NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|261278557|pdb|2WML|A]
View 

Chain A, Cmp-n-acetylneuraminate-beta-galactosamide -alpha-2,3-sialyltransferase

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Glyco_transf_29 pfam00777
Glycosyltransferase family 29 (sialyltransferase). Members of this family belong to ...
41-296 1.10e-106

Glycosyltransferase family 29 (sialyltransferase). Members of this family belong to glycosyltransferase family 29.


:

Pssm-ID: 366297  Cd Length: 266  Bit Score: 311.07  E-value: 1.10e-106
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WML_A         41 QPLLTAKNAHLEEDTYKWWlrlqREKKpnNLNDTIRELFQVVPGNVDPLLEKRLVSCRRCAVVGNSGNLKESYYGPQIDS 120
Cdd:pfam00777   1 PPFLTKENTPLGEDLRYWW----GEFK--GSYEVLEELFKLLPKPDSPFSNKRPDRCRRCAVVGNGGILRGSGCGKEIDS 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WML_A        121 HDFVLR*NKAPTEGFEADVGSKTTHHFVYPES--------FRELAQEVS*ILVPFKTTDLEWVISATTTGRIS-----HT 187
Cdd:pfam00777  75 HDFVIRCNLAPTKGYEKDVGSKTTLRTMYPESiiqsfgglKVPLDRDTFLVLLPFKGLDFLWLPAFLTKGEVSlwvryFF 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WML_A        188 YVPVPAKIKVKKEKILIYHPAFIKYVFDRWLQGHG---RYPSTGILSVIFSLHICDEVDLYGFGA--DSKGNWHHYWENn 262
Cdd:pfam00777 155 WKRVKSKIPADPDKVRILNPDFLRYVANFWLRGKGwkaRRPSTGALALTLALHLCDEVSLYGFGPflDHPGNSHHYYDN- 233
                         250       260       270
                  ....*....|....*....|....*....|....
2WML_A        263 pSAGAFRKTGVHDGDFESNVTTILASINKIRIFK 296
Cdd:pfam00777 234 -KMGAMRFTGVHDMPEEFKLLKKLHKEGVIKLHT 266
 
Name Accession Description Interval E-value
Glyco_transf_29 pfam00777
Glycosyltransferase family 29 (sialyltransferase). Members of this family belong to ...
41-296 1.10e-106

Glycosyltransferase family 29 (sialyltransferase). Members of this family belong to glycosyltransferase family 29.


Pssm-ID: 366297  Cd Length: 266  Bit Score: 311.07  E-value: 1.10e-106
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WML_A         41 QPLLTAKNAHLEEDTYKWWlrlqREKKpnNLNDTIRELFQVVPGNVDPLLEKRLVSCRRCAVVGNSGNLKESYYGPQIDS 120
Cdd:pfam00777   1 PPFLTKENTPLGEDLRYWW----GEFK--GSYEVLEELFKLLPKPDSPFSNKRPDRCRRCAVVGNGGILRGSGCGKEIDS 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WML_A        121 HDFVLR*NKAPTEGFEADVGSKTTHHFVYPES--------FRELAQEVS*ILVPFKTTDLEWVISATTTGRIS-----HT 187
Cdd:pfam00777  75 HDFVIRCNLAPTKGYEKDVGSKTTLRTMYPESiiqsfgglKVPLDRDTFLVLLPFKGLDFLWLPAFLTKGEVSlwvryFF 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WML_A        188 YVPVPAKIKVKKEKILIYHPAFIKYVFDRWLQGHG---RYPSTGILSVIFSLHICDEVDLYGFGA--DSKGNWHHYWENn 262
Cdd:pfam00777 155 WKRVKSKIPADPDKVRILNPDFLRYVANFWLRGKGwkaRRPSTGALALTLALHLCDEVSLYGFGPflDHPGNSHHYYDN- 233
                         250       260       270
                  ....*....|....*....|....*....|....
2WML_A        263 pSAGAFRKTGVHDGDFESNVTTILASINKIRIFK 296
Cdd:pfam00777 234 -KMGAMRFTGVHDMPEEFKLLKKLHKEGVIKLHT 266
 
Name Accession Description Interval E-value
Glyco_transf_29 pfam00777
Glycosyltransferase family 29 (sialyltransferase). Members of this family belong to ...
41-296 1.10e-106

Glycosyltransferase family 29 (sialyltransferase). Members of this family belong to glycosyltransferase family 29.


Pssm-ID: 366297  Cd Length: 266  Bit Score: 311.07  E-value: 1.10e-106
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WML_A         41 QPLLTAKNAHLEEDTYKWWlrlqREKKpnNLNDTIRELFQVVPGNVDPLLEKRLVSCRRCAVVGNSGNLKESYYGPQIDS 120
Cdd:pfam00777   1 PPFLTKENTPLGEDLRYWW----GEFK--GSYEVLEELFKLLPKPDSPFSNKRPDRCRRCAVVGNGGILRGSGCGKEIDS 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WML_A        121 HDFVLR*NKAPTEGFEADVGSKTTHHFVYPES--------FRELAQEVS*ILVPFKTTDLEWVISATTTGRIS-----HT 187
Cdd:pfam00777  75 HDFVIRCNLAPTKGYEKDVGSKTTLRTMYPESiiqsfgglKVPLDRDTFLVLLPFKGLDFLWLPAFLTKGEVSlwvryFF 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WML_A        188 YVPVPAKIKVKKEKILIYHPAFIKYVFDRWLQGHG---RYPSTGILSVIFSLHICDEVDLYGFGA--DSKGNWHHYWENn 262
Cdd:pfam00777 155 WKRVKSKIPADPDKVRILNPDFLRYVANFWLRGKGwkaRRPSTGALALTLALHLCDEVSLYGFGPflDHPGNSHHYYDN- 233
                         250       260       270
                  ....*....|....*....|....*....|....
2WML_A        263 pSAGAFRKTGVHDGDFESNVTTILASINKIRIFK 296
Cdd:pfam00777 234 -KMGAMRFTGVHDMPEEFKLLKKLHKEGVIKLHT 266
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH