orn_aminotrans TIGR01885
ornithine aminotransferase; This model describes the final step in the biosynthesis of ...
40-437 0e+00

ornithine aminotransferase; This model describes the final step in the biosynthesis of ornithine from glutamate via the non-acetylated pathway. Ornithine amino transferase takes L-glutamate 5-semialdehyde and makes it into ornithine, which is used in the urea cycle, as well as in the biosynthesis of arginine. This model includes low-GC bacteria and eukaryotic species. The genes from two species are annotated as putative acetylornithine aminotransferases - one from Porphyromonas gingivalis (OMNI|PG1271), and the other from Staphylococcus aureus (OMNI|SA0170). After homology searching using BLAST it was determined that these two sequences were most closely related to ornithine aminotransferases. This model's seed includes one characterized hit, from Bacillus subtilis (SP|P38021).


Pssm-ID: 273853 [Multi-domain]  Cd Length: 401  Bit Score: 761.48  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         40 SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNV 119
Cdd:TIGR01885   1 SEEAIERENKYGAHNYHPLPVVFSKAEGVHVWDVEGKRYLDFLSAYSAVNQGHCHPKIVKALTEQAQKLTLSSRAFYNDV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        120 LGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGP 199
Cdd:TIGR01885  81 FGEFAEYVTKLFGYDKVLPMNTGAEAVETAIKLARKWGYKVKGIPENQAIIVSAKGNFHGRTLGAISMSTDPDSRTNFGP 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        200 FMPGFDIIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLA 277
Cdd:TIGR01885 161 YVPGFKKIPYNNLEALEEALEDhgPNVCAFIVEPIQGEAGVVVPDDGYLKKVRELCTKHNVLLIADEIQTGLGRTGKLLC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        278 VDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILR 357
Cdd:TIGR01885 241 VDHENVKPDIVLLGKALSGGVYPVSAVLADDDVMLTIKPGEHGSTYGGNPLACAVAVAALEVLEEEKLAENAEKLGEIFR 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        358 NELMKLPSDVVTAVRGKGLLNAIVIKETKDW-DAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:TIGR01885 321 DQLKKLPKPIITEVRGRGLLNAIVIDESKTGrTAWDLCLKLKEKGLLAKPTHGNIIRLAPPLVITEEQLDEGLEIIKKVI 400

                  .
2OAT_B        437 L 437
Cdd:TIGR01885 401 D 401
PTZ00125 PTZ00125
ornithine aminotransferase-like protein; Provisional
46-439 0e+00

ornithine aminotransferase-like protein; Provisional


Pssm-ID: 240281 [Multi-domain]  Cd Length: 400  Bit Score: 705.29  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        46 REYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEE 125
Cdd:PTZ00125   1 LENQYGAHNYHPLPVVLKRGKGVFVWDVEGKKYYDFLSAYSAVNQGHCHPKILAALINQAQKLTLTSRAFYNDVLGLAEK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       126 YITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFD 205
Cdd:PTZ00125  81 YITDLFGYDKVLPMNSGAEAGETALKFARKWGYEVKGIPENQAKIIFCNGNFSGRTIGACSASTDPKCYNNFGPFVPGFE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       206 IIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRP 285
Cdd:PTZ00125 161 LVDYNDVEALEKLLQDPNVAAFIVEPIQGEAGVIVPDDGYLKQVYELCKKYNVLLIVDEIQTGLGRTGKLLAHDHEGVKP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       286 DIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLP- 364
Cdd:PTZ00125 241 DIVLLGKALSGGLYPISAVLANDDVMLVIKPGEHGSTYGGNPLACAVAVEALEVLKEEKLAENAQRLGEVFRDGLKELLk 320
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2OAT_B       365 -SDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF 439
Cdd:PTZ00125 321 kSPWVKEIRGKGLLNAIVFDHSDGVNAWDLCLKLKENGLLAKPTHDNIIRFAPPLVITKEQLDQALEIIKKVLKSF 396
ArgD COG4992
Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase [Amino acid transport and ...
38-436 0e+00

Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase [Amino acid transport and metabolism];


Pssm-ID: 227325 [Multi-domain]  Cd Length: 404  Bit Score: 510.94  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       38 PTSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYN 117
Cdd:COG4992   4 ELTAATIELFMKYLMPTYGRLPVVIVRGEGAYVWDQQGREYLDFAAGIAVNNLGHCHPALVEALKEQAEKLWHVSNLFYN 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      118 NVLGEYEEYITKLFNYH-KVLPMNTGVEAGETACKLARKWGYTVKgiqkyKAKIVFAAGNFWGRTLSAISSSTDPTSYDG 196
Cdd:COG4992  84 EPQAELAEKLVELSPFAdRVFFCNSGAEANEAALKLARKYTGDPE-----KSKIIAFENSFHGRTLGALSATGQPKYRKG 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      197 FGPFMPGFDIIPYNDLPALERALqDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWL 276
Cdd:COG4992 159 FGPLLPGFRHVPFNDIEALEAAI-DEDTAAVIVEPIQGEGGVIPAPPEFLKALRELCDEHGALLILDEVQTGLGRTGKLF 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      277 AVDYENVRPDIVLLGKALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIIL 356
Cdd:COG4992 238 AYEHYGVEPDILTLAKALGGG-FPIGAMLATEEIASAFTPGDHGSTFGGNPLACAVALAVLEVLLEEGLLENVREKGEYL 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      357 RNELMKL--PSDVVTAVRGKGLLNAIVIKEtkDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINK 434
Cdd:COG4992 317 LQRLRELkrRYPLVKEVRGRGLMIGIELKE--PYRARDIVRALREEGVLVLPAGPNVIRFLPPLVITEEEIDEALDALER 394

                ..
2OAT_B      435 TI 436
Cdd:COG4992 395 AL 396
OAT_like cd00610
Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP) ...
43-436 1.84e-166

Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase, alanine-glyoxylate aminotransferase, dialkylglycine decarboxylase, 4-aminobutyrate aminotransferase, beta-alanine-pyruvate aminotransferase, adenosylmethionine-8-amino-7-oxononanoate aminotransferase, and glutamate-1-semialdehyde 2,1-aminomutase. All the enzymes belonging to this family act on basic amino acids and their derivatives are involved in transamination or decarboxylation.


Pssm-ID: 99735 [Multi-domain]  Cd Length: 413  Bit Score: 473.98  E-value: 1.84e-166
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       43 IFEREYKYGAHNY--HPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAF-YNNV 119
Cdd:cd00610   1 LFERDRKVLWHGYtvRPYPLVIVRAEGAYLYDVDGNRYLDFLSGIGVLNLGHNHPEVVEALKEQLAKLTHFSLGFfYNEP 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      120 LGEYEEYITKLF--NYHKVLPMNTGVEAGETACKLARKWGYtvkgiqkyKAKIVFAAGNFWGRTLSAISSSTDPTSYDGF 197
Cdd:cd00610  81 AVELAELLLALTpeGLDKVFFVNSGTEAVEAALKLARAYTG--------RKKIISFEGAYHGRTLGALSLTGSKKYRGGF 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      198 GPFMPGFDIIPYN-----------DLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADE 264
Cdd:cd00610 153 GPLLPGVLHVPYPyryrppaeladDLEALEEALEEhpEEVAAVIVEPIQGEGGVIVPPPGYLKALRELCRKHGILLIADE 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      265 IQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTI--KPGEHGSTYGGNPLGCRVAIAALEVLEE 342
Cdd:cd00610 233 VQTGFGRTGKMFAFEHFGVEPDIVTLGKGLGGGL-PLGAVLGREEIMDAFpaGPGLHGGTFGGNPLACAAALAVLEVLEE 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      343 ENLAENADKLGIILRNELMKLPS--DVVTAVRGKGLLNAIVI------KETKDWDAWKVCLRLRDNGLLAKPTHGDIIRF 414
Cdd:cd00610 312 EGLLENAAELGEYLRERLRELAEkhPLVGDVRGRGLMIGIELvkdratKPPDKELAAKIIKAALERGLLLRPSGGNVIRL 391
                       410       420
                ....*....|....*....|..
2OAT_B      415 APPLVIKEDELRESIEIINKTI 436
Cdd:cd00610 392 LPPLIITEEEIDEGLDALDEAL 413
Aminotran_3 pfam00202
Aminotransferase class-III;
50-436 6.79e-148

Aminotransferase class-III;


Pssm-ID: 333920 [Multi-domain]  Cd Length: 400  Bit Score: 426.35  E-value: 6.79e-148
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         50 YGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSR-AFYNNVLGEYEEYIT 128
Cdd:pfam00202   1 YYARGVDPILIFITKAKGVYLYDVDGRRYLDFYSGIAVTNLGHCHPALVAAVKNQADKLTHTSFgAFTNEPALKLAEKLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        129 KLFNYH--KVLPMNTGVEAGETACKLARKWGYTVKGIQKykAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDI 206
Cdd:pfam00202  81 KLTPGGldKVFFMNSGSEANENALKLARKYYREKGATER--TKIIAFSGAFHGRTLGALSVTGSPKYKTGFGPFLPGFPR 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        207 IPYNDLPALE-------------RALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTG 273
Cdd:pfam00202 159 APYPDPEFLKenearcleelealEKVKDDEIAAVIVEPIQGEGGVNPPSPAFLRGLRALCKEHGVLLIADEVQTGFGRTG 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        274 RWLAVDYENVRPDIVLLGKALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLG 353
Cdd:pfam00202 239 KLFAHEHWGVSPDIMTFAKALTGG-FPLSAVLGTAEVMQAFAPGSHGSTYGGNPLACAAALATLDIIEDEDLLQNAARLG 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        354 IILRNELMKL--PSDVVTAVRGKGLLnaIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEI 431
Cdd:pfam00202 318 AYLKEGLEALqeKYDVIGDVRGKGLM--IAIELKEDVTVNEIILAALEKGVLIRPCGDNVIRFMPPLIITDEQIDEGLEI 395

                  ....*
2OAT_B        432 INKTI 436
Cdd:pfam00202 396 ISDAL 400
 
Name Accession Description Interval E-value
Orn_aminotrans TIGR01885
ornithine aminotransferase; This model describes the final step in the biosynthesis of ...
40-437 0e+00

ornithine aminotransferase; This model describes the final step in the biosynthesis of ornithine from glutamate via the non-acetylated pathway. Ornithine amino transferase takes L-glutamate 5-semialdehyde and makes it into ornithine, which is used in the urea cycle, as well as in the biosynthesis of arginine. This model includes low-GC bacteria and eukaryotic species. The genes from two species are annotated as putative acetylornithine aminotransferases - one from Porphyromonas gingivalis (OMNI|PG1271), and the other from Staphylococcus aureus (OMNI|SA0170). After homology searching using BLAST it was determined that these two sequences were most closely related to ornithine aminotransferases. This model's seed includes one characterized hit, from Bacillus subtilis (SP|P38021).


Pssm-ID: 273853 [Multi-domain]  Cd Length: 401  Bit Score: 761.48  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         40 SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNV 119
Cdd:TIGR01885   1 SEEAIERENKYGAHNYHPLPVVFSKAEGVHVWDVEGKRYLDFLSAYSAVNQGHCHPKIVKALTEQAQKLTLSSRAFYNDV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        120 LGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGP 199
Cdd:TIGR01885  81 FGEFAEYVTKLFGYDKVLPMNTGAEAVETAIKLARKWGYKVKGIPENQAIIVSAKGNFHGRTLGAISMSTDPDSRTNFGP 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        200 FMPGFDIIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLA 277
Cdd:TIGR01885 161 YVPGFKKIPYNNLEALEEALEDhgPNVCAFIVEPIQGEAGVVVPDDGYLKKVRELCTKHNVLLIADEIQTGLGRTGKLLC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        278 VDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILR 357
Cdd:TIGR01885 241 VDHENVKPDIVLLGKALSGGVYPVSAVLADDDVMLTIKPGEHGSTYGGNPLACAVAVAALEVLEEEKLAENAEKLGEIFR 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        358 NELMKLPSDVVTAVRGKGLLNAIVIKETKDW-DAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:TIGR01885 321 DQLKKLPKPIITEVRGRGLLNAIVIDESKTGrTAWDLCLKLKEKGLLAKPTHGNIIRLAPPLVITEEQLDEGLEIIKKVI 400

                  .
2OAT_B        437 L 437
Cdd:TIGR01885 401 D 401
PTZ00125 PTZ00125
ornithine aminotransferase-like protein; Provisional
46-439 0e+00

ornithine aminotransferase-like protein; Provisional


Pssm-ID: 240281 [Multi-domain]  Cd Length: 400  Bit Score: 705.29  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        46 REYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEE 125
Cdd:PTZ00125   1 LENQYGAHNYHPLPVVLKRGKGVFVWDVEGKKYYDFLSAYSAVNQGHCHPKILAALINQAQKLTLTSRAFYNDVLGLAEK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       126 YITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFD 205
Cdd:PTZ00125  81 YITDLFGYDKVLPMNSGAEAGETALKFARKWGYEVKGIPENQAKIIFCNGNFSGRTIGACSASTDPKCYNNFGPFVPGFE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       206 IIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRP 285
Cdd:PTZ00125 161 LVDYNDVEALEKLLQDPNVAAFIVEPIQGEAGVIVPDDGYLKQVYELCKKYNVLLIVDEIQTGLGRTGKLLAHDHEGVKP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       286 DIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLP- 364
Cdd:PTZ00125 241 DIVLLGKALSGGLYPISAVLANDDVMLVIKPGEHGSTYGGNPLACAVAVEALEVLKEEKLAENAQRLGEVFRDGLKELLk 320
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2OAT_B       365 -SDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF 439
Cdd:PTZ00125 321 kSPWVKEIRGKGLLNAIVFDHSDGVNAWDLCLKLKENGLLAKPTHDNIIRFAPPLVITKEQLDQALEIIKKVLKSF 396
PLN02624 PLN02624
ornithine-delta-aminotransferase
10-439 0e+00

ornithine-delta-aminotransferase


Pssm-ID: 215335 [Multi-domain]  Cd Length: 474  Bit Score: 681.89  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        10 RFAVLSRGVHSSVASATSVATKKTVQGPP-TSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAV 88
Cdd:PLN02624   8 LLQRLARRSRRLRRRSYGALPEGSAPSLSdSSAHLIELEEKYSAHNYHPIPVVFSRAKGSRIWDPEGKKYLDFLSAYSAV 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        89 NQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKA 168
Cdd:PLN02624  88 NQGHCHPKIIKALTEQAEKLTLSSRAFYNDKFPEFAEYLTSMFGYDMVLPMNTGAEGVETAIKLARKWGYEKKGIPKNEA 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       169 KIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYL 246
Cdd:PLN02624 168 IIVSCCGCFHGRTLAAISMSCDNEATRGFGPLLPGHLKVDFGDLDALEKIFEEdgDRIAAFLFEPIQGEAGVVIPPDGYL 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       247 MGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGN 326
Cdd:PLN02624 248 KAVRELCSKHNVLMIADEIQTGLARTGKMLACDWEEVRPDVVILGKALGGGVIPVSAVLADKDVMLCIKPGEHGSTFGGN 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       327 PLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLP---SDVVTAVRGKGLLNAIVIKETKDW--DAWKVCLRLRDNG 401
Cdd:PLN02624 328 PLASAVAMAALQVVQDEKLAERSAKLGQELRDQLQKIQkqfPKLIKEVRGRGLLNAVVLNSPKLGpvSAYDVCLKLKERG 407
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|..
2OAT_B       402 LLAKPTHGDIIRFAPPLVIKEDELRESI----EIINKTILSF 439
Cdd:PLN02624 408 LLAKPTHDTIIRLAPPLSISEDELQECSkalsDVLEHDLPKL 449
rocD PRK04073
ornithine--oxo-acid transaminase; Provisional
39-434 0e+00

ornithine--oxo-acid transaminase; Provisional


Pssm-ID: 179736 [Multi-domain]  Cd Length: 396  Bit Score: 522.36  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        39 TSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNN 118
Cdd:PRK04073   3 KSEKIIELTNHYGAHNYHPLPIVISEAEGVWVKDPEGNRYMDMLSAYSAVNQGHRHPKIIQALKDQADKVTLTSRAFHSD 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       119 VLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFG 198
Cdd:PRK04073  83 QLGPWYEKVAKLTGKDMVLPMNTGAEAVETAIKAARRWAYDVKGVEPNKAEIIACEGNFHGRTMAAVSLSSEEEYKRGFG 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       199 PFMPGFDIIPYNDLPALERALqDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAV 278
Cdd:PRK04073 163 PMLPGIKKIPYGDLEALKAAI-TPNTAAFLVEPIQGEAGINIPPEGFLKAARELCKEENVLFIADEIQTGLGRTGKLFAC 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       279 DYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRN 358
Cdd:PRK04073 242 DWDNVTPDMYILGKALGGGVFPISCVAANRDILGVFTPGSHGSTFGGNPLACAVSIAALEVLEEEKLPERSLELGEYFKE 321
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2OAT_B       359 ELMKLPSDVVTAVRGKGLLNAIVIKETkdwdAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINK 434
Cdd:PRK04073 322 QLKEIDNPMIKEVRGRGLFIGVELNEP----ARPYCEALKEEGLLCKETHETVIRFAPPLVITKEELDWAFEKIKA 393
rocD PRK00854
ornithine--oxo-acid transaminase; Reviewed
37-436 0e+00

ornithine--oxo-acid transaminase; Reviewed


Pssm-ID: 234848 [Multi-domain]  Cd Length: 401  Bit Score: 516.64  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        37 PPTSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFY 116
Cdd:PRK00854   2 MNTSEDLIATEQRLGAHNYKPLDVVLTRGEGVWVWDTDGNRYLDCLSAYSAVNQGHCHPKILAAMVEQAGRLTLTSRAFR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       117 NNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDG 196
Cdd:PRK00854  82 NDQLAPLYEELAALTGSHKVLPMNSGAEAVETAIKAVRKWGYEVKGVPEGQAEIIVCADNFHGRTLSIVGFSTDPDARGG 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       197 FGPFMPGFDIIPYNDLPALERALqDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWL 276
Cdd:PRK00854 162 FGPFTPGFRVVPFGDAEALEAAI-TPNTVAFLVEPIQGEAGVIIPPAGYFTRVRELCTANNVTLILDEIQTGLGRTGKLL 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       277 AVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIIL 356
Cdd:PRK00854 241 AEEHEGIEADVTLIGKALSGGFYPVSAVLSNSEVLGVLKPGQHGSTFGGNPLACAVARAALKVLTEEGMIENAAEMGAYF 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       357 RNELMKLPSDVVTAVRGKGLLNAIVIkETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK00854 321 LEGLRSIRSNIVREVRGRGLMLAVEL-EPEAGGARQYCEALKERGLLAKDTHDHTIRLAPPLVITREQVDWALEQIAKVL 399
ArgD COG4992
Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase [Amino acid transport and ...
38-436 0e+00

Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase [Amino acid transport and metabolism];


Pssm-ID: 227325 [Multi-domain]  Cd Length: 404  Bit Score: 510.94  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       38 PTSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYN 117
Cdd:COG4992   4 ELTAATIELFMKYLMPTYGRLPVVIVRGEGAYVWDQQGREYLDFAAGIAVNNLGHCHPALVEALKEQAEKLWHVSNLFYN 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      118 NVLGEYEEYITKLFNYH-KVLPMNTGVEAGETACKLARKWGYTVKgiqkyKAKIVFAAGNFWGRTLSAISSSTDPTSYDG 196
Cdd:COG4992  84 EPQAELAEKLVELSPFAdRVFFCNSGAEANEAALKLARKYTGDPE-----KSKIIAFENSFHGRTLGALSATGQPKYRKG 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      197 FGPFMPGFDIIPYNDLPALERALqDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWL 276
Cdd:COG4992 159 FGPLLPGFRHVPFNDIEALEAAI-DEDTAAVIVEPIQGEGGVIPAPPEFLKALRELCDEHGALLILDEVQTGLGRTGKLF 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      277 AVDYENVRPDIVLLGKALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIIL 356
Cdd:COG4992 238 AYEHYGVEPDILTLAKALGGG-FPIGAMLATEEIASAFTPGDHGSTFGGNPLACAVALAVLEVLLEEGLLENVREKGEYL 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      357 RNELMKL--PSDVVTAVRGKGLLNAIVIKEtkDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINK 434
Cdd:COG4992 317 LQRLRELkrRYPLVKEVRGRGLMIGIELKE--PYRARDIVRALREEGVLVLPAGPNVIRFLPPLVITEEEIDEALDALER 394

                ..
2OAT_B      435 TI 436
Cdd:COG4992 395 AL 396
OAT_like cd00610
Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP) ...
43-436 1.84e-166

Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase, alanine-glyoxylate aminotransferase, dialkylglycine decarboxylase, 4-aminobutyrate aminotransferase, beta-alanine-pyruvate aminotransferase, adenosylmethionine-8-amino-7-oxononanoate aminotransferase, and glutamate-1-semialdehyde 2,1-aminomutase. All the enzymes belonging to this family act on basic amino acids and their derivatives are involved in transamination or decarboxylation.


Pssm-ID: 99735 [Multi-domain]  Cd Length: 413  Bit Score: 473.98  E-value: 1.84e-166
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       43 IFEREYKYGAHNY--HPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAF-YNNV 119
Cdd:cd00610   1 LFERDRKVLWHGYtvRPYPLVIVRAEGAYLYDVDGNRYLDFLSGIGVLNLGHNHPEVVEALKEQLAKLTHFSLGFfYNEP 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      120 LGEYEEYITKLF--NYHKVLPMNTGVEAGETACKLARKWGYtvkgiqkyKAKIVFAAGNFWGRTLSAISSSTDPTSYDGF 197
Cdd:cd00610  81 AVELAELLLALTpeGLDKVFFVNSGTEAVEAALKLARAYTG--------RKKIISFEGAYHGRTLGALSLTGSKKYRGGF 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      198 GPFMPGFDIIPYN-----------DLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADE 264
Cdd:cd00610 153 GPLLPGVLHVPYPyryrppaeladDLEALEEALEEhpEEVAAVIVEPIQGEGGVIVPPPGYLKALRELCRKHGILLIADE 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      265 IQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTI--KPGEHGSTYGGNPLGCRVAIAALEVLEE 342
Cdd:cd00610 233 VQTGFGRTGKMFAFEHFGVEPDIVTLGKGLGGGL-PLGAVLGREEIMDAFpaGPGLHGGTFGGNPLACAAALAVLEVLEE 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      343 ENLAENADKLGIILRNELMKLPS--DVVTAVRGKGLLNAIVI------KETKDWDAWKVCLRLRDNGLLAKPTHGDIIRF 414
Cdd:cd00610 312 EGLLENAAELGEYLRERLRELAEkhPLVGDVRGRGLMIGIELvkdratKPPDKELAAKIIKAALERGLLLRPSGGNVIRL 391
                       410       420
                ....*....|....*....|..
2OAT_B      415 APPLVIKEDELRESIEIINKTI 436
Cdd:cd00610 392 LPPLIITEEEIDEGLDALDEAL 413
Aminotran_3 pfam00202
Aminotransferase class-III;
50-436 6.79e-148

Aminotransferase class-III;


Pssm-ID: 333920 [Multi-domain]  Cd Length: 400  Bit Score: 426.35  E-value: 6.79e-148
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         50 YGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSR-AFYNNVLGEYEEYIT 128
Cdd:pfam00202   1 YYARGVDPILIFITKAKGVYLYDVDGRRYLDFYSGIAVTNLGHCHPALVAAVKNQADKLTHTSFgAFTNEPALKLAEKLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        129 KLFNYH--KVLPMNTGVEAGETACKLARKWGYTVKGIQKykAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDI 206
Cdd:pfam00202  81 KLTPGGldKVFFMNSGSEANENALKLARKYYREKGATER--TKIIAFSGAFHGRTLGALSVTGSPKYKTGFGPFLPGFPR 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        207 IPYNDLPALE-------------RALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTG 273
Cdd:pfam00202 159 APYPDPEFLKenearcleelealEKVKDDEIAAVIVEPIQGEGGVNPPSPAFLRGLRALCKEHGVLLIADEVQTGFGRTG 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        274 RWLAVDYENVRPDIVLLGKALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLG 353
Cdd:pfam00202 239 KLFAHEHWGVSPDIMTFAKALTGG-FPLSAVLGTAEVMQAFAPGSHGSTYGGNPLACAAALATLDIIEDEDLLQNAARLG 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        354 IILRNELMKL--PSDVVTAVRGKGLLnaIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEI 431
Cdd:pfam00202 318 AYLKEGLEALqeKYDVIGDVRGKGLM--IAIELKEDVTVNEIILAALEKGVLIRPCGDNVIRFMPPLIITDEQIDEGLEI 395

                  ....*
2OAT_B        432 INKTI 436
Cdd:pfam00202 396 ISDAL 400
PRK02627 PRK02627
acetylornithine aminotransferase; Provisional
39-439 3.22e-145

acetylornithine aminotransferase; Provisional


Pssm-ID: 235056 [Multi-domain]  Cd Length: 396  Bit Score: 419.15  E-value: 3.22e-145
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        39 TSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNN 118
Cdd:PRK02627   2 TSEAIIELEKKYLMNTYGRLPIAFVRGEGARLWDDDGKEYLDFLAGIAVNNLGHCHPKLVEAIQEQAAKLIHTSNLYYIE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       119 VLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTvKGIQKYkaKIVFAAGNFWGRTLSAISSSTDPTSYDGFG 198
Cdd:PRK02627  82 PQEELAEKLVELSGMDKVFFCNSGAEANEAAIKLARKYGHK-KGIEKP--EIITAENSFHGRTLATLSATGQPKYQEGFE 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       199 PFMPGFDIIPYNDLPALERALqDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAV 278
Cdd:PRK02627 159 PLVEGFIYVPFNDIEALKAAI-TDKTAAVMLEPIQGEGGVNPADKEYLQALRELCDENGILLILDEVQTGMGRTGKLFAY 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       279 DYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRN 358
Cdd:PRK02627 238 QHYGIEPDIMTLAKGLGGGV-PIGAVLAKEKVADVFTPGDHGSTFGGNPLACAAALAVIEIIEEEGLLENAAEVGEYLRA 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       359 ELMKLPS--DVVTAVRGKGLLNAIVIKEtkdwDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK02627 317 KLRELLEkyPGIKEVRGLGLMIGIELDR----PAAEIVKKALEKGLLINVTGDNVLRLLPPLIISKEEIDEAVDRLEEVL 392

                 ...
2OAT_B       437 LSF 439
Cdd:PRK02627 393 KEL 395
argD TIGR00707
transaminase, acetylornithine/succinylornithine family; This family of proteins, for which ...
54-436 6.76e-127

transaminase, acetylornithine/succinylornithine family; This family of proteins, for which ornithine aminotransferases form an outgroup, consists mostly of proteins designated acetylornithine aminotransferase. However, the two very closely related members from E. coli are assigned different enzymatic activities. One is acetylornithine aminotransferase (EC 2.6.1.11), ArgD, an enzyme of arginine biosynthesis, while another is succinylornithine aminotransferase, an enzyme of the arginine succinyltransferase pathway, an ammonia-generating pathway of arginine catabolism (See MEDLINE:98361920). Members of this family may also act on ornithine, like ornithine aminotransferase (EC 2.6.1.13) (see MEDLINE:90337349) and on succinyldiaminopimelate, like N-succinyldiaminopmelate-aminotransferase (EC 2.6.1.17, DapC, an enzyme of lysine biosynthesis) (see MEDLINE:99175097)


Pssm-ID: 273228 [Multi-domain]  Cd Length: 379  Bit Score: 372.08  E-value: 6.76e-127
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         54 NYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNY 133
Cdd:TIGR00707   5 TYGRLPVKIVRGKGSYVYDVNGKEYLDFVAGIAVNALGHAHPKLVEALKEQAEKLWHTSNLYYTEPQEELAEKLVEHSGA 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        134 HKVLPMNTGVEAGETACKLARKWGYTVkgiQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLP 213
Cdd:TIGR00707  85 DRVFFCNSGAEANEAALKLARKYTGDK---GSEKKKIVAFENAFHGRTMGTLSATGQPKYQKGFEPLVPGFSYAPYNDIE 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        214 ALERALQDpNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKA 293
Cdd:TIGR00707 162 SLKAAIDD-ETAAVIVEPIQGEGGVVPASAEFLKALREICKDKDALLIFDEVQTGVGRTGKLFAYEHYGVEPDIITLAKG 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        294 LSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSDV-VTAVR 372
Cdd:TIGR00707 241 LGGGV-PIGATLAKEEVAEAFTPGDHGSTFGGNPLACAAALAVLEVIEKERLLENVKEKGDYFVERLEELGKNYgLKEVR 319
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
2OAT_B        373 GKGLLNAIVIKEtkdwDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:TIGR00707 320 GKGLMLGIELEA----PYKDIVKEALEAGLLVNTAGPNVLRFLPPLIITEEEIDEAVDALEAAI 379
GabT COG0160
4-aminobutyrate aminotransferase or related aminotransferase [Amino acid transport and ...
27-436 2.08e-122

4-aminobutyrate aminotransferase or related aminotransferase [Amino acid transport and metabolism];


Pssm-ID: 223238 [Multi-domain]  Cd Length: 447  Bit Score: 363.08  E-value: 2.08e-122
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       27 SVATKKTVQGPPTSDDIFEREYKYGAHNY--HPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQ 104
Cdd:COG0160   5 EEPDIVTEAPGPKALELIERREEALARSYgrFRFPLVIVRAEGAYLYDVDGNEYLDFLSGIAVLNLGHNHPRVVEAVKRQ 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      105 VDKLTLTSRAFYNNVlgEYEEYITKLF------NYHKVLPMNTGVEAGETACKLARKwgYTvkgiqKYKAKIVFAaGNFW 178
Cdd:COG0160  85 LAKLNHTHTRDLYYE--PYVELAEKLTalapgsGLKKVFFGNSGAEAVEAAIKIARA--YT-----GRPGVIAFD-GAFH 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      179 GRTLSAIS-SSTDPTSYDGFGPFMPGFDIIPYNDLP-----------------ALERALQDPN-----VAAFMVEPIQGE 235
Cdd:COG0160 155 GRTLGALSlTGSKPPYKAGFGPLPPGVYHVPYPNPYrcpfgiggeecgddaleYIERALFDLEvgpeeVAAIIIEPIQGE 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      236 AGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMlTIK 315
Cdd:COG0160 235 GGIIVPPKGFLKALRKLCREHGILLIADEVQTGFGRTGKMFAFEHFGVEPDIVTLAKSLGGGL-PLSAVVGRAEIM-DWP 312
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      316 PGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSD--VVTAVRGKGLLNAIVI---KETKDWD- 389
Cdd:COG0160 313 PGGHGGTFGGNPVACAAALAVLDVIEEENLLERAAELGEYLRDRLEELQEKhpLIGDVRGLGLMIGVELvkdRDTKEPDa 392
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|.
2OAT_B      390 --AWKVCLRLRDNGLLAKPT--HGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:COG0160 393 elAAKIVARAFERGLLLLTCgpHGNVLRILPPLTISDEELDEGLDILEEAL 443
argD PRK03244
acetylornithine aminotransferase; Provisional
53-432 3.07e-108

acetylornithine aminotransferase; Provisional


Pssm-ID: 235112 [Multi-domain]  Cd Length: 398  Bit Score: 324.94  E-value: 3.07e-108
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        53 HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYsAVNQ-GHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLF 131
Cdd:PRK03244  20 NNYGTPPLALVRGEGAVVWDVDGKEYLDLLGGI-AVNAlGHAHPAVVEAVTRQLATLGHVSNLFATEPQIALAERLVELL 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       132 N---YHKVLPMNTGVEAGETACKLARKWGYTvkgiqkykaKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIP 208
Cdd:PRK03244  99 GapeGGRVFFCNSGAEANEAAFKLARLTGRT---------KIVAAEGGFHGRTMGALALTGQPAKRAPFEPLPGGVEHVP 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       209 YNDLPALERALQDPnVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIV 288
Cdd:PRK03244 170 YGDVDALAAAVDDD-TAAVFLEPIQGEAGVVPPPAGYLAAAREITDRHGALLVLDEVQTGIGRTGAWFAHQHDGVTPDVV 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       289 LLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSDVV 368
Cdd:PRK03244 249 TLAKGLGGGL-PIGACLAFGPAADLLTPGLHGSTFGGNPVACAAALAVLDTIASEGLLENAERLGEQLRAGIEALGHPLV 327
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
2OAT_B       369 TAVRGKGLLNAIVIKETkdwDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEII 432
Cdd:PRK03244 328 DHVRGRGLLLGIVLTAP---VAKAVEAAAREAGFLVNAVAPDVIRLAPPLIITDAQVDAFVAAL 388
argD PRK01278
acetylornithine transaminase protein; Provisional
54-439 9.49e-106

acetylornithine transaminase protein; Provisional


Pssm-ID: 179270 [Multi-domain]  Cd Length: 389  Bit Score: 318.32  E-value: 9.49e-106
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        54 NYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSrafynNVLG--EYEEYITKLF 131
Cdd:PRK01278   9 VYNRADLAFERGEGVWLIDEDGERYLDFASGIAVNSLGHAHPHLVEALKEQAEKLWHVS-----NLYRipEQERLAERLV 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       132 NY---HKVLPMNTGVEAGETACKLARKWGYtVKGiQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIP 208
Cdd:PRK01278  84 ENsfaDKVFFTNSGAEAVECAIKTARRYHY-GKG-HPERYRIITFEGAFHGRTLATIAAGGQEKYLEGFGPLVPGFDQVP 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       209 YNDLPALERALqDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAvdYEN--VRPD 286
Cdd:PRK01278 162 FGDIEALKAAI-TPNTAAILIEPIQGEGGIRPAPDEFLKGLRQLCDENGLLLIFDEVQCGMGRTGKLFA--HEWagVTPD 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       287 IVLLGKALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS- 365
Cdd:PRK01278 239 IMAVAKGIGGG-FPLGACLATEEAAKGMTPGTHGSTYGGNPLAMAVGNAVLDVILAPGFLDNVQRMGLYLKQKLEGLVDr 317
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2OAT_B       366 --DVVTAVRGKGLLNAIVIKEtkdwDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF 439
Cdd:PRK01278 318 fpDVIEEVRGKGLLLGLKCVV----PNRDLVQALRDEGLLTVGAGDNVVRLLPPLIITEEEIDEALERLERAAESL 389
PRK05769 PRK05769
4-aminobutyrate aminotransferase; Provisional
38-436 2.92e-103

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 235599 [Multi-domain]  Cd Length: 441  Bit Score: 313.78  E-value: 2.92e-103
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        38 PTSDDIFEREYKYGAHNYH-PLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLT---LTSr 113
Cdd:PRK05769  15 PKAREIIERDEKYLAQSTRrWYPLVIERGEGVWVEDVDGNVYLDFNAGIAVTNVGHAHPKVVKAVKEQAEKFLhysLTD- 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       114 aFYNNVLGEYEEYITKL----FNYhKVLPMNTGVEAGETACKLARkwGYTvkgiqKYKAKIVFAaGNFWGRTLSAIS-SS 188
Cdd:PRK05769  94 -FYYEPAVELAERLVEIapggFEK-KVFFTNSGTESNEAAIKIAR--YHT-----GRKYIIAFL-GAFHGRTYGSLSlTA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       189 TDPTSYDGFGPFMPGFDIIPY-----NDLPAL------ERALQ-----------DPN-VAAFMVEPIQGEAGVVVPDPGY 245
Cdd:PRK05769 164 SKPVQRKGFFPLMPGVIHVPYpnpyrNPWGIEnpeecgNAVLDfiedylfkklvPPEeVAAIIVEPIQGEGGYVVPPKNF 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       246 LMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMlTIKPGEHGSTYGG 325
Cdd:PRK05769 244 FKELRKLADKYGILLIDDEVQTGMGRTGKMFAIEHFGVEPDIITLAKAIAGGL-PLGAVIGRAELM-FLPPGSHANTFGG 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       326 NPLGCRVAIAALEVLeEENLAENADKLGIILRNEL--MKLPSDVVTAVRGKGLLNAI-VIKETKDWDAW---KVCLRLRD 399
Cdd:PRK05769 322 NPVAAAAALATLEEL-EEGLLENAQKLGEYLRKELkeLKEKYEFIGDVRGLGLMIGVeLVKDRKEPDPKlrdKVLYEAFK 400
                        410       420       430
                 ....*....|....*....|....*....|....*..
2OAT_B       400 NGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK05769 401 RGLLLLGAGKSAIRIIPPLIITEEEADIGLEILEEAI 437
argD PRK05093
bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; ...
54-430 4.67e-98

bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed


Pssm-ID: 179933 [Multi-domain]  Cd Length: 403  Bit Score: 299.14  E-value: 4.67e-98
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        54 NYHPLPVALERGKGIYLWDVEGRKYFDFlSSYSAVNQ-GHCHPKIVNALKSQVDKLTLTSRAFYNN-VLgeyeEYITKLF 131
Cdd:PRK05093  18 NYAPAEFIPVRGEGSRVWDQQGKEYIDF-AGGIAVTAlGHCHPALVKALKEQGEKLWHISNVFTNEpAL----RLAKKLI 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       132 NY---HKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKakIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIP 208
Cdd:PRK05093  93 DAtfaERVFFANSGAEANEAAFKLARRYACDRHGPEKTE--IIAFHNSFHGRTLFTVSVGGQPKYSDGFGPKPADITHVP 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       209 YNDLPALErALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIV 288
Cdd:PRK05093 171 FNDLAAVK-AVIDDHTCAVVVEPIQGEGGVIPATPEFLQGLRELCDQHNALLIFDEVQTGMGRTGDLFAYMHYGVTPDIL 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       289 LLGKALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS--D 366
Cdd:PRK05093 250 TSAKALGGG-FPIGAMLTTAEIASHFKVGTHGSTYGGNPLACAVAEAVFDIINTPEVLEGVKARRQRFVDGLQKINQkyG 328
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
2OAT_B       367 VVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIE 430
Cdd:PRK05093 329 VFSEIRGMGLLIGAELKPQYKGRARDFLNAAAEEGVMVLVAGPDVLRFAPSLVIEEADIDEGLA 392
argD PRK02936
acetylornithine aminotransferase; Provisional
54-436 2.85e-96

acetylornithine aminotransferase; Provisional


Pssm-ID: 179505 [Multi-domain]  Cd Length: 377  Bit Score: 293.80  E-value: 2.85e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        54 NYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNY 133
Cdd:PRK02936   7 TYGRFPIDIVKGKGTKVTDNNGKTYLDFTSGIAVCNLGHCHPTVTKAVQEQLDDIWHVSNLFTNSLQEEVASLLAENSAG 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       134 HKVLPMNTGVEAGETACKLARKwgYTvkgiqkYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLP 213
Cdd:PRK02936  87 DLVFFCNSGAEANEAALKLARK--HT------GKSKIVTFEQSFHGRTFGTMSATGQEKIKEGFGPLLPGFTHVPFNDIK 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       214 ALERALqDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKA 293
Cdd:PRK02936 159 ALKEVM-NEEVAAVMLEVVQGEGGVIPADPAFLQEVQTLCKKFGALLIIDEVQTGIGRTGTLFAYEQFGLDPDIVTVAKG 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       294 LSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMK--LPSDVVTAV 371
Cdd:PRK02936 238 LGNGI-PVGAMIGKKELGTAFGPGSHGSTFGGNPLAMAAAKEVLQVIKQPSFLEEVQEKGEYFLQKLQEelEHLECVKNI 316
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
2OAT_B       372 RGKGLLNAIVIKEtkdwDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK02936 317 RGKGLMIGIECTE----EVAPVIEQLREEGLLVLSAGPNVIRLLPPLVVTKEELDQAVYLLKKVL 377
BioA COG0161
Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme transport and metabolism]; ...
55-436 5.82e-95

Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme transport and metabolism];


Pssm-ID: 223239 [Multi-domain]  Cd Length: 449  Bit Score: 292.91  E-value: 5.82e-95
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       55 YHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVlgEYEEYITKLFNYH 134
Cdd:COG0161  23 PLAEPRVIVRAEGVYLTDIDGRRYLDGMSGLWCVNHGHGRPEIAEAIKKQLDKLPHVMFGGFTHE--PAIELAEKLAELA 100
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      135 KVLPMN------TGVEAGETACKLARKWgYTVKGiQKYKAKIVFAAGNFWGRTLSAISSSTDPTSY-DGFGPFMPGFDII 207
Cdd:COG0161 101 PEGGLDhvfftdSGSEAVETALKMALQY-WRARG-QPQRKKFISRRNGYHGDTLGAMSVGGPVALRhAFYDPLLPEVLHL 178
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      208 P-----------------YNDLPALER--ALQDP-NVAAFMVEPI-QGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQ 266
Cdd:COG0161 179 PapyayrrgffgegdeefAEAADELEAliLEHGPeTIAAFIVEPVvGGAGGMLVPPPGYLKRVREICDKYGILLIADEVA 258
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      267 TGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGE-----HGSTYGGNPLGCRVAIAALEVLE 341
Cdd:COG0161 259 TGFGRTGKMFACEHAGIVPDILCLAKGLTGGYLPLSAVLTSDRIYEAFSDGDagafmHGHTYSGNPLACAAALANLDILE 338
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      342 EENLAENADKLGIILRNELMKLPSD--VVTAVRGKGLLNAIVI---KETKDWDAWKVCLRLRD----NGLLAKPThGDII 412
Cdd:COG0161 339 EEDLLERVAEIGAYLQAGLQAALADhpLVGDVRGLGLIGAIELvadKATKTPFEARVGARVRAaaleRGLLIRPL-GDVI 417
                       410       420
                ....*....|....*....|....
2OAT_B      413 RFAPPLVIKEDELRESIEIINKTI 436
Cdd:COG0161 418 YLMPPLIITREEIDELVDALREAL 441
PRK08117 PRK08117
4-aminobutyrate aminotransferase; Provisional
42-436 1.29e-93

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 181234 [Multi-domain]  Cd Length: 433  Bit Score: 288.85  E-value: 1.29e-93
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        42 DIFEREYKYGA---HNYHP-LPValERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYN 117
Cdd:PRK08117   7 DLVERYPQLLApalAKDHPnLPV--VKGEGCYYYGVDGKEYLDFTSGIAVANVGHRHPKVVQAIKEQADKLMHGPSGVIY 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       118 nvlgeYEEYITKLFNYHKVLP--------MNTGVEAGETACKLARKwgytvkgIQKYKAKIVFAaGNFWGRTLSAISSST 189
Cdd:PRK08117  85 -----YESILKLAEELAEITPggldcfffSNSGAEAIEGALKLAKH-------VTKRPYIISFT-GCFHGRTLGALSVTT 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       190 DPTSY-DGFGPFMPGFDIIPY--------------------NDLPALERALQDPN-VAAFMVEPIQGEAGVVVPDPGYLM 247
Cdd:PRK08117 152 SKSKYrKYYQPLLGSVYQAPYpycdrcpkgedpevcfleclRDLESLFKHQVTPEeVAAVIIEPVLGEGGYIVPPKSFLK 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       248 GVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNP 327
Cdd:PRK08117 232 KLREICDRHGILLIFDEVQTGFGRTGEWFAAQTFGVVPDIMTIAKGIASGL-PLSAVVASKELMEQWPLGSHGTTFGGNP 310
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       328 LGCRVAIAALEVLEEENLAENADKLGIILRNEL--MKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRD----NG 401
Cdd:PRK08117 311 VACAAALATLEVIKEEKLLDNANEMGAYALERLevLKEKHPVIGDVRGIGLMIGIEIVDPDGEPDGDAVEKILDkcleKG 390
                        410       420       430
                 ....*....|....*....|....*....|....*..
2OAT_B       402 LL--AKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK08117 391 LLfyLCGNAGNVLRMIPPLTVTKEEIDEGLDILDEAL 427
arg_catab_astC TIGR03246
succinylornithine transaminase family; Members of the seed alignment for this protein family ...
54-439 5.07e-90

succinylornithine transaminase family; Members of the seed alignment for this protein family are the enzyme succinylornithine transaminase (EC 2.6.1.81), which catalyzes the third of five steps in arginine succinyltransferase (AST) pathway, an ammonia-releasing pathway of arginine degradation. All seed alignment sequences are found within arginine succinyltransferase operons, and all proteins that score above 820.0 bits should function as succinylornithine transaminase. However, a number of sequences extremely closely related in sequence, found in different genomic contexts, are likely to act in different biological processes and may act on different substrates. This model is desigated subfamily rather than equivalog, pending further consideration, for this reason. [Energy metabolism, Amino acids and amines]


Pssm-ID: 274490 [Multi-domain]  Cd Length: 397  Bit Score: 278.55  E-value: 5.07e-90
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         54 NYHPLPVALERGKGIYLWDVEGRKYFDFLSSYsAVNQ-GHCHPKIVNALKSQVDKLTLTSRAFYNN-VLGEYEEYITKLF 131
Cdd:TIGR03246  13 VYAPAPFIPVRGEGSRVWDQQGKEYIDFAGGI-AVNAlGHAHPELVKALIEQAQKLWHIGNGYTNEpVLRLAKKLVDATF 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        132 NyHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKakIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYND 211
Cdd:TIGR03246  92 A-DRVFFCNSGAEANEAALKLARKYALDRHGAHKSE--IVAFKNSFHGRTLFTVSVGGQPKYSQDFAPLPGGIKHAPYND 168
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        212 LPALErALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLG 291
Cdd:TIGR03246 169 LAAAK-ALIDDKTCAVIVEPIQGEGGVVPADPAFLKGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTA 247
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        292 KALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS--DVVT 369
Cdd:TIGR03246 248 KALGGG-FPIGAMLTTTEIAAVLTVGTHGTTYGGNPLACAVAGKVLDLVNTPEVLAGVKQRHDWFVDRLEKINAryNVFS 326
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        370 AVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF 439
Cdd:TIGR03246 327 EIRGKGLLIGCVLTAAYAGKAKQIVNAAAEEGVMALIAGPNVVRFAPSLVISDEDIDEGLARFERAVEQF 396
argD PRK04612
acetylornithine transaminase protein; Provisional
55-439 1.90e-84

acetylornithine transaminase protein; Provisional


Pssm-ID: 179868 [Multi-domain]  Cd Length: 408  Bit Score: 264.50  E-value: 1.90e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        55 YHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNN-VLGEYEEYITKLFNY 133
Cdd:PRK04612  19 YRPRQVVLERGQGSRVWDDQGREYLDLAAGIAVCGLGHNDPDLVAALTEQAGKLWHTSNVFYSApPLKLAEELVTASRFA 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       134 HKVLPMNTGVEAGETACKLARKWGyTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLP 213
Cdd:PRK04612  99 EKVFLCNSGTEANEAAIKLVRKWA-SSQGRPADKRVIVTFRGSFHGRTLAAVTATAQPKYQEGYEPLPGGFRYVDFNDVE 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       214 ALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKA 293
Cdd:PRK04612 178 ALEAAMAGGDVAAVMLEPIQGEGGVMPAAPGFLARVRALCDQHDALLVLDEIQCGMGRTGTLFAHWQEQVTPDIVTLAKA 257
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       294 LSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSD--VVTAV 371
Cdd:PRK04612 258 LGGG-FPIGAMLAGPKVAETMQFGAHGTTFGGNPLAAAVARVALRKLASPQIAANVARQSAALRAGLEALNAEfgVFAQV 336
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
2OAT_B       372 RGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF 439
Cdd:PRK04612 337 RGRGLMLGAVLAPAHAGQAGAILDLAAEHGLLLLQAGPDVLRFVPALNLTDAELADGLARLRLALADY 404
bioA TIGR00508
adenosylmethionine-8-amino-7-oxononanoate transaminase; All members of the seed alignment have ...
50-436 2.70e-83

adenosylmethionine-8-amino-7-oxononanoate transaminase; All members of the seed alignment have been demonstrated experimentally to act as EC 2.6.1.62, an enzyme in the biotin biosynthetic pathway. Alternate names include 7,8-diaminopelargonic acid aminotransferase, DAPA aminotransferase, and adenosylmethionine-8-amino-7-oxononanoate aminotransferase. The gene symbol is bioA in E. coli and BIO3 in S. cerevisiae. [Biosynthesis of cofactors, prosthetic groups, and carriers, Biotin]


Pssm-ID: 273109 [Multi-domain]  Cd Length: 421  Bit Score: 261.66  E-value: 2.70e-83
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         50 YGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKL--------------TLTSRaf 115
Cdd:TIGR00508   5 YTQMKEALPPLPIERAEGVYLYDEDGRRYIDGISSWWVNIHGHNHPRLNAAIKEQLDKLehvmfgglthepaiELAER-- 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        116 ynnvlgeyeeyITKLF--NYHKVLPMNTGVEAGETACKLARKWgYTVKGiQKYKAKIVFAAGNFWGRTLSAISSStDPTS 193
Cdd:TIGR00508  83 -----------LVEITpeGLEKVFFSDSGSVAVEVALKMALQY-WQNQG-RPGRTRFLALRNGYHGDTFGAMSVG-DVGG 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        194 YDG-FGPFMPGFDIIPY----------------NDLPALERALQD--PNVAAFMVEPI-QGEAGVVVPDPGYLMGVRELC 253
Cdd:TIGR00508 149 FHAlFEPLLFEQVFIPAppcyrcygwdpddceaECLAALEALLEEhaDEIAAFIVEPLvQGAGGMRFYPPGYLRKLRELC 228
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        254 TRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGE------HGSTYGGNP 327
Cdd:TIGR00508 229 DEYGVLLIADEIATGFGRTGKLFACEHAGVTPDILCLSKGLTGGYLPLAATLTTDEIYEAFYSDDagkafmHGHTYTGNP 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        328 LGCRVAIAALEVLEEENLAENADKLGIILRNELMKL-PSDVVTAVRGKGLLNAIVIKETKD---WDAWKVCLRLRDNGLL 403
Cdd:TIGR00508 309 LACAAALASLDLLEEEDWLEQVARIEAQLRAGLAPLrDHPGVADVRVLGAIGAVELVRDVEpypSIGAKIYQFFLERGVL 388
                         410       420       430
                  ....*....|....*....|....*....|...
2OAT_B        404 AKPThGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:TIGR00508 389 LRPL-GNVIYLMPPYIITDEELERLTAAIKEAI 420
argD PRK03715
acetylornithine transaminase protein; Provisional
49-432 1.60e-82

acetylornithine transaminase protein; Provisional


Pssm-ID: 179636 [Multi-domain]  Cd Length: 395  Bit Score: 258.85  E-value: 1.60e-82
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        49 KYGAHNYHPL-------PVALERGKGIYLWDVEGRKYFDFLSSYsAVNQ-GHCHPKIVNALKSQVDKLTLTSRAFYNNVL 120
Cdd:PRK03715   2 PFNDYPIDSLmyitnrpDIVFTHGKGSWLYDHNGKRYLDFIQGW-AVNClGHCNPGMVEALAAQAEKLINPSPAFYNEPM 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       121 GEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGytvkgiQKYKA---KIVFAAGNFWGRTLSAISSSTDPtSYDG- 196
Cdd:PRK03715  81 AKLAGLLTQHSCFDKVFFANSGAEANEGAIKLARKWG------RKHKNgayEIITFDHSFHGRTLATMSASGKP-GWDTi 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       197 FGPFMPGFDIIPYNDLPALErALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWL 276
Cdd:PRK03715 154 FAPQVPGFPKAELNDIASVE-KLITDKTVAVMLEPVQGEGGVIPATREFMQQLRALTKQHGLLLIVDEVQTGCGRTGTLF 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       277 AVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMlTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIIL 356
Cdd:PRK03715 233 AYELSGIEPDIMTLGKGIGGGV-PLAALLAKAEVA-VFEAGDQGGTYNGNPLMTAVGVAVISQLLAPGFLEGVRARGEYL 310
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       357 RNELMKLPSDV-VTAVRGKGLLNAIVIKetKDwDAWKVCLRLRD---NGLLAKPTHGDIIRFAPPLVIKEDELRESIEII 432
Cdd:PRK03715 311 KEKLLELSEERgLEGERGEGLLRALLLG--KD-IGPQIVEKARDmqpDGLLLNAPRPNLLRFMPALNVTTEEIDQMIAML 387
PRK06918 PRK06918
4-aminobutyrate aminotransferase; Reviewed
63-432 5.27e-82

4-aminobutyrate aminotransferase; Reviewed


Pssm-ID: 235885 [Multi-domain]  Cd Length: 451  Bit Score: 259.36  E-value: 5.27e-82
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        63 ERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTsrAFynNVLgEYEEYIT---KLFNY------ 133
Cdd:PRK06918  41 QSANGALVTDVDGNQYIDFAGAIGTINVGHSHPKVKEALHKQVDQYIHT--GF--NVM-MYEPYIElaeKLAALapgsfd 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       134 HKVLPMNTGVEAGETACKLARKwgYTvkgiqKYKAKIVFAAGnFWGRTLSAISSSTDPTSYD-GFGPFMP---------- 202
Cdd:PRK06918 116 KKVLFLNSGAEAVENAVKIARK--YT-----KRQGIISFSRG-FHGRTLMTMTMTSKVKPYKfGFGPFAPevykapfpye 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       203 -------------GFDIIPYNDLPALERALQdpNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGL 269
Cdd:PRK06918 188 yrrpeglteeqydDFMIEEFKNFFISEVAPE--TIAAVVMEPVQGEGGFIVPSKKFVQEVRNICSEHGILFVADEIQTGF 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       270 ARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENA 349
Cdd:PRK06918 266 ARTGKYFAIEHFDVVPDLITVSKSLGAGV-PISGVIGRKEIMDESAPGELGGTYAGSPLGCAAALAVLDIIEKENLNDRA 344
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       350 DKLGIILRNEL--MKLPSDVVTAVRGKGLLNAIVI---KETKDWD---AWKVCLRLRDNG--LLAKPTHGDIIRFAPPLV 419
Cdd:PRK06918 345 IELGKVVMNRFeeMKNKYNCIGDVRGLGAMCAFELvqdRKTKEPDktlTANICKEANKRGllLLSAGTYGNVIRVLMPLV 424
                        410
                 ....*....|...
2OAT_B       420 IKEDELRESIEII 432
Cdd:PRK06918 425 ITDEQLEEGLTII 437
PLN00144 PLN00144
acetylornithine transaminase
62-436 5.85e-80

acetylornithine transaminase


Pssm-ID: 177748 [Multi-domain]  Cd Length: 382  Bit Score: 251.93  E-value: 5.85e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        62 LERGKGIYLWDVEGRKYFDFlSSYSAVNQ-GHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMN 140
Cdd:PLN00144   1 FVSGKGCKLYDVEGKEYLDM-AAGIAVNAlGHGDPDWVKAVAEQAGTLAHVSNVYHTIPQVELAKRLVASSFADRVFFCN 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       141 TGVEAGETACKLARKWGYTVKGIQKYKAK------IVFAAGnFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPA 214
Cdd:PLN00144  80 SGTEANEAAIKFARKYQRVRAPDKKDPAAssatefVSFSNS-FHGRTLGALALTSKEQYRTPFEPLMPGVTFVEYGNLEA 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       215 LERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKAL 294
Cdd:PLN00144 159 ARKLIQKGKTAAVFVEPVQGEGGIYPATKEFLQGLRALCDEAGALLVFDEVQCGLGRTGYLWAHEAYGVEPDIMTLAKPL 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       295 SGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELM-KL-PSDVVTAVR 372
Cdd:PLN00144 239 AGGL-PIGAVLVTEKVASAINPGDHGSTFAGGPLVCNAALAVLDKISKPGFLASVAKKGEYLRELLRrKLgGNPHVKEVR 317
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
2OAT_B       373 GKGLLNAIVIketkDWDAWKVCLRLRDNGLLA-KPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PLN00144 318 GVGLLVGIQL----DVPAGPLVDACRDSGLLVlTAGKGDVVRLVPPLVISEAELEQAVEILADCL 378
PRK08360 PRK08360
4-aminobutyrate aminotransferase; Provisional
38-436 2.41e-79

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 181401 [Multi-domain]  Cd Length: 443  Bit Score: 252.39  E-value: 2.41e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        38 PTSDDIFEREYKY--GAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAF 115
Cdd:PRK08360   1 MKPLEIIERYSKVisPANRVTYYPLVPVKAENAKVWDIEGNEYIDFLSDAAVQNVGHNNPRVVKAIKEQTDKLIHYTPIY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       116 YNNV----LGEYEEYITKLfNYHKVLPMNTGVEAGETACKLARkwGYTvkgiqkYKAKIVFAAGNFWGRTLSAIS-SSTD 190
Cdd:PRK08360  81 GFPVepllLAEKLIEIAPG-DNPKVSFGLSGSDANDGAIKFAR--AYT------KRRKILSYLRSYYGSTYGAMSlTGLD 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       191 PTSYDGFGPfMPGFDIIPYNDL---------------------PALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGV 249
Cdd:PRK08360 152 FPVRALVGE-LSDVHYIPYPDCyrcpfgkepgsckmecveyikEKFEGEVYAEGVAALFAEPIQGDAGMIVPPEDYFKKL 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       250 RELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLG 329
Cdd:PRK08360 231 KKILDEHGILLVVDEVQSGLGRTGKWFAIEHFGVEPDIITLGKPLGGGL-PISATIGRAEIMDSLPPLAHAFTLSGNPVA 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       330 CRVAIAALEVLEEENLAENADKLG--IILRNELMKLPSDVVTAVRGKGLLNAIVI---KETKDW---DAWKVCLRLRDNG 401
Cdd:PRK08360 310 SAAALAVIEEIEEKNLLKRAEKLGnyTKKRLEEMKKKHELIGDVRGIGLMIGVDLvkdRETKERayeEAAKVVWRAWELG 389
                        410       420       430
                 ....*....|....*....|....*....|....*
2OAT_B       402 LLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK08360 390 LIVTFFSGNVLRIQPPLTIEKEVLDEGLDILEEAI 424
argD PRK04013
acetylornithine/acetyl-lysine aminotransferase; Provisional
62-436 1.77e-78

acetylornithine/acetyl-lysine aminotransferase; Provisional


Pssm-ID: 101376 [Multi-domain]  Cd Length: 364  Bit Score: 247.53  E-value: 1.77e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        62 LERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNT 141
Cdd:PRK04013  10 LVRGEGIYVWDSQGRRYLDLIAGIGVNVLGHNHPEWVEEMSEQLEKLVVAGPMFEHEEKEEMLEELSKWVNYEYVYMGNS 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       142 GVEAGETACKLARkwgytvkgIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQD 221
Cdd:PRK04013  90 GTEAVEAALKFAR--------LYTGRKEIIAMTNAFHGRTMGALSATWKPKYREDFEPLVPGFKHIPFNDVEAAKEAITK 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       222 pNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLaRTGRWLAVDYENVRPDIVLLGKALSGGLyPV 301
Cdd:PRK04013 162 -ETAAVIFEPIQGEGGIVPAKEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYKVEPDIVTMGKGIGNGV-PV 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       302 SAVLCDDDimltIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENAdklgiilRNELMKLPSDVVTAVRGKGLLNAIV 381
Cdd:PRK04013 239 SLTLTNFD----VERGKHGSTFGGNPLACKAVAVTLRILRRERLVEKA-------GEKFIEIKGERVVTTRGRGLMIGIV 307
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*
2OAT_B       382 IKETkdwdAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK04013 308 LKKP----VGKYVEELQNRGYLVHTAGQRVIRLLPPLIISKDTMEEAKSAIEGVI 358
PRK08593 PRK08593
4-aminobutyrate aminotransferase; Provisional
39-436 1.95e-78

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 181493 [Multi-domain]  Cd Length: 445  Bit Score: 250.00  E-value: 1.95e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        39 TSDDIFEREYKYGAH----NYHPLpvALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLT-LTSR 113
Cdd:PRK08593   3 KAHQLIQEDEHYFAKsgriKYYPL--VIDHGYGATLTDVDGKTYIDLLASASSQNVGHAPPRVVEAIKAQADKFIhYTPA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       114 AFYNNVLGEYEEYITKLF--NYHK-VLPMNTGVEAGETACKLARkwGYTvkGIQkYkakIVFAAGNFWGRTLSAIS-SST 189
Cdd:PRK08593  81 YMYHEPLVRLAKKLCELApgDFEKrVTFGLSGSDANDGIIKFAR--AYT--GRP-Y---IISFTNAYHGSTYGSLSmSGI 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       190 DPTSYDGFGPFMPGFDIIPYND----------------------------LPALEralqdpnVAAFMVEPIQGEAGVVVP 241
Cdd:PRK08593 153 SLNMRRKYGPLLPGFVHIPFPDkyrgmyeepdanfveeylaplkemfekyLPADE-------VACIVIETIQGDGGLLEP 225
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       242 DPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGS 321
Cdd:PRK08593 226 VPGYFEALYKFCREHGILFAVDDIQQGLGRTGKWSSISHFNITPDLMSFGKSLAGGM-PMSAIVGRKEIMESLEAPAHLF 304
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       322 TYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS--DVVTAVRGKGLLNAIVI---KETKDWD---AWKV 393
Cdd:PRK08593 305 TTGANPVSCAAALATIDMIEDESLLQRSAEKGEYARKRFDQWVSkyNFVGDVRGYGLSIGIDIvsdKKLKTRDneaALKI 384
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|...
2OAT_B       394 CLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK08593 385 CNYCFEHGVVIIAVAGNVLRFQPPLVITYEQLDTALNTIEQAF 427
PRK07495 PRK07495
4-aminobutyrate aminotransferase; Provisional
63-437 8.06e-78

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 236032 [Multi-domain]  Cd Length: 425  Bit Score: 247.74  E-value: 8.06e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        63 ERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSrafyNNVLgEYEEYITKLFNYHKVLPMN-- 140
Cdd:PRK07495  27 DRAENAEIWDKEGRRYIDFAAGIAVVNTGHRHPRVIAAVKAQLDRFTHTC----HQVV-PYENYVRLAERLNALVPGDfa 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       141 -------TGVEAGETACKLARkwgytvkgIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYD-GFGPFMPGFDIIPY--- 209
Cdd:PRK07495 102 kktifvtTGAEAVENAVKIAR--------AATGRSAVIAFGGGFHGRTFMGMSLTGKVVPYKvGFGAMMPDVYHVPFpve 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       210 -------NDLPALERALQ---DPN-VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAV 278
Cdd:PRK07495 174 lhgvsveQSLAALDKLFKadvDPQrVAAIIIEPVQGEGGFYPAPAAFMKALRELCDQHGILLIADEVQTGFARTGKLFAM 253
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       279 DYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRN 358
Cdd:PRK07495 254 EHHEVAADLTTMAKGLAGGF-PLAAVTGRAEIMDAPGPGGLGGTYGGNPLGIAAAHAVLDVIEEEDLCERANQLGNRLKQ 332
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       359 ELMKLPSDV--VTAVRGKGLLNAI----VIKETKDWD-AWKVCLRLRDNG--LLAKPTHGDIIRFAPPLVIKEDELRESI 429
Cdd:PRK07495 333 RLASLRETVpeIADIRGPGFMNAVefndADSGLPSAEfANRVRLKALEKGliLLTCGVHGNVIRFLAPITIQDDVFAEAL 412

                 ....*...
2OAT_B       430 EIINKTIL 437
Cdd:PRK07495 413 DILEASIL 420
PRK12381 PRK12381
bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional
55-429 9.45e-78

bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional


Pssm-ID: 183486 [Multi-domain]  Cd Length: 406  Bit Score: 246.94  E-value: 9.45e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        55 YHPLPVALERGKGIYLWDVEGRKYFDFLSSYsAVNQ-GHCHPKIVNALKSQVDKLTLTSRAFYNN-VLGEYEEYITKLFN 132
Cdd:PRK12381  18 YAPAPFIPVRGEGSRLWDQQGKEYIDFAGGI-AVNAlGHAHPALREALNEQASKFWHTGNGYTNEpVLRLAKKLIDATFA 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       133 yHKVLPMNTGVEAGETACKLARKWGYTVKGiqKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDL 212
Cdd:PRK12381  97 -DRVFFCNSGAEANEAALKLARKYAHDRYG--SHKSGIVAFKNAFHGRTLFTVSAGGQPKYSQDFAPLPPDIRHAAYNDL 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       213 PALeRALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGK 292
Cdd:PRK12381 174 NSA-SALIDDQTCAVIVEPIQGEGGVIPADKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDVLTTAK 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       293 ALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS--DVVTA 370
Cdd:PRK12381 253 ALGGG-FPIGAMLTTEKCASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINAryGLFSE 331
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*....
2OAT_B       371 VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESI 429
Cdd:PRK12381 332 IRGLGLLIGCVLNAEYAGKAKQISQEAAKAGVMVLIAGPNVVRFAPALNISEEEITTGL 390
PRK06058 PRK06058
4-aminobutyrate aminotransferase; Provisional
58-436 2.40e-77

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 235685 [Multi-domain]  Cd Length: 443  Bit Score: 247.25  E-value: 2.40e-77
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        58 LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSraFYNNvlgEYEEYITKLFNYHKVL 137
Cdd:PRK06058  38 LPVYVARAGGGIVEDVDGNRLIDLGSGIAVTSVGNSAPRVVEAVREQVARFTHTC--FMVT---PYEGYVAVAEQLNRLT 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       138 P---------MNTGVEAGETACKLARKwgYTVKGiqkykAKIVFAAGnFWGRTLSAISSSTDPTSY-DGFGPFMPgfDI- 206
Cdd:PRK06058 113 PgdhekrsalFNSGAEAVENAVKIARS--YTGRQ-----AVVVFDHA-YHGRTNLTMALTAKSMPYkSGFGPFAP--EVy 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       207 -----IPYNDLP--------ALERALQ-------DPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQ 266
Cdd:PRK06058 183 rapmsYPYRDPKglatdgeeAAARAITviekqvgADNLAAVIIEPIQGEGGFIVPAEGFLPALLEWCRENGVVFIADEVQ 262
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       267 TGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLA 346
Cdd:PRK06058 263 TGFARTGAWFACEHEGIVPDLITTAKGIAGGL-PLSAVTGRAEIMDAPHPGGLGGTYGGNPVACAAALAAIETIEEDDLV 341
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       347 ENADKLGIILRNELMKLPS--DVVTAVRGKGLLNAI--VIKETKDWDA---WKVCLRLRDNGL--LAKPTHGDIIRFAPP 417
Cdd:PRK06058 342 ARARQIEALMTDRLRALAAedDRIGDVRGRGAMIAIelVKPGTTEPDAeltKALAAAAHAAGVivLTCGTYGNVIRLLPP 421
                        410
                 ....*....|....*....
2OAT_B       418 LVIKEDELRESIEIINKTI 436
Cdd:PRK06058 422 LVIGDELLREGLDVLEAAL 440
PRK11522 PRK11522
putrescine--2-oxoglutarate aminotransferase; Provisional
69-436 5.52e-76

putrescine--2-oxoglutarate aminotransferase; Provisional


Pssm-ID: 183175 [Multi-domain]  Cd Length: 459  Bit Score: 244.27  E-value: 5.52e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        69 YLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTS-------RAFYNNVLGEyeeyIT------KLFNyhk 135
Cdd:PRK11522  75 TLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSqelldplRAMLAKTLAA----LTpgklkySFFC--- 147
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       136 vlpmNTGVEAGETACKLARKWgytvkgiQKYKAKIVFAA--GNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLP 213
Cdd:PRK11522 148 ----NSGTESVEAALKLAKAY-------QSPRGKFTFIAtsGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIE 216
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       214 ALERALQD-----PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIV 288
Cdd:PRK11522 217 AMRTALSEckktgDDVAAVILEPIQGEGGVILPPEGYLTAVRKLCDEFGALLILDEVQTGMGRTGKMFACEHENVQPDIL 296
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       289 LLGKALSGGLYPVSAVLCDDDI--MLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS- 365
Cdd:PRK11522 297 CLAKALGGGVMPIGATIATEEVfsVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDYLLDGFRQLARe 376
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
2OAT_B       366 --DVVTAVRGKGLLNAIVIKETKdwDAWKVCLRLRDNGLLAKPT--HGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK11522 377 ypDLVQEARGKGMLMAIEFVDNE--IGYNFASEMFRQRVLVAGTlnNAKTIRIEPPLTLTIEQCEQVLKAARKAL 449
GABAtrnsam TIGR00700
4-aminobutyrate aminotransferase, prokaryotic type; This enzyme is a class III ...
58-432 1.55e-73

4-aminobutyrate aminotransferase, prokaryotic type; This enzyme is a class III pyridoxal-phosphate-dependent aminotransferase. This model describes known bacterial examples of the enzyme. The best archaeal matches are presumed but not trusted to have the equivalent function. The degree of sequence difference between this set and known eukaryotic (mitochondrial) examples is greater than the distance to some proteins known to have different functions, and so separate models are built for prokaryotic and eukaryotic sets. E. coli has two isozymes. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase. [Central intermediary metabolism, Other]


Pssm-ID: 129783 [Multi-domain]  Cd Length: 420  Bit Score: 236.70  E-value: 1.55e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         58 LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSrafYNNVLgeYEEYITKLFNYHKVL 137
Cdd:TIGR00700  15 LPVFAARAEGAILEDVDGNRLIDFASGIAVLNIGHSHPRVVDAVRTQVAEFTHTC---FMVTP--YEGYVALAEKLNRIA 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        138 P---------MNTGVEAGETACKLARKwgYTvkgiqKYKAKIVFAAGnFWGRTLSAISSSTDPTSYD-GFGPFMPGFDII 207
Cdd:TIGR00700  90 PgsgpkksvfFNSGAEAVENAVKIARS--YT-----GRPGVVAFDHG-FHGRTNMTMALTAKVMPYKsGFGPFAPEVYRA 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        208 PY----------------NDLPALER----ALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQT 267
Cdd:TIGR00700 162 PLpypyrdglldkqlstdGELAAARAifviDVGANNVAALVIEPVQGEGGFIVPAKGFVPALLDWCREHGIVFIADEVQT 241
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        268 GLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAE 347
Cdd:TIGR00700 242 GFARTGAMFACEHEGPEPDLITTAKSLADGL-PLSGVTGRAEIMDAPAPGGLGGTYAGNPLACAAALAVLAIIESEGLIE 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        348 NADKLGIILRNELMKLPS--DVVTAVRGKGLLNAI--VIKETKDWD---AWKVCLRLRDNG--LLAKPTHGDIIRFAPPL 418
Cdd:TIGR00700 321 RARQIGRLVTDRLTTLKAvdPRIGDVRGLGAMIAVelVDPGTTEPDaglAERIATAAHAAGllLLTCGMFGNIIRFLPPL 400
                         410
                  ....*....|....
2OAT_B        419 VIKEDELRESIEII 432
Cdd:TIGR00700 401 TIGDELLSEGLDIL 414
PRK06062 PRK06062
hypothetical protein; Provisional
52-434 1.70e-73

hypothetical protein; Provisional


Pssm-ID: 235687 [Multi-domain]  Cd Length: 451  Bit Score: 237.23  E-value: 1.70e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        52 AHNYHPL-------PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYE 124
Cdd:PRK06062  22 AHVFHSWsaqgkinPMVIAGAEGSYVWDYEGRRYLDFSSQLVNTNIGHQHPKVVAAIQEQAARLCTVAPAHANDARSEAA 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       125 EYITKL----FNyhKVLPMNTGVEAGETACKLARkwgytvkgIQKYKAKIVFAAGNFWGRTLSAISSSTDP------TSY 194
Cdd:PRK06062 102 RLIAERapgdLS--KVFFTNGGADANEHAVRMAR--------LHTGRPKVLSAYRSYHGGTGSAINLTGDPrrwpndTGR 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       195 DG----FGPFMPGFDIIPYNDLPALERALQD----------PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLF 260
Cdd:PRK06062 172 AGvvhfFGPFLYRSEFHATTEEEECERALAHlervielegpSTIAAILLESVPGTAGILVPPPGYLAGVRELCDRHGIVL 251
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       261 IADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIK----PGehGSTYGGNPLGCRVAIAA 336
Cdd:PRK06062 252 IADEVMAGFGRTGKWFAIEHFGVVPDLITFAKGVNSGYVPLGGVAISEAIAATFAdrpyPG--GLTYSGHPLACAAAVAT 329
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       337 LEVLEEENLAENADKLGI-ILRNELMKL----PSdvVTAVRGKGLLNAIVI---KETKD----WDAWKVCLR-----LRD 399
Cdd:PRK06062 330 INAMEEEGIVENAARIGAeVLGPGLRELaerhPS--VGEVRGLGVFWALELvadRETREplapYGASSAAMAavkaaCKE 407
                        410       420       430
                 ....*....|....*....|....*....|....*
2OAT_B       400 NGLLAKpTHGDIIRFAPPLVIKEDELRESIEIINK 434
Cdd:PRK06062 408 RGLLPF-VNGNRIHVVPPCTVTEDEVREGLAILDA 441
putres_am_tran TIGR03372
putrescine aminotransferase; Members of this family are putrescine aminotransferase, as found ...
70-424 1.48e-72

putrescine aminotransferase; Members of this family are putrescine aminotransferase, as found in Escherichia coli, Erwinia carotovora subsp. atroseptica, and closely related species. This pyridoxal phosphate enzyme, as characterized in E. coli, can act also on cadaverine and, more weakly, spermidine. [Central intermediary metabolism, Polyamine biosynthesis]


Pssm-ID: 132415 [Multi-domain]  Cd Length: 442  Bit Score: 234.53  E-value: 1.48e-72
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         70 LWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLF--NYHKVLPMNTGVEAGE 147
Cdd:TIGR03372  69 LIDTQGNEFIDCLGGFGIFNVGHRNPNVIAAVENQLAKQPLHSQELLDPLRALLAKTLAALTpgKLKYSFFCNSGTESVE 148
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        148 TACKLArkwgytvKGIQKYKAKIVF--AAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQD---- 221
Cdd:TIGR03372 149 AALKLA-------KAYQSPRGKFTFiaASGAFHGKSLGALSATAKPAFRKPFMPLLPGFHHVAFGDIEAMLKALNEckkt 221
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        222 -PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYP 300
Cdd:TIGR03372 222 gDDVAAIILEPIQGEGGVILPPEGYLPAVRALCDEFGALLILDEVQTGMGRTGKMFACEHEGVQPDILCLAKALGGGVMP 301
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        301 VSAVLCDDDI--MLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS---DVVTAVRGKG 375
Cdd:TIGR03372 302 IGATIATEAVfsVLFDNPFLHTTTFGGNPLACAAALATINELLEKNLPAQAAIKGDFLLDGFQQLAAeypDLIIEARGKG 381
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|
2OAT_B        376 LLNAIVIKETKDWDAWKVCLrLRDNGLLAKP-THGDIIRFAPPLVIKEDE 424
Cdd:TIGR03372 382 LLMAIEFRDNEIGYAFAKEL-FQQNILVAGTlNNAKSIRIEPPLTITIEQ 430
PRK06777 PRK06777
4-aminobutyrate aminotransferase; Provisional
63-436 1.56e-72

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 180690 [Multi-domain]  Cd Length: 421  Bit Score: 233.94  E-value: 1.56e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        63 ERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSrafYNNVlgEYEEYITKLFNYHKVLPMN-- 140
Cdd:PRK06777  27 ERAENATLWDVEGREYIDFAAGIAVLNTGHRHPKVVAAVRQQLDQFTHTA---YQIV--PYASYVTLAERINALAPIDgp 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       141 -------TGVEAGETACKLARkwGYTvkgiqKYKAKIVFAAGnFWGRTLSAISSSTDPTSYD-GFGPFmPG--------- 203
Cdd:PRK06777 102 aktafftTGAEAVENAVKIAR--AYT-----GRPGVIAFGGA-FHGRTLLTMALTGKVAPYKvGFGPF-PGsifhalypn 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       204 --FDIIPYNDLPALERALQ---DPN-VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLA 277
Cdd:PRK06777 173 elHGVSVEEALSSVERLFKadiAPDqVAAILLEPIQGEGGFNVAPPEFMSALRTLCDEHGILLIADEVQTGFARTGKLFA 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       278 VDYENVRPDIVLLGKALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILR 357
Cdd:PRK06777 253 MEYYDVKPDLITMAKSLGGG-MPISAVVGRAEVMDAPAPGGLGGTYAGNPLAVAAALAVLDVIAEEKLCQRALILGAHLV 331
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       358 NELMKLPSD--VVTAVRGKGLLNAIvikETKDWDAWK--------VCLRLRDNG--LLAKPTHGDIIRFAPPLVIKEDEL 425
Cdd:PRK06777 332 EVLEKAKAScpAIVDIRARGSMVAV---EFNDPQTGKpspeftrqYQRQALEEGllLLSCGVHGNVIRFLYPLTIPDAQF 408
                        410
                 ....*....|.
2OAT_B       426 RESIEIINKTI 436
Cdd:PRK06777 409 SKALNILTRLL 419
PRK06916 PRK06916
adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
28-436 2.85e-71

adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional


Pssm-ID: 180746 [Multi-domain]  Cd Length: 460  Bit Score: 231.94  E-value: 2.85e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        28 VATKKTVQGPPTSDDIFEreyKYGAHNYHPL----------PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKI 97
Cdd:PRK06916   1 FSKSTTDKPSYTYEELSE---KNKAYVWHPFtqmkdyleedPLIIERGEGRKLYDVNGNEYYDGVSSIWLNVHGHQVPEL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        98 VNALKSQVDKLTLTSRAFYNNVLG-EYEEYITKLF--NYHKVLPMNTGVEAGETACKLARKWgYTVKGIQKyKAKIVFAA 174
Cdd:PRK06916  78 DEAIREQLNKIAHSTLLGLANVPSiLLAEKLIEVVpeGLKKVFYSDSGATAVEIAIKMAFQY-WQNKGKPK-KQRFVTLK 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       175 GNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPY---------ND--------LPALERALQDPN--VAAFMVEP-IQG 234
Cdd:PRK06916 156 NAYHGDTIGAVSVGAIDLFHQVYSSLLFEAIKMPYpytyrspygNDkaeivkkhLEELEELLKEKHeeIAAIIVEPlVQG 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       235 EAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTI 314
Cdd:PRK06916 236 AGGMITMPKGYLKGLRNLCTKYNVLFITDEVATGFGRTGKMFACEHENVTPDIMTAGKGLTGGYLPIAITVTTDEIYNAF 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       315 -------KPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS-DVVTAVRGKGLLNAIVI---K 383
Cdd:PRK06916 316 ygdyeeqKTFFHGHSYTGNPLGCAVALANLELYEKTNLIEQVARKTEYVATQLEDLFAlKHVGDIRQLGLMVGIELvknK 395
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*....
2OAT_B       384 ETKD---WD---AWKVCLRLRDNGLLAKPThGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK06916 396 ETKEpfeWTervGVQVCKRSRELGMLTRPL-GNTIVFMPPLASTIDELDEMLRILYKAI 453
PRK06082 PRK06082
4-aminobutyrate aminotransferase; Provisional
38-436 3.83e-70

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 180390 [Multi-domain]  Cd Length: 459  Bit Score: 228.83  E-value: 3.83e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        38 PTSDDIFEREYKYGAHNYHPLPV--ALERGKGIYLWDVEGRKYFDFLSSysAVNQ-GHCHPKIVNALKSQVDKLTLTSRA 114
Cdd:PRK06082  32 ERTQALLKRDSEVFLHQAMSTPCldVLASAEGIYIEDVDGKKYMDFHGN--NVHQlGYGHPHVIEKVKEQMAKLPFSPRR 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       115 FYNNVLGEYEEYITKLF--NYHKVLPMNTGVEAGETACKLARKwgYTvkgiQKYKakIVFAAGNFWGRTLSAISSSTDPT 192
Cdd:PRK06082 110 FTNETAIECAEKLTEIAggELNRVLFAPGGTSAIGMALKLARH--IT----GNFK--VVSLWDSFHGASLDAISVGGEAC 181
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       193 SYDGFGPFMPGFD-IIPYN------------DLPA---LERALQ-DPNVAAFMVEPIQGeAGVVVPDPGYLMGVRELCTR 255
Cdd:PRK06082 182 FRQGMGPLMAGVErIPPAVsyrgafpdadgsDVHYadyLEYVIEkEGGIGAFIAEAVRN-TDVQVPSKAYWKRVREICDK 260
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       256 HQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDD--DIMLTIKPGEHgsTYGGNPLGCRVA 333
Cdd:PRK06082 261 HNVLLIIDEIPNGMGRTGEWFTHQAYGIEPDILCIGKGLGGGLVPIAAMITKDkyNTAAQISLGHY--THEKSPLGCAAA 338
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       334 IAALEVLEEENLAENADKLGIILRNELMKLPSD--VVTAVRGKGLLNAI---VIKETKDW---DAWKVCLRLRDNGLLAK 405
Cdd:PRK06082 339 LATIEVIEQEGLLEKVKADSQFMRERLLEMKAKypLIGDVRGIGLLWGVelvTDRHTKERaydEAEAVLYRCLNNGLSFK 418
                        410       420       430
                 ....*....|....*....|....*....|.
2OAT_B       406 PTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK06082 419 VSQGNVIQLSPPLIITREELTQALAILEEAI 449
PRK08088 PRK08088
4-aminobutyrate aminotransferase; Validated
59-432 4.90e-68

4-aminobutyrate aminotransferase; Validated


Pssm-ID: 236149 [Multi-domain]  Cd Length: 425  Bit Score: 222.36  E-value: 4.90e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        59 PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTsrAFynNVLGeYEEYIT--KLFNY--- 133
Cdd:PRK08088  24 PIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHT--CF--QVLA-YEPYLElcEKMNQkvp 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       134 ----HKVLPMNTGVEAGETACKLARkwGYTvkgiqKYKAKIVFAAGnFWGRTLSAISSSTDPTSYD-GFGpFMPG----- 203
Cdd:PRK08088  99 gdfaKKTLLVTTGSEAVENAVKIAR--AAT-----KRSGVIAFTGA-YHGRTHYTLALTGKVNPYSaGMG-LMPGhvyra 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       204 ------FDIIPYNDLPALERALQD----PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTG 273
Cdd:PRK08088 170 lypcplHGVSEDDAIASIERIFKNdaapEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADEVQTGAGRTG 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       274 RWLAVDYENVRPDIVLLGKALSGGlYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLG 353
Cdd:PRK08088 250 TLFAMEQMGVAADLTTFAKSIAGG-FPLAGVTGRAEVMDAIAPGGLGGTYAGNPIACAAALAVLKVFEQENLLQKANALG 328
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       354 IILRNELMKLPSD--VVTAVRGKGLLNAIVIKETKDWD------AWKVCLRLRDNG--LLAKPTHGDIIRFAPPLVIKED 423
Cdd:PRK08088 329 EKLKDGLLAIAEKhpEIGDVRGLGAMIAIELFEDGDHSkpnaklTAQIVARARDKGliLLSCGPYYNVLRILVPLTIEDA 408

                 ....*....
2OAT_B       424 ELRESIEII 432
Cdd:PRK08088 409 QIRQGLEII 417
PRK06917 PRK06917
hypothetical protein; Provisional
65-436 9.24e-68

hypothetical protein; Provisional


Pssm-ID: 235884 [Multi-domain]  Cd Length: 447  Bit Score: 222.30  E-value: 9.24e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        65 GKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNvlgEYEEYITKLFNYHkvLP------ 138
Cdd:PRK06917  20 GKGVYLYDQNGNKYFDGSSGAVTAGIGHGVKEIADAIKEQAEEVSFVYRSQFTS---EPAEKLAKKLSDL--SPgdlnws 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       139 --MNTGVEAGETACKLARKWgYTVKGIQKyKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDII--PY----- 209
Cdd:PRK06917  95 ffVNSGSEANETAMKIAIQH-FQERGIQG-KHKILSRWMSYHGITMGALSMSGHPLRRQRFVSLLEDYPTIsaPYcyrcp 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       210 --NDLPA--------LERALQ---DPNVAAFMVEPIQGEAG-VVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRW 275
Cdd:PRK06917 173 vqKVYPTcqlacateLETAIErigAEHIAAFIAEPIIGAAGaAVVPPKGYYKVIKEICDHYDILFIADEVMTGLGRTGAM 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       276 LAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEH----GSTYGGNPLGCRVAIAALEVLEEENLAENADK 351
Cdd:PRK06917 253 FAMEHWGVEPDIMTLGKGLGAGYTPIAATVVSDRVMEPILRGSRsimsGHTLSANPLSAATALAVLEYMEKHNLPEKAAE 332
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       352 LGIILRNELMKLP--SDVVTAVRGKGLLNAIVI---KETKD------WDAWKVCLRLRDNGLLAKPT-------HGDIIR 413
Cdd:PRK06917 333 KGEYLIKGLQKVQqqSTIIGDVRGKGLLIGVEFvadKKTKQpfsksqAVASELISVAAKNGLLLYPAvagqdgkEGDAVI 412
                        410       420
                 ....*....|....*....|...
2OAT_B       414 FAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK06917 413 IAPPMTITYSELDELLSIFAKSV 435
PRK04260 PRK04260
acetylornithine aminotransferase; Provisional
54-436 1.62e-66

acetylornithine aminotransferase; Provisional


Pssm-ID: 179803 [Multi-domain]  Cd Length: 375  Bit Score: 217.01  E-value: 1.62e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        54 NYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHcHPKIVNALKSQVDKLTLTSRAFYNNVlgeYEEYITKLFNY 133
Cdd:PRK04260   7 NYKRAAIEFVKAEGNYLIDTDGKKYLDFSSGIGVTNLGF-HPQVQQALQKQAGLIWHSPNLYLNSL---QEEVAQKLIGD 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       134 HKVLPM--NTGVEAGETACKLARKwgytVKGiqkyKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYND 211
Cdd:PRK04260  83 KDYLAFfcNSGAEANEAAIKIARK----ATG----KQEIITFQNSFHGRTFGSMSATGQDKIKDGFGDGVPHFSYAIFND 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       212 LPALErALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLG 291
Cdd:PRK04260 155 LNSVK-ALVNKNTAAVMLELVQGESGVLPADKDFVKALADYCQETGILLIVDEVQTGMGRTGKLYAFEHYGIEPDIFTLA 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       292 KALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSD--VVT 369
Cdd:PRK04260 234 KGLANGV-PVGAMLAKSSLGGAFGYGSHGSTFGGNKLSMAAASATLDIMLTAGFLEQALENGNYLQEQLQKALQDkeTVT 312
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2OAT_B       370 AVRGKGLLnaIVIKETKDWDawKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK04260 313 TVRGLGYM--IGIETTADLS--QLVEAARDKGLIVLTAGTNVIRLLPPLTLTKEEIEQGIAILSEVF 375
PRK05964 PRK05964
adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
50-436 1.08e-65

adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional


Pssm-ID: 235656 [Multi-domain]  Cd Length: 423  Bit Score: 216.22  E-value: 1.08e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        50 YGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLtltsrafyNNV-LGEY----- 123
Cdd:PRK05964  16 YTQMKLHPPPIPIVRAEGAYLYLADGRELIDAISSWWVATHGHNHPYIDQAIREQLDRL--------DHViFAGFthepa 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       124 EEYITKLFnyhKVLPMN--------TGVEAGETACKLA----RKWGytvkgiQKYKAKIVFAAGNFWGRTLSAISSSTDP 191
Cdd:PRK05964  88 ERLAQRLV---ALTPGGldhvffsdSGSVAVEVALKMAlqywRNRG------EPGRSRFLSLRGGYHGDTIGTMSVGDRG 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       192 TSYDGFGPFMPGFDIIP-------YNDLPALERAL--QDPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFI 261
Cdd:PRK05964 159 GMHALYTPLLFEQVTAPfppdgyeQATLDALEALLekHAGEIAAFIVEPlVQGAGGMLFYDPRYLAELRRICDRHGVLLI 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       262 ADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGE------HGSTYGGNPLGCRVAIA 335
Cdd:PRK05964 239 FDEIATGFGRTGTLFACEQAGVSPDIMCLSKGLTGGYLPLAATLCTAEIFEAFYSDDrakafmHSPSYTANPLACAAANA 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       336 ALEVLEEENLAENADKLGIILRNELMKLPSD-VVTAVRGKGLLNAI-VIKETKDWDAWKVCLRLRDNGLLAKPThGDIIR 413
Cdd:PRK05964 319 SLDLFEDEPVLERVAALSAGLAEGLEPFRDLpGVADVRVLGAIGAVeLDRPVLERDGPALRAFALERGVLLRPL-GNTIY 397
                        410       420
                 ....*....|....*....|...
2OAT_B       414 FAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK05964 398 LMPPYIITAEELDRITDAIVEVA 420
PRK13360 PRK13360
omega amino acid--pyruvate transaminase; Provisional
54-436 3.55e-65

omega amino acid--pyruvate transaminase; Provisional


Pssm-ID: 183999 [Multi-domain]  Cd Length: 442  Bit Score: 215.37  E-value: 3.55e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        54 NYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTS-------RAFynnvlgEYEEY 126
Cdd:PRK13360  24 QFKKAPRLLVAAKGMYYTTHDGRRVLDGTAGLWCVNAGHGRPEIVEAVRAQAGELDYAPafqmghpKAF------ELANR 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       127 ITKLF--NYHKVLPMNTGVEAGETACKLARKWgYTVKGiQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGF 204
Cdd:PRK13360  98 IAEIApgGLNHVFFTNSGSESVDTALKIALAY-HRARG-EGSRTRLIGRERGYHGVGFGGISVGGIVPNRKAFGALLPGV 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       205 DIIPYNDLPA------------------LER--ALQDP-NVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIAD 263
Cdd:PRK13360 176 DHLPHTLDLArnafskgqpehgaeladeLERlvTLHDAsTIAAVIVEPVAGSTGVLIPPKGYLQRLREICDKHGILLIFD 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       264 EIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGE-------HGSTYGGNPLGCRVAIAA 336
Cdd:PRK13360 256 EVITGFGRLGAPFAAQYFGVTPDLLTCAKGLTNGAIPMGAVFVSSEIHDAFMQGPeagieffHGYTYSGHPLACAAALAT 335
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       337 LEVLEEENLAENADKLGIILRNELMKLpSDV--VTAVRGKGLLNAIVIKETKD---WDAWKVCLRLRDNGLLAKPThGDI 411
Cdd:PRK13360 336 LDLYEREGLLTRAARLAPYWEDALHSL-RDAphVIDIRNLGLVGAVELAPRDGkpgKRAYEVFLKCFEKGLMIRYT-GDI 413
                        410       420
                 ....*....|....*....|....*
2OAT_B       412 IRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK13360 414 LALSPPLIIEEAQIDELFDILAQAL 438
PRK07481 PRK07481
hypothetical protein; Provisional
44-425 6.55e-63

hypothetical protein; Provisional


Pssm-ID: 168967 [Multi-domain]  Cd Length: 449  Bit Score: 209.53  E-value: 6.55e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        44 FEREYKyGAHNYHPL----------PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTS- 112
Cdd:PRK07481   1 FLMSNN-ARRFWHPMahpaemkarpPIIIVRGDGVYVYDIDGKKLLDGVGGLWNVNVGHNREEVKEAIVRQLDELEYYSt 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       113 -RAFYNNVLGEYEEYITKLF---NYHKVLPMNTGVEAGETACKLARKWgYTVKGiQKYKAKIVFAAGNFWGRTLSAISSS 188
Cdd:PRK07481  80 fDGTTHPRAIELSYELIDMFapeGMRRVFFSSGGSDSVETALKLARQY-WKVRG-QPERTKFISLKQGYHGTHFGGASVN 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       189 TDPTSYDGFGPFMPGFDII--------PYND----------LPALER--ALQDPN-VAAFMVEPIQGEAGVVVPDPGYLM 247
Cdd:PRK07481 158 GNTVFRRNYEPLLPGCFHVetpwlyrnPFTEqdpeelaricARLLEReiAFQGPDtIAAFIAEPVQGAGGVIVPPANFWP 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       248 GVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGE-------HG 320
Cdd:PRK07481 238 LVREVCDRHGILLIADEVVTGFGRTGSWFGSRGWGVKPDIMCLAKGITSGYVPLGATMVNARIADAFEANAdfggaimHG 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       321 STYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLP--SDVVTAVRGKGLLNAIVI---KETKDWD------ 389
Cdd:PRK07481 318 YTYSGHPVACAAALATLDIVVREDLPANAAKRGAYLLEGLQPLKerFELVGDVRGKGLMLALDLvadKATREPIdpskgy 397
                        410       420       430
                 ....*....|....*....|....*....|....*.
2OAT_B       390 AWKVCLRLRDNGLLAKPTHGDIIrFAPPLVIKEDEL 425
Cdd:PRK07481 398 ANAVADVARENGVLVRPSGTKII-LSPPLVIQREDV 432
PRK09221 PRK09221
beta alanine--pyruvate transaminase; Provisional
59-436 5.53e-61

beta alanine--pyruvate transaminase; Provisional


Pssm-ID: 181707 [Multi-domain]  Cd Length: 445  Bit Score: 204.32  E-value: 5.53e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        59 PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLT-------SRAFynnvlgEYEEYITKLF 131
Cdd:PRK09221  32 PRLLVSAEGMYYTDADGRKILDGTAGLWCCNAGHGRPEIVEAVARQAATLDYApafqmghPLAF------ELAERLAELA 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       132 --NYHKVLPMNTGVEAGETACKLARKWgYTVKGiQKYKAKIVfaaG--------NFWGRTLSAISSSTDPtsydgFGPFM 201
Cdd:PRK09221 106 pgGLDHVFFTNSGSESVDTALKIALAY-HRARG-QGTRTRLI---GrergyhgvGFGGISVGGIVNNRKM-----FGGLL 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       202 PGFDIIPYN-DLP-----------------ALER--ALQDP-NVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLF 260
Cdd:PRK09221 176 PGVDHLPHTlDLPenafskgqpehgaeladDLERlvALHDAsTIAAVIVEPMAGSAGVLVPPKGYLQRLREICDKHGILL 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       261 IADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGE-------HGSTYGGNPLGCRVA 333
Cdd:PRK09221 256 IFDEVITGFGRLGAAFAAERFGVTPDIITFAKGLTNGAIPMGAVIASDEIYDAFMQGPeyaieffHGYTYSAHPVACAAG 335
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       334 IAALEVLEEENLAENADKLGIILRNELMKL---PSdvVTAVRGKGLLNAIVIKETKD------WDAWKVCLrlrDNGLLA 404
Cdd:PRK09221 336 LATLDIYREEDLFERAAELAPYFEDAVHSLkglPH--VIDIRNIGLVAGIELAPRPGapgargYEAFMKCF---EKGLLV 410
                        410       420       430
                 ....*....|....*....|....*....|..
2OAT_B       405 KPThGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK09221 411 RYT-GDTIALSPPLIIEKAQIDELVDALGDAL 441
PRK09792 PRK09792
4-aminobutyrate transaminase; Provisional
70-436 3.43e-59

4-aminobutyrate transaminase; Provisional


Pssm-ID: 182078 [Multi-domain]  Cd Length: 421  Bit Score: 199.10  E-value: 3.43e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        70 LWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSrafYNNVlgEYEEYITKLFNYHKVLPM---------N 140
Cdd:PRK09792  34 LKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTA---YQIV--PYESYVTLAEKINALAPVsgqaktaffT 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       141 TGVEAGETACKLARKwgytvkgiQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYD-GFGPFMPGFDIIPY---------- 209
Cdd:PRK09792 109 TGAEAVENAVKIARA--------HTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKiGFGPFPGSVYHVPYpsdlhgistq 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       210 NDLPALERALQ---DPN-VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRP 285
Cdd:PRK09792 181 DSLDAIERLFKsdiEAKqVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKP 260
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       286 DIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS 365
Cdd:PRK09792 261 DLMTMAKSLAGGM-PLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKE 339
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       366 DV--VTAVRGKGllnAIVIKETKDWD--------AWKVCLRLRDNGLLAKP--THGDIIRFAPPLVIKEDELRESIEIIN 433
Cdd:PRK09792 340 SVpaIAAVRGLG---SMIAAEFNDPQtgepsaaiAQKIQQRALAQGLLLLTcgAYGNVIRFLYPLTIPDAQFDAAMKILQ 416

                 ...
2OAT_B       434 KTI 436
Cdd:PRK09792 417 DAL 419
HemL COG0001
Glutamate-1-semialdehyde aminotransferase [Coenzyme transport and metabolism];
59-363 6.79e-59

Glutamate-1-semialdehyde aminotransferase [Coenzyme transport and metabolism];


Pssm-ID: 223080 [Multi-domain]  Cd Length: 432  Bit Score: 198.57  E-value: 6.79e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       59 PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTL----TSRAfynnvlGEYEEYITKLF-NY 133
Cdd:COG0001  36 PIFIERGKGAYLTDVDGNEYIDYVLGWGPLILGHAHPAVVEAVQEQLERGLSfgapTELE------VELAELLIERVpSI 109
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      134 HKVLPMNTGVEAGETACKLARkwGYTvkGiqkyKAKIVFAAGNFWGRTLSAISSSTDPTSYDGfGPFMPG--------FD 205
Cdd:COG0001 110 EKVRFVNSGTEATMSAIRLAR--AYT--G----RDKIIKFEGCYHGHSDSLLVKAGSGAATLG-SPSSPGvpadvakhTL 180
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      206 IIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLaRTGRWLAVDYENV 283
Cdd:COG0001 181 VLPYNDLEALEEAFEEygDDIAAVIVEPVAGNMGVVPPEPGFLEGLRELTEEHGALLIFDEVITGF-RVALGGAQGYYGV 259
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B      284 RPDIVLLGKALSGGLyPVSAVLCDDDIMLTIKPGE---HGSTYGGNPLGCRVAIAALEVL-EEENLAENADKLGIILRNE 359
Cdd:COG0001 260 EPDLTTLGKIIGGGL-PIGAFGGRAEIMEQLAPLGpvyQAGTLSGNPLAMAAGLATLEELmTEEGVYERLDALGERLAEG 338

                ....
2OAT_B      360 LMKL 363
Cdd:COG0001 339 LRAA 342
PRK06541 PRK06541
hypothetical protein; Provisional
51-438 5.45e-58

hypothetical protein; Provisional


Pssm-ID: 235823 [Multi-domain]  Cd Length: 460  Bit Score: 197.14  E-value: 5.45e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        51 GAHNYHPLPVaLERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKL---TLTSRAFYNNVlgeyeEYI 127
Cdd:PRK06541  28 GAYIDAPVPV-IVRGEGCYIWDDRGKRYLDGLAGLFVVQVGHGRAELAEAAAKQAGTLaffPLWSYAHPPAI-----ELA 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       128 TKLFNY-----HKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKakIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMP 202
Cdd:PRK06541 102 ERLAALapgdlNRVFFTTGGSEAVESAWKLAKQYFKLTGKPGKHK--VISRAIAYHGTTQGALAITGLPAFKAPFEPLVP 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       203 GFDIIP----Y------NDLPALERALQD----------PN-VAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFI 261
Cdd:PRK06541 180 GGFRVPntnfYrapelgDDPEAFGRWAADrieeaiefegPDtVAAVFLEPVQNAGGCFPPPPGYFERVREICDRYDVLLV 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       262 ADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGE----HGSTYGGNPLGCRVAIAAL 337
Cdd:PRK06541 260 SDEVICAFGRLGEMFGCERFGYVPDIITCAKGITSGYSPLGAMIASDRLFEPFLDGPtmflHGYTFGGHPVSAAVALANL 339
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       338 EVLEEENLAENADKLGIILRNELMKLPS-DVVTAVRGKGLLNAIVI---KETKDWDAWKVCLR---------LRDNGLLA 404
Cdd:PRK06541 340 DIFEREGLLDHVRDNEPAFRATLEKLLDlPIVGDVRGDGYFYGIELvkdKATKETFTDDESERllrgflspaLFEAGLYC 419
                        410       420       430
                 ....*....|....*....|....*....|....*.
2OAT_B       405 KPTH-GD-IIRFAPPLVIKEDELREsIEIINKTILS 438
Cdd:PRK06541 420 RADDrGDpVVQLAPPLISGQEEFDE-IEQILRSVLT 454
PRK05639 PRK05639
4-aminobutyrate aminotransferase; Provisional
38-436 2.74e-56

4-aminobutyrate aminotransferase; Provisional


Pssm-ID: 168145 [Multi-domain]  Cd Length: 457  Bit Score: 192.46  E-value: 2.74e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        38 PTSDDIFEREYKYGAHNY--HPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAF 115
Cdd:PRK05639  13 PKAKELIEREKRVLSPGIgvKLFPLVPKRGFGALIEDVDGNVFIDFLAGAAAASTGYSHPKLVKAVQEQVALIQHSMIGY 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       116 -YNNVLGEYEEYITKL--FNYHKVLPMNTGVEAGETACKLARkwgytvkgIQKYKAKIVFAAGNFWGRTLSAISSSTDPT 192
Cdd:PRK05639  93 tHSERAIRVAEKLAEIspIENPKVLFGLSGSDAVDMAIKVSK--------FSTRRPWILAFIGAYHGQTLGATSVAAFQS 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       193 SYD-GFGPFMPGFDIIPYND---------------------LPALE-----RALQDPNVAAFMVEPIQGEAGVVVPDPGY 245
Cdd:PRK05639 165 SQKrGFSPLMPNVVWIPYPNpyrnpwgingyeepdelinrfLDYLEnyvfsHVVPPDEVAALFAEPIQGDAGIVVPPENF 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       246 LMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMlTIKPGEHGSTYGG 325
Cdd:PRK05639 245 FKELKKLLDEHGILLVMDEVQTGIGRTGKWFASEWFEVKPDLIIFGKGVASGM-GLSGVIGRKELM-DLTSGSALLTPAA 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       326 NPLGCRVAIAALEVLEEENLAENADKLG--IILRNELMKLPSDVVTAVRGKGLL-NAIVIKETKDWD---AWKVCLRLRD 399
Cdd:PRK05639 323 NPVISAAAEATLEIIEEENLLKNALKVGefIKKRLLEMKESFEVIGDVRGKGLMiGVEIVKENGKPDpelTGKICWRAFE 402
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|
2OAT_B       400 NGLLAkPTHG---DIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK05639 403 LGLIL-PSYGmfgNVIRITPPLVITKEIAEKGLEIMERAI 441
PRK07483 PRK07483
hypothetical protein; Provisional
53-436 3.18e-56

hypothetical protein; Provisional


Pssm-ID: 236027 [Multi-domain]  Cd Length: 443  Bit Score: 191.70  E-value: 3.18e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        53 HNYHPLPVALeRGKGIYLWDVEGRKYFDfLSSYSAV-NQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEyeEYITKLF 131
Cdd:PRK07483   8 SPRATLPVAV-AGEGIYLIDATGKRYLD-ASGGAAVsCLGHSHPRVIAAIHAQIDRLAYAHTSFFTTEPAE--ALADRLV 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       132 NY-----HKVLPMNTGVEAGETACKLARKwgYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDI 206
Cdd:PRK07483  84 AAapaglEHVYFVSGGSEAVEAALKLARQ--YFVEIGQPQRRHFIARRQSYHGNTLGALAIGGNAWRREPFAPLLIEAHH 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       207 I----PYNDLPA--------------LERALQD---PNVAAFMVEPIQGE-AGVVVPDPGYLMGVRELCTRHQVLFIADE 264
Cdd:PRK07483 162 VspcyAYREQRAgesdeaygqrladeLEAKILElgpDTVAAFVAETVVGAtAGAVPPVPGYFKRIREVCDRYGVLLILDE 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       265 IQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPG----EHGSTYGGNPLGCRVAIAALEVL 340
Cdd:PRK07483 242 VMCGMGRTGTLFACEEDGVAPDLVTIAKGLGAGYQPIGAVLASDRIYDAIADGsgffQHGHTYLGHATACAAALAVQRVI 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       341 EEENLAENADKLGIILRNELM----KLPSdvVTAVRGKGLLNAIVI---KETKD-WD-AWKVCLRLR----DNGLLAKP- 406
Cdd:PRK07483 322 AEDGLLANVRARGEQLRARLRerlgQHPH--VGDIRGRGLFVGVELvadRATKApFDpALKLHARIKreamARGLMVYPm 399
                        410       420       430
                 ....*....|....*....|....*....|....*.
2OAT_B       407 ------THGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK07483 400 ggtidgVRGDHVLLAPPFIITAAQIDEIVERLGDAI 435
PRK09264 PRK09264
diaminobutyrate--2-oxoglutarate aminotransferase; Validated
59-436 3.70e-56

diaminobutyrate--2-oxoglutarate aminotransferase; Validated


Pssm-ID: 236437 [Multi-domain]  Cd Length: 425  Bit Score: 191.15  E-value: 3.70e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        59 PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNAL-----KSQV----DKLTLTSRAFynnvLGEYEEYITK 129
Cdd:PRK09264  22 PVVFDKAKGSWLYDEDGKEYIDFFAGAGALNYGHNNPVLKQALidylqRDGIthglDMHTTAKREF----LETFEETILK 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       130 LFNY-HKV-LPMNTGVEAGETACKLARKwgytVKGiqkyKAKIVFAAGNFWGRTLSAIS-----------------SSTD 190
Cdd:PRK09264  98 PRGLdYKVqFTGPTGTNAVEAALKLARK----VTG----RTNIVAFTNGFHGMTLGSLAvtgnshkrqgagvplnnVTRM 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       191 PtsYDGFgpFMPGFDIIPYndlpaLERALQDPNV-----AAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEI 265
Cdd:PRK09264 170 P--YDGY--FGGDVDTLAY-----LEKLLEDSSSgvdlpAAVIVETVQGEGGINVASAEWLQRLAKLCRKHDILLIVDDI 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       266 QTGLARTGRWLAVDYENVRPDIVLLGKALSG-GLyPVSAVLC--DDDIMltiKPGEHGSTYGGNPLGCRVAIAALEVL-E 341
Cdd:PRK09264 241 QAGCGRTGTFFSFERAGITPDIVTLSKSISGyGL-PMALVLIkpELDVW---KPGEHNGTFRGNNLAFVTATAALEEYwS 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       342 EENLAENADKLGIILRNELMKL---PSDVVTAVRGKGLLNAIvikETKDWD-AWKVCLRLRDNGLLAKP--THGDIIRFA 415
Cdd:PRK09264 317 DDAFEKEVKAKGELVRERLEEIaakYPGLGAEVRGRGMMQGI---DFGDGElAGKIAAEAFENGLIIETsgPEDEVVKLL 393
                        410       420
                 ....*....|....*....|.
2OAT_B       416 PPLVIKEDELRESIEIINKTI 436
Cdd:PRK09264 394 PPLTIDEEELEEGLDILEEAV 414
PRK07480 PRK07480
putative aminotransferase; Validated
52-436 4.76e-56

putative aminotransferase; Validated


Pssm-ID: 180994 [Multi-domain]  Cd Length: 456  Bit Score: 191.65  E-value: 4.76e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        52 AHNYHPL----------PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLtltsrAFYNNVLG 121
Cdd:PRK07480  16 AHHLHPFsdmkalnekgSRVITRAEGVYLWDSEGNKILDGMAGLWCVNVGYGRKELADAAARQMREL-----PYYNTFFK 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       122 EYEEYITKL-----------FNYhkVLPMNTGVEAGETACKLARKWgYTVKGiqKYKAKIVFAAGN-FWGRTLSAISSST 189
Cdd:PRK07480  91 TTHPPAIELaaklaevappgFNH--VFFTNSGSEANDTVLRMVRHY-WALKG--KPQKKVIISRKNgYHGSTVAGASLGG 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       190 DPTSYDGFGPFMPGFDII--PY-----NDLPALE------RALQDP-------NVAAFMVEPIQGEAGVVVPDPGYLMGV 249
Cdd:PRK07480 166 MKYMHEQGDLPIPGIVHIdqPYwfgegGDMTPEEfglaaaRQLEAKilelgadNVAAFIGEPIQGAGGVIIPPATYWPEI 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       250 RELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDI--MLTIKPGE--HGSTYGG 325
Cdd:PRK07480 246 QRICRKYDILLVADEVICGFGRTGEWFGSQHFGIKPDLMTIAKGLTSGYIPMGAVGVGDRVaeVLIEEGGEfnHGFTYSG 325
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       326 NPLGCRVAIAALEVLEEENLAENA-DKLGIILRNELMKLPS-DVVTAVRGKGLLNAIVI---KETKD--WDAWKVCLRLR 398
Cdd:PRK07480 326 HPVAAAVALANLRILRDEGIVERVrDDTGPYLQKRLRELADhPLVGEVRGVGLVGAIELvkdKATRErfEAGGGVGTICR 405
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|..
2OAT_B       399 D----NGLLAKPThGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK07480 406 DhcfaNGLIMRAV-GDRMIISPPLVITHAEIDELVEKARKAL 446
dat TIGR00709
2,4-diaminobutyrate 4-transaminases; This family consists of L-diaminobutyric acid ...
58-436 5.70e-56

2,4-diaminobutyrate 4-transaminases; This family consists of L-diaminobutyric acid transaminases. This general designation covers both 2.6.1.76 (diaminobutyrate-2-oxoglutarate transaminase, which uses glutamate as the amino donor in DABA biosynthesis), and 2.6.1.46 (diaminobutyrate--pyruvate transaminase, which uses alanine as the amino donor). Most members with known function are 2.6.1.76, and at least some annotations as 2.6.1.46 in current databases at time of model revision are incorrect. A distinct branch of this family contains examples of 2.6.1.76 nearly all of which are involved in ectoine biosynthesis. A related enzyme is 4-aminobutyrate aminotransferase (EC 2.6.1.19), also called GABA transaminase. These enzymes all are pyridoxal phosphate-containing class III aminotransferase. [Central intermediary metabolism, Other]


Pssm-ID: 129792 [Multi-domain]  Cd Length: 442  Bit Score: 191.32  E-value: 5.70e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         58 LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDK------LTLT-------SRAFYNNVLGEYE 124
Cdd:TIGR00709  21 LPTAFAKAQGCWVTDVEGKEYLDFLAGAGTLALGHNHPNMKQKILDYLQSglplhtLDLTtplkdafIEALLNIIPKRKM 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        125 EYITKLfnyhkvlPMNTGVEAGETACKLARKwgYTVKGiqkykaKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGF 204
Cdd:TIGR00709 101 DYKLQF-------PGPSGADAVEAAIKLAKT--YTGRT------NVISFSGGFHGMTIGALAVTGNLFAKNAVGMLMPGV 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        205 DIIPY------------------------NDLPALERALQDPnvAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLF 260
Cdd:TIGR00709 166 QFMPYpheyrcpfgiggeagsnasieyfeNFIEDVESGVDKP--AAVILEAIQGEGGVVAAPSEWLQKIREVTRKHDIKL 243
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        261 IADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVsAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVL 340
Cdd:TIGR00709 244 ILDEVQAGFGRSGTMFAFEHAGIEPDFVVMSKAVGGGL-PL-AVLLIAPEFDAWQPAGHTGTFRGNQLAMVTGTEALNYW 321
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        341 EEENLAENADKLGIILRNELMKLPSD--VVTAVRGKGLLNAIVI-KETKDWD-----------AWKVCLRLRDNGLLAKP 406
Cdd:TIGR00709 322 KDDNLAQNAQERGERITSFLDDMIKEhpCIGNVRGRGLMQGIMIvDERQSKDatgayprdcelAAAIQGACFENGLLLET 401
                         410       420       430
                  ....*....|....*....|....*....|..
2OAT_B        407 --THGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:TIGR00709 402 ggREGEVFRLLCPITIDQEECEEGISRFKQAV 433
ectoine_ectB TIGR02407
diaminobutyrate--2-oxoglutarate aminotransferase; Members of this family of class III ...
42-436 2.46e-54

diaminobutyrate--2-oxoglutarate aminotransferase; Members of this family of class III pyridoxal-phosphate-dependent aminotransferases are diaminobutyrate--2-oxoglutarate aminotransferase (EC 2.6.1.76) that catalyze the first step in ectoine biosynthesis from L-aspartate beta-semialdehyde. This family is readily separated phylogenetically from enzymes with the same substrate and product but involved in other process such as siderophore (SP|Q9Z3R2) or 1,3-diaminopropane (SP|P44951) biosynthesis. The family TIGR00709 previously included both groups but has now been revised to exclude the ectoine biosynthesis proteins of this family. Ectoine is a compatible solute particularly effective in conferring salt tolerance. [Cellular processes, Adaptations to atypical conditions]


Pssm-ID: 274117 [Multi-domain]  Cd Length: 412  Bit Score: 185.95  E-value: 2.46e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B         42 DIFErEYKYGAHNY-HPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQV---------DKLTLT 111
Cdd:TIGR02407   1 DIFE-ELESEVRSYcRSFPTVFEKAKGSTLWDEDGKEYIDFFAGAGALNYGHNNPKLKQALIDYLaddgiihslDMATEA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        112 SRAFynnvLGEYEEYITKL--FNYHKVLPMNTGVEAGETACKLARKwgytVKGiqkyKAKIVFAAGNFWGRTLSAISSST 189
Cdd:TIGR02407  80 KREF----LETFNEIILKPrgLDYKVQFPGPTGTNAVESALKLARK----VTG----RSNVVSFTNAFHGMTLGSLSVTG 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        190 DPTSYDGFGPFMPGFDIIPY--------NDLPALERALQDPNV-----AAFMVEPIQGEAGVVVPDPGYLMGVRELCTRH 256
Cdd:TIGR02407 148 NRFKRQGAGVPLSNVSRMPYdgylggdvDTIAYFEKLLEDSSSgvdlpAAVILETVQGEGGINVASDEWLQRLEKLCRRH 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        257 QVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSG-GLyPVSAVLC--DDDIMltiKPGEHGSTYGGNPLGCRVA 333
Cdd:TIGR02407 228 DILLIVDDIQAGCGRTGTFFSFEPAGIEPDIVCLSKSISGyGL-PLALTLIkpELDVW---KPGEHNGTFRGNNLAFVTA 303
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        334 IAALEVL-EEENLAENADKLGIILRNELMKL----PSDVVTaVRGKGLLNAIVIKETKdwDAWKVCLRLRDNGLLAKpTH 408
Cdd:TIGR02407 304 TAALEYYwSDDAFEKAVQRKSEIIQERLDRIvaeyPELIKQ-VRGRGLMQGIECGDGD--LAGKIAKAAFENGLIIE-TS 379
                         410       420       430
                  ....*....|....*....|....*....|.
2OAT_B        409 G---DIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:TIGR02407 380 GpndEVIKLLPPLTIDEETLQQGLDILEQAV 410
PRK06938 PRK06938
diaminobutyrate--2-oxoglutarate aminotransferase; Provisional
58-431 5.48e-54

diaminobutyrate--2-oxoglutarate aminotransferase; Provisional


Pssm-ID: 235892 [Multi-domain]  Cd Length: 464  Bit Score: 186.39  E-value: 5.48e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        58 LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDK------LTLTS---RAFYNNVLGEYEEYIT 128
Cdd:PRK06938  45 IPLALKRARGIYVEDVEGRQFIDCLAGAGTLALGHNHPVVIEAIQQVLADelplhtLDLTTpvkDQFVQDLFASLPEAFA 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       129 KLFNYHKVLPmnTGVEAGETACKLARkwgyTVKGiqkyKAKIVFAAGNFWGRTLSAIS--SSTDPTSYdgFGPFMPGFDI 206
Cdd:PRK06938 125 REAKIQFCGP--TGTDAVEAALKLVK----TATG----RSTVLSFQGGYHGMSQGALSlmGNLGPKKP--LGALLPGVQF 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       207 IPYN-----------------DLPALERALQDPNV-----AAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADE 264
Cdd:PRK06938 193 LPYPydyrcpfglggeagvraNLHYLENLLDDPESgvvlpAAVILEVVQGEGGVIPAPIEWLRGLRRITEEAGIPLIVDE 272
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       265 IQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVSAVLCDDDIMlTIKPGEHGSTYGGNPLGCRVAIAALEVLEEEN 344
Cdd:PRK06938 273 IQSGFGRTGKMFAFEHAGIIPDVVVLSKAIGGSL-PLAVVVYREWLD-TWQPGAHAGTFRGNQMAMAAGSATLRYIKEHR 350
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       345 LAENADKLGIILRNELMKLPSDV--VTAVRGKGL-LNAIVIKETKDWDAW--------------KVCLRlrdNGLLAK-- 405
Cdd:PRK06938 351 LAEHAAAMGERLREHLRQLQRDYpqLGDVRGRGLmLGVEIVDPQGEPDALghppangelasliqRECLR---RGLILElg 427
                        410       420
                 ....*....|....*....|....*.
2OAT_B       406 PTHGDIIRFAPPLVIKEDELRESIEI 431
Cdd:PRK06938 428 GRHGSVVRFLPPLIITAEQIDEVAEI 453
PRK06931 PRK06931
diaminobutyrate--2-oxoglutarate aminotransferase; Provisional
58-438 8.18e-52

diaminobutyrate--2-oxoglutarate aminotransferase; Provisional


Pssm-ID: 235889 [Multi-domain]  Cd Length: 459  Bit Score: 180.72  E-value: 8.18e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        58 LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDK------LTLTS---RAFYNNVL----GEYE 124
Cdd:PRK06931  40 LPLAIAKAQGVWVTDVEGNQYLDCLAGAGTLALGHNHPDVLQSIQDVLTSglplhtLDLTTplkDAFSEYLLsllpGQGK 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       125 EYITKLFNyhkvlPmnTGVEAGETACKLARKwgYTVKGiqkykaKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGF 204
Cdd:PRK06931 120 EYCLQFTG-----P--SGADAVEAAIKLAKT--YTGRS------NVISFSGGYHGMTHGALAVTGNLSPKNAVNGLMPGV 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       205 DIIPY------------------------NDLPALERALQDPnvAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLF 260
Cdd:PRK06931 185 QFMPYpheyrcplgiggeagvkaltyyfeNFIEDVESGVRKP--AAVILEAIQGEGGVNPAPVEWLQKIREVTQKHGILL 262
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       261 IADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLyPVsAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVL 340
Cdd:PRK06931 263 IVDEVQAGFARTGKMFAFEHAGIEPDIIVMSKAVGGGL-PL-AVLGIKKEFDAWQPGGHTGTFRGNQLAMATGLTTLKIL 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       341 EEENLAENADKLGIILRNELMKLPSD--VVTAVRGKGLLNAI-VIKETKDWDAW--------------KVCLrlrDNGLL 403
Cdd:PRK06931 341 KEENLAQNAAERGEWLKAQLAELQKRypCIGNVRGRGLMIGIeIVDERQPADAMgsypadgelaaaiqKACF---ENGLL 417
                        410       420       430
                 ....*....|....*....|....*....|....*..
2OAT_B       404 AKP--THGDIIRFAPPLVIKEDELRESIEIINKTILS 438
Cdd:PRK06931 418 LERggRNGNVVRLLPPLLITQAECEEFIDRFEQALLA 454
PRK06105 PRK06105
aminotransferase; Provisional
52-436 2.18e-51

aminotransferase; Provisional


Pssm-ID: 180401 [Multi-domain]  Cd Length: 460  Bit Score: 179.42  E-value: 2.18e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        52 AHNYHPL----------PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKL----TLTSRAFYN 117
Cdd:PRK06105  14 AYHLHPYtnarrheeegPLVIERGEGIYVYDDAGKRYIEGMAGLWSVALGFSEQRLVEAAARQMKKLpfyhTFSHKSHGP 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       118 NV-LGEyeeyitKLFNYHKVlPM------NTGVEAGETACKLArkWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTD 190
Cdd:PRK06105  94 VIdLAE------KLVAMAPV-PMskvfftNSGSEANDTVVKLV--WYYNNALGRPEKKKIISRQRGYHGVTIASASLTGL 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       191 PTSYDGFG---PFM-------------PG-----FDIIPYNDLPALERAlQDPN-VAAFMVEPIQGEAGVVVPDPGYLMG 248
Cdd:PRK06105 165 PNNHRSFDlplDRIlhtgcphyyrfglPGeseeaFATRLANELEALILA-EGPDtIAAFIGEPVMGAGGVIVPPKTYWEK 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       249 VRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTI-----KPGE--HGS 321
Cdd:PRK06105 244 IQAVLRKYDILLVADEVICGFGRTGNMFGCETFGIKPDILVMSKQLSSSYQPLSAVLMNEKVYDPIadesgKIGTfgHGF 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       322 TYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSD-VVTAVRGKGLLNAIVI---KETKDW--DAWKVCL 395
Cdd:PRK06105 324 TASGHPVAAAVALENLAIIEERDLVGNAAERGARLQARLRALADHpLVGEVRGVGLIAAVELvadKATKTPfePPGKVGA 403
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*
2OAT_B       396 ----RLRDNGLLAKPThGDIIRFAPPLVIKEDELRESIEIINKTI 436
Cdd:PRK06105 404 ranaAAHEHGVISRAM-GDTLAFCPPLIITAAQVDEMVDRFGRAL 447
PRK07678 PRK07678
aminotransferase; Validated
55-426 2.69e-50

aminotransferase; Validated


Pssm-ID: 181078 [Multi-domain]  Cd Length: 451  Bit Score: 176.36  E-value: 2.69e-50
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B        55 YHP-LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLtltsrAFY----------------N 117
Cdd:PRK07678  25 YNPnATMVVAKAEGAWVTDIQGNRYLDGMSGLWCVNVGYGRKELAEAAYEQLKTL-----SYFpltqshepaiklaeklN 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       118 NVLGEyeEYITkLFNyhkvlpmNTGVEAGETACKLARKWgYTVKG-------IQKYKAkivfAAGNFWGrTLSAISSSTD 190
Cdd:PRK07678 100 EWLGG--EYVI-FFS-------NSGSEANETAFKIARQY-HAQKGephrykfISRYRA----YHGNSMG-ALAATGQAQR 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OAT_B       191 PTSYDGFGP-F----------MPGFDIIPYN