NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|195927533|pdb|3DAX|B]
View 

Chain B, Cytochrome P450 7A1

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
15-480 1.26e-98

Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


:

Pssm-ID: 365848  Cd Length: 458  Bit Score: 304.58  E-value: 1.26e-98
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B         15 PPLENGLiPYLGCALQFG--ANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKY---FDWKKFHFATSA 89
Cdd:pfam00067   1 PPGPPPL-PLFGNLLQLGrgGNLHSVFTKLQKKYGPIFRLYLGPKPTVVLSGPEAVKEVLIKKGEefsGRPDEPWFATSR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B         90 KAFGHRSIDPMDGNTTENINDTFIKTLQGHA---LNSLTESMMENLQRIMRPPVSSNS--KTAAWVTEGMYSFCYRVMFE 164
Cdd:pfam00067  80 GPFLGKGILFANGPRWRQLRRFLTPTFRSFGklkFEPRVQEEARDLVEKLRKTAGQPGviDITFLLFRAALNVICSILFG 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        165 AGYLTIFGRDLTRRDTQKAHILNNLDNF-KQFDKVFPALvAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLR 243
Cdd:pfam00067 160 ERFGSLEDPKFLELVKAVQELFSLLSSPsPQLLDLFPIL-KYFPGKHGRKLKRARKKLKDLLDKLIEERRETLDSAGSPR 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        244 MFLNDTLS-------TFDDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLenagqkvsleGNPI 316
Cdd:pfam00067 239 DFLDALLLakekdgeKLTDEELRATVLDLFFAGTDTTSSTLSWALYELAKNPEVQEKLREEIDEVI----------GDKR 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        317 CLSQAELNDLPVLDSIIKESLRLSSAS-LNI-RTAKEDFTLhledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDR 394
Cdd:pfam00067 309 SPTYDDLQNMPYLDAVIKETLRLHPVVpLLLpREVTKDTVI----PGYLIPKGTLVIVNLYALHRDPKVFPNPEEFDPER 384
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        395 YLDENGKTKTtfycnglklKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSragLGILPP 474
Cdd:pfam00067 385 FLDENGNFRK---------SFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGVDPPDIDETP---LLLPPK 452

                  ....*.
3DAX_B        475 LNDIEF 480
Cdd:pfam00067 453 PYKLKF 458
 
Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
15-480 1.26e-98

Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


Pssm-ID: 365848  Cd Length: 458  Bit Score: 304.58  E-value: 1.26e-98
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B         15 PPLENGLiPYLGCALQFG--ANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKY---FDWKKFHFATSA 89
Cdd:pfam00067   1 PPGPPPL-PLFGNLLQLGrgGNLHSVFTKLQKKYGPIFRLYLGPKPTVVLSGPEAVKEVLIKKGEefsGRPDEPWFATSR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B         90 KAFGHRSIDPMDGNTTENINDTFIKTLQGHA---LNSLTESMMENLQRIMRPPVSSNS--KTAAWVTEGMYSFCYRVMFE 164
Cdd:pfam00067  80 GPFLGKGILFANGPRWRQLRRFLTPTFRSFGklkFEPRVQEEARDLVEKLRKTAGQPGviDITFLLFRAALNVICSILFG 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        165 AGYLTIFGRDLTRRDTQKAHILNNLDNF-KQFDKVFPALvAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLR 243
Cdd:pfam00067 160 ERFGSLEDPKFLELVKAVQELFSLLSSPsPQLLDLFPIL-KYFPGKHGRKLKRARKKLKDLLDKLIEERRETLDSAGSPR 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        244 MFLNDTLS-------TFDDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLenagqkvsleGNPI 316
Cdd:pfam00067 239 DFLDALLLakekdgeKLTDEELRATVLDLFFAGTDTTSSTLSWALYELAKNPEVQEKLREEIDEVI----------GDKR 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        317 CLSQAELNDLPVLDSIIKESLRLSSAS-LNI-RTAKEDFTLhledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDR 394
Cdd:pfam00067 309 SPTYDDLQNMPYLDAVIKETLRLHPVVpLLLpREVTKDTVI----PGYLIPKGTLVIVNLYALHRDPKVFPNPEEFDPER 384
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        395 YLDENGKTKTtfycnglklKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSragLGILPP 474
Cdd:pfam00067 385 FLDENGNFRK---------SFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGVDPPDIDETP---LLLPPK 452

                  ....*.
3DAX_B        475 LNDIEF 480
Cdd:pfam00067 453 PYKLKF 458
PLN02196 PLN02196
abscisic acid 8'-hydroxylase
8-456 1.07e-21

abscisic acid 8'-hydroxylase


Pssm-ID: 177847  Cd Length: 463  Bit Score: 97.31  E-value: 1.07e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B         8 RRRQTGEPPLENGLI--PYLGCALQ-FGANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFdWKKFH 84
Cdd:PLN02196  27 RRSSSTKLPLPPGTMgwPYVGETFQlYSQDPNVFFASKQKRYGSVFKTHVLGCPCVMISSPEAAKFVLVTKSHL-FKPTF 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        85 FATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALnsltESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMFe 164
Cdd:PLN02196 106 PASKERMLGKQAIFFHQGDYHAKLRKLVLRAFMPDAI----RNMVPDIESIAQESLNSWEGTQINTYQEMKTYTFNVAL- 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       165 agyLTIFGRD--LTRRDTQKAHILnnldnfkqFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELisl 242
Cdd:PLN02196 181 ---LSIFGKDevLYREDLKRCYYI--------LEKGYNSMPINLPGTLFHKSMKARKELAQILAKILSKRRQNGSSH--- 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       243 rmflNDTLSTF-------DDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEvkrtlENAGQKVSLEGNp 315
Cdd:PLN02196 247 ----NDLLGSFmgdkeglTDEQIADNIIGVIFAARDTTASVLTWILKYLAENPSVLEAVTEE-----QMAIRKDKEEGE- 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       316 iCLSQAELNDLPVLDSIIKESLRLSSA-SLNIRTAKEDftlhLEDGSYNIRKD-DIIALYPQLMHlDPEIYPDPLTFKYD 393
Cdd:PLN02196 317 -SLTWEDTKKMPLTSRVIQETLRVASIlSFTFREAVED----VEYEGYLIPKGwKVLPLFRNIHH-SADIFSDPGKFDPS 390
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
3DAX_B       394 RYldENGKTKTTFycnglklkyyyMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQ 456
Cdd:PLN02196 391 RF--EVAPKPNTF-----------MPFGNGTHSCPGNELAKLEISVLIHHLTTKYRWSIVGTS 440
CypX COG2124
Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense ...
35-455 3.81e-19

Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense mechanisms];


Pssm-ID: 225035 [Multi-domain]  Cd Length: 411  Bit Score: 89.41  E-value: 3.81e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       35 PLEFLRANQRKHGHVFTCKLMGKY--VHFITNPLSYHKVLCHGKYFdwKKFHFATSAKAFGHRSIDPMDGNTTENINDTF 112
Cdd:COG2124  24 PRFFLERAEDPYGDYFTLRLPGPGdgFWVVSRPADVREVLRDPRFF--SSALGAGLRPRLLRPVLGDGSLLTLDGPEHTR 101
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B      113 IKTLqghaLN-SLTESMMENLQRIMRPPV-----SSNSKTAAWVTEGMYSFCYRVMfeagyLTIFGRDLTRRDTQKAHIL 186
Cdd:COG2124 102 LRKL----LApAFTPRALRGYRPLIREIAdrlldDLWQGGADLVLDFAAELTLRVI-----AELLGVPLEDRPQLLRWSD 172
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B      187 NNLDNFKQFDkvfpalvagLPIHMFRTAHNAREKLAESLRHEnLQKR--ESISELISLRMFLNDT-LSTFDDLEKAKTHL 263
Cdd:COG2124 173 ALLLRLDPDL---------GPEEPWRRARAARRELDAYLRAL-IAERraAPRDDLLSLLLSAEDDgGGRLSDDEIRDELI 242
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B      264 VVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAgqkvslegnpiclsqaelndlpvldsIIKESLRL-SSA 342
Cdd:COG2124 243 TLLVAGHETTANALAWALYALLRHPDQLAKLRAEPDRPLLEA--------------------------VVEETLRLyPPV 296
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B      343 SLNIRTAKEDFTLhledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDEngktkttfycnglklkyyYMPFGS 422
Cdd:COG2124 297 PLARRVATEDVEL----GGYRIPAGTVVLLSIGAANRDPEVFPDPDEFDPERFNNA------------------HLPFGG 354
                       410       420       430
                ....*....|....*....|....*....|...
3DAX_B      423 GATICPGRLFAIHEIKQFLILMLSYFELELIEG 455
Cdd:COG2124 355 GPHRCLGAALARLELKVALAELLRRFPLLLLAE 387
P450_cycloAA_1 TIGR04538
cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome ...
293-437 7.48e-10

cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome P450 enzymes that occur next to tRNA-dependent cyclodipeptide synthases. This group does NOT include CYP121 (Rv2275) from Mycobacterium tuberculosis, adjacent to the cyclodityrosine synthetase Rv2276.


Pssm-ID: 275331  Cd Length: 395  Bit Score: 60.51  E-value: 7.48e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        293 AATEEVKRTLenAGQKVSLEGNPICLsQAELNDLPVLDSIIKESLRLSS-ASLNIRTAKEDFTLHledgSYNIRKDDIIA 371
Cdd:TIGR04538 225 AATEPADKTL--AYMIYHLLNNPEQL-NDVLDDRKLLRRAIAETLRLHSpVQLIPRQLSQDVTIS----GKEIKKGDTVF 297
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
3DAX_B        372 LYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTfycnglklKYYYMPFGSGATICPGRLFAIHEI 437
Cdd:TIGR04538 298 CMIGAANRDPEAFEDPDEFNIHRKDLVNKSAFTG--------AARHLAFGSGVHNCVGAAFAKRQL 355
 
Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
15-480 1.26e-98

Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


Pssm-ID: 365848  Cd Length: 458  Bit Score: 304.58  E-value: 1.26e-98
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B         15 PPLENGLiPYLGCALQFG--ANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKY---FDWKKFHFATSA 89
Cdd:pfam00067   1 PPGPPPL-PLFGNLLQLGrgGNLHSVFTKLQKKYGPIFRLYLGPKPTVVLSGPEAVKEVLIKKGEefsGRPDEPWFATSR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B         90 KAFGHRSIDPMDGNTTENINDTFIKTLQGHA---LNSLTESMMENLQRIMRPPVSSNS--KTAAWVTEGMYSFCYRVMFE 164
Cdd:pfam00067  80 GPFLGKGILFANGPRWRQLRRFLTPTFRSFGklkFEPRVQEEARDLVEKLRKTAGQPGviDITFLLFRAALNVICSILFG 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        165 AGYLTIFGRDLTRRDTQKAHILNNLDNF-KQFDKVFPALvAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLR 243
Cdd:pfam00067 160 ERFGSLEDPKFLELVKAVQELFSLLSSPsPQLLDLFPIL-KYFPGKHGRKLKRARKKLKDLLDKLIEERRETLDSAGSPR 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        244 MFLNDTLS-------TFDDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLenagqkvsleGNPI 316
Cdd:pfam00067 239 DFLDALLLakekdgeKLTDEELRATVLDLFFAGTDTTSSTLSWALYELAKNPEVQEKLREEIDEVI----------GDKR 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        317 CLSQAELNDLPVLDSIIKESLRLSSAS-LNI-RTAKEDFTLhledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDR 394
Cdd:pfam00067 309 SPTYDDLQNMPYLDAVIKETLRLHPVVpLLLpREVTKDTVI----PGYLIPKGTLVIVNLYALHRDPKVFPNPEEFDPER 384
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        395 YLDENGKTKTtfycnglklKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSragLGILPP 474
Cdd:pfam00067 385 FLDENGNFRK---------SFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGVDPPDIDETP---LLLPPK 452

                  ....*.
3DAX_B        475 LNDIEF 480
Cdd:pfam00067 453 PYKLKF 458
PLN02196 PLN02196
abscisic acid 8'-hydroxylase
8-456 1.07e-21

abscisic acid 8'-hydroxylase


Pssm-ID: 177847  Cd Length: 463  Bit Score: 97.31  E-value: 1.07e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B         8 RRRQTGEPPLENGLI--PYLGCALQ-FGANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFdWKKFH 84
Cdd:PLN02196  27 RRSSSTKLPLPPGTMgwPYVGETFQlYSQDPNVFFASKQKRYGSVFKTHVLGCPCVMISSPEAAKFVLVTKSHL-FKPTF 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        85 FATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALnsltESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMFe 164
Cdd:PLN02196 106 PASKERMLGKQAIFFHQGDYHAKLRKLVLRAFMPDAI----RNMVPDIESIAQESLNSWEGTQINTYQEMKTYTFNVAL- 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       165 agyLTIFGRD--LTRRDTQKAHILnnldnfkqFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELisl 242
Cdd:PLN02196 181 ---LSIFGKDevLYREDLKRCYYI--------LEKGYNSMPINLPGTLFHKSMKARKELAQILAKILSKRRQNGSSH--- 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       243 rmflNDTLSTF-------DDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEvkrtlENAGQKVSLEGNp 315
Cdd:PLN02196 247 ----NDLLGSFmgdkeglTDEQIADNIIGVIFAARDTTASVLTWILKYLAENPSVLEAVTEE-----QMAIRKDKEEGE- 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       316 iCLSQAELNDLPVLDSIIKESLRLSSA-SLNIRTAKEDftlhLEDGSYNIRKD-DIIALYPQLMHlDPEIYPDPLTFKYD 393
Cdd:PLN02196 317 -SLTWEDTKKMPLTSRVIQETLRVASIlSFTFREAVED----VEYEGYLIPKGwKVLPLFRNIHH-SADIFSDPGKFDPS 390
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
3DAX_B       394 RYldENGKTKTTFycnglklkyyyMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQ 456
Cdd:PLN02196 391 RF--EVAPKPNTF-----------MPFGNGTHSCPGNELAKLEISVLIHHLTTKYRWSIVGTS 440
CypX COG2124
Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense ...
35-455 3.81e-19

Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense mechanisms];


Pssm-ID: 225035 [Multi-domain]  Cd Length: 411  Bit Score: 89.41  E-value: 3.81e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       35 PLEFLRANQRKHGHVFTCKLMGKY--VHFITNPLSYHKVLCHGKYFdwKKFHFATSAKAFGHRSIDPMDGNTTENINDTF 112
Cdd:COG2124  24 PRFFLERAEDPYGDYFTLRLPGPGdgFWVVSRPADVREVLRDPRFF--SSALGAGLRPRLLRPVLGDGSLLTLDGPEHTR 101
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B      113 IKTLqghaLN-SLTESMMENLQRIMRPPV-----SSNSKTAAWVTEGMYSFCYRVMfeagyLTIFGRDLTRRDTQKAHIL 186
Cdd:COG2124 102 LRKL----LApAFTPRALRGYRPLIREIAdrlldDLWQGGADLVLDFAAELTLRVI-----AELLGVPLEDRPQLLRWSD 172
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B      187 NNLDNFKQFDkvfpalvagLPIHMFRTAHNAREKLAESLRHEnLQKR--ESISELISLRMFLNDT-LSTFDDLEKAKTHL 263
Cdd:COG2124 173 ALLLRLDPDL---------GPEEPWRRARAARRELDAYLRAL-IAERraAPRDDLLSLLLSAEDDgGGRLSDDEIRDELI 242
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B      264 VVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAgqkvslegnpiclsqaelndlpvldsIIKESLRL-SSA 342
Cdd:COG2124 243 TLLVAGHETTANALAWALYALLRHPDQLAKLRAEPDRPLLEA--------------------------VVEETLRLyPPV 296
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B      343 SLNIRTAKEDFTLhledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDEngktkttfycnglklkyyYMPFGS 422
Cdd:COG2124 297 PLARRVATEDVEL----GGYRIPAGTVVLLSIGAANRDPEVFPDPDEFDPERFNNA------------------HLPFGG 354
                       410       420       430
                ....*....|....*....|....*....|...
3DAX_B      423 GATICPGRLFAIHEIKQFLILMLSYFELELIEG 455
Cdd:COG2124 355 GPHRCLGAALARLELKVALAELLRRFPLLLLAE 387
PLN02302 PLN02302
ent-kaurenoic acid oxidase
203-451 2.19e-13

ent-kaurenoic acid oxidase


Pssm-ID: 215171  Cd Length: 490  Bit Score: 72.05  E-value: 2.19e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       203 VAGLPIHMFRTAHN----AREKLAESLRHENLQKRESISELISLRMflNDTLS-----------TFDDLEKAKTHLVVLW 267
Cdd:PLN02302 220 VRAMAINLPGFAYHralkARKKLVALFQSIVDERRNSRKQNISPRK--KDMLDllldaedengrKLDDEEIIDLLLMYLN 297
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       268 ASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLEN--AGQKVslegnpicLSQAELNDLPVLDSIIKESLRLSSASLN 345
Cdd:PLN02302 298 AGHESSGHLTMWATIFLQEHPEVLQKAKAEQEEIAKKrpPGQKG--------LTLKDVRKMEYLSQVIDETLRLINISLT 369
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       346 I-RTAKEDFTLhledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTtfycnglklkyyYMPFGSGA 424
Cdd:PLN02302 370 VfREAKTDVEV----NGYTIPKGWKVLAWFRQVHMDPEVYPNPKEFDPSRWDNYTPKAGT------------FLPFGLGS 433
                        250       260
                 ....*....|....*....|....*..
3DAX_B       425 TICPGRLFAIHEIKQFLILMLSYFELE 451
Cdd:PLN02302 434 RLCPGNDLAKLEISIFLHHFLLGYRLE 460
PLN02687 PLN02687
flavonoid 3'-monooxygenase
279-456 9.42e-13

flavonoid 3'-monooxygenase


Pssm-ID: 215371  Cd Length: 517  Bit Score: 70.23  E-value: 9.42e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       279 WSLFQMIRNPEAMKAATEEVKrtlenagqkvSLEGNPICLSQAELNDLPVLDSIIKESLRL-SSASLNI-RTAKEDftlh 356
Cdd:PLN02687 319 WAIAELIRHPDILKKAQEELD----------AVVGRDRLVSESDLPQLTYLQAVIKETFRLhPSTPLSLpRMAAEE---- 384
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       357 LEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLkyyyMPFGSGATICPGRLFAIHE 436
Cdd:PLN02687 385 CEINGYHIPKGATLLVNVWAIARDPEQWPDPLEFRPDRFLPGGEHAGVDVKGSDFEL----IPFGAGRRICAGLSWGLRM 460
                        170       180
                 ....*....|....*....|
3DAX_B       437 IKQFLILMLSYFELELIEGQ 456
Cdd:PLN02687 461 VTLLTATLVHAFDWELADGQ 480
PLN02394 PLN02394
trans-cinnamate 4-monooxygenase
274-468 1.99e-11

trans-cinnamate 4-monooxygenase


Pssm-ID: 215221  Cd Length: 503  Bit Score: 65.91  E-value: 1.99e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       274 IPATFWS----LFQMIRNPEAMKAATEEVKRTLEnagqkvslEGNPIclSQAELNDLPVLDSIIKESLRLSSA------S 343
Cdd:PLN02394 306 IETTLWSiewgIAELVNHPEIQKKLRDELDTVLG--------PGNQV--TEPDTHKLPYLQAVVKETLRLHMAipllvpH 375
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       344 LNIRTAKEdftlhledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTfycnglKLKYYYMPFGSG 423
Cdd:PLN02394 376 MNLEDAKL--------GGYDIPAESKILVNAWWLANNPELWKNPEEFRPERFLEEEAKVEAN------GNDFRFLPFGVG 441
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
3DAX_B       424 ATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKcppLDQSRAG 468
Cdd:PLN02394 442 RRSCPGIILALPILGIVLGRLVQNFELLPPPGQSK---IDVSEKG 483
PLN02655 PLN02655
ent-kaurene oxidase
167-456 2.35e-11

ent-kaurene oxidase


Pssm-ID: 215354  Cd Length: 466  Bit Score: 65.53  E-value: 2.35e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       167 YLTIFGRDLTRRDTQKAHILNNLDNFKQFD--KVFPALvAGLPIHMF----RTAHNAREKLAESLRHENLQKRESISELI 240
Cdd:PLN02655 167 YVEELGTEISKEEIFDVLVHDMMMCAIEVDwrDFFPYL-SWIPNKSFetrvQTTEFRRTAVMKALIKQQKKRIARGEERD 245
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       241 SLRMFLNDTLSTFDDlekaKTHLVVLW----ASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLenAGQKVSLEgnpi 316
Cdd:PLN02655 246 CYLDFLLSEATHLTD----EQLMMLVWepiiEAADTTLVTTEWAMYELAKNPDKQERLYREIREVC--GDERVTEE---- 315
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       317 clsqaELNDLPVLDSIIKESLRLSSAS--LNIRTAKEDFTLhledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDR 394
Cdd:PLN02655 316 -----DLPNLPYLNAVFHETLRKYSPVplLPPRFVHEDTTL----GGYDIPAGTQIAINIYGCNMDKKRWENPEEWDPER 386
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
3DAX_B       395 YLDENGKTKTtfycnglklKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQ 456
Cdd:PLN02655 387 FLGEKYESAD---------MYKTMAFGAGKRVCAGSLQAMLIACMAIARLVQEFEWRLREGD 439
PLN02936 PLN02936
epsilon-ring hydroxylase
254-456 2.50e-11

epsilon-ring hydroxylase


Pssm-ID: 178524  Cd Length: 489  Bit Score: 65.58  E-value: 2.50e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       254 DDLekakthLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLEnaGQKVSLEgnpiclsqaELNDLPVLDSII 333
Cdd:PLN02936 281 DDL------LSMLVAGHETTGSVLTWTLYLLSKNPEALRKAQEELDRVLQ--GRPPTYE---------DIKELKYLTRCI 343
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       334 KESLRL-SSASLNIRTAKEDFTLhleDGSYNIRK--DDIIALYPqlMHLDPEIYPDPLTFKYDRYLDENGKTkttfycNG 410
Cdd:PLN02936 344 NESMRLyPHPPVLIRRAQVEDVL---PGGYKVNAgqDIMISVYN--IHRSPEVWERAEEFVPERFDLDGPVP------NE 412
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
3DAX_B       411 LKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQ 456
Cdd:PLN02936 413 TNTDFRYIPFSGGPRKCVGDQFALLEAIVALAVLLQRLDLELVPDQ 458
PLN00110 PLN00110
flavonoid 3',5'-hydroxylase (F3'5'H); Provisional
260-455 3.70e-11

flavonoid 3',5'-hydroxylase (F3'5'H); Provisional


Pssm-ID: 177725  Cd Length: 504  Bit Score: 64.87  E-value: 3.70e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       260 KTHLVVLWASQANTIPATF-WSLFQMIRNPEAMKAATEEVKRTLenagqkvsleGNPICLSQAELNDLPVLDSIIKESLR 338
Cdd:PLN00110 291 KALLLNLFTAGTDTSSSVIeWSLAEMLKNPSILKRAHEEMDQVI----------GRNRRLVESDLPKLPYLQAICKESFR 360
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       339 L-SSASLNI-RTAKEdftlHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENgKTKTTFYCNGLKLkyy 416
Cdd:PLN00110 361 KhPSTPLNLpRVSTQ----ACEVNGYYIPKNTRLSVNIWAIGRDPDVWENPEEFRPERFLSEK-NAKIDPRGNDFEL--- 432
                        170       180       190
                 ....*....|....*....|....*....|....*....
3DAX_B       417 yMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEG 455
Cdd:PLN00110 433 -IPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWKLPDG 470
PLN02987 PLN02987
Cytochrome P450, family 90, subfamily A
6-448 3.99e-11

Cytochrome P450, family 90, subfamily A


Pssm-ID: 166628  Cd Length: 472  Bit Score: 65.00  E-value: 3.99e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B         6 SSRRRQTGEPPLENGLiPYLGCALQF-----GANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCH-GKYFD 79
Cdd:PLN02987  23 RTRYRRMRLPPGSLGL-PLVGETLQLisaykTENPEPFIDERVARYGSLFMTHLFGEPTVFSADPETNRFILQNeGKLFE 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        80 WKkfHFATSAKAFGHRSIDPMDGNTTENINdtfikTLQGHALNS--LTESMMENLQRIMRPPVSSNSKTAAWVTEGMysf 157
Cdd:PLN02987 102 CS--YPGSISNLLGKHSLLLMKGNLHKKMH-----SLTMSFANSsiIKDHLLLDIDRLIRFNLDSWSSRVLLMEEAK--- 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       158 cyRVMFEagyLTIfgRDLTRRDT-------QKAHILNnLDNFkqFDKVFPALVAglpihMFRTAHNAREKLAESLRHENL 230
Cdd:PLN02987 172 --KITFE---LTV--KQLMSFDPgewteslRKEYVLV-IEGF--FSVPLPLFST-----TYRRAIQARTKVAEALTLVVM 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       231 QKRESISELISLRmflNDTLST-------FDDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLE 303
Cdd:PLN02987 237 KRRKEEEEGAEKK---KDMLAAllasddgFSDEEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEKIRA 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       304 NAGQKVSLEgnpiclsQAELNDLPVLDSIIKESLRLSSASLNI-RTAKEDftlhLEDGSYNIRKDDIIALYPQLMHLDPE 382
Cdd:PLN02987 314 MKSDSYSLE-------WSDYKSMPFTQCVVNETLRVANIIGGIfRRAMTD----IEVKGYTIPKGWKVFASFRAVHLDHE 382
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
3DAX_B       383 IYPDPLTFKYDRYLDENGKTkttfyCNGlklkYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYF 448
Cdd:PLN02987 383 YFKDARTFNPWRWQSNSGTT-----VPS----NVFTPFGGGPRLCPGYELARVALSVFLHRLVTRF 439
P450_cycloAA_1 TIGR04538
cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome ...
293-437 7.48e-10

cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome P450 enzymes that occur next to tRNA-dependent cyclodipeptide synthases. This group does NOT include CYP121 (Rv2275) from Mycobacterium tuberculosis, adjacent to the cyclodityrosine synthetase Rv2276.


Pssm-ID: 275331  Cd Length: 395  Bit Score: 60.51  E-value: 7.48e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B        293 AATEEVKRTLenAGQKVSLEGNPICLsQAELNDLPVLDSIIKESLRLSS-ASLNIRTAKEDFTLHledgSYNIRKDDIIA 371
Cdd:TIGR04538 225 AATEPADKTL--AYMIYHLLNNPEQL-NDVLDDRKLLRRAIAETLRLHSpVQLIPRQLSQDVTIS----GKEIKKGDTVF 297
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
3DAX_B        372 LYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTfycnglklKYYYMPFGSGATICPGRLFAIHEI 437
Cdd:TIGR04538 298 CMIGAANRDPEAFEDPDEFNIHRKDLVNKSAFTG--------AARHLAFGSGVHNCVGAAFAKRQL 355
PLN03234 PLN03234
cytochrome P450 83B1; Provisional
231-455 2.14e-09

cytochrome P450 83B1; Provisional


Pssm-ID: 178773  Cd Length: 499  Bit Score: 59.32  E-value: 2.14e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       231 QKRESISELIsLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATF-WSLFQMIRNPEAMKAATEEVKRTLENAGQkv 309
Cdd:PLN03234 262 QETESFIDLL-MQIYKDQPFSIKFTHENVKAMILDIVVPGTDTAAAVVvWAMTYLIKYPEAMKKAQDEVRNVIGDKGY-- 338
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       310 slegnpicLSQAELNDLPVLDSIIKESLRLSSAsLNIRTAKEDFTlHLEDGSYNIRKDDIIALYPQLMHLDPEIYPD-PL 388
Cdd:PLN03234 339 --------VSEEDIPNLPYLKAVIKESLRLEPV-IPILLHRETIA-DAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDnPN 408
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       389 TFKYDRYLDENgktkttfycNGLKLK---YYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEG 455
Cdd:PLN03234 409 EFIPERFMKEH---------KGVDFKgqdFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKG 469
PLN02971 PLN02971
tryptophan N-hydroxylase
232-465 3.63e-09

tryptophan N-hydroxylase


Pssm-ID: 166612  Cd Length: 543  Bit Score: 58.90  E-value: 3.63e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       232 KRESISELISLRMFLNDT----LSTFDDLEKAKTHLVVlwASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLenagq 307
Cdd:PLN02971 300 KRTQIEDFLDIFISIKDEagqpLLTADEIKPTIKELVM--AAPDNPSNAVEWAMAEMINKPEILHKAMEEIDRVV----- 372
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       308 kvsleGNPICLSQAELNDLPVLDSIIKESLRLSS-ASLNI-RTAKEDFTLhledGSYNIRKDDIIALYPQLMHLDPEIYP 385
Cdd:PLN02971 373 -----GKERFVQESDIPKLNYVKAIIREAFRLHPvAAFNLpHVALSDTTV----AGYHIPKGSQVLLSRYGLGRNPKVWS 443
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       386 DPLTFKYDRYLDENgkTKTTFYCNGLKlkyyYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQS 465
Cdd:PLN02971 444 DPLSFKPERHLNEC--SEVTLTENDLR----FISFSTGKRGCAAPALGTAITTMMLARLLQGFKWKLAGSETRVELMESS 517
PLN02774 PLN02774
brassinosteroid-6-oxidase
190-455 1.50e-08

brassinosteroid-6-oxidase


Pssm-ID: 178373  Cd Length: 463  Bit Score: 56.71  E-value: 1.50e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       190 DNFK-QFDKvfpaLVAG---LPIHM----FRTAHNAREKLAESLRHENLQKRES---ISELISLRMFLNDTLSTFDDlEK 258
Cdd:PLN02774 190 EEFKtEFFK----LVLGtlsLPIDLpgtnYRSGVQARKNIVRMLRQLIQERRASgetHTDMLGYLMRKEGNRYKLTD-EE 264
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       259 AKTHLVVLWASQANTIPAT-FWSLFQMIRNPEAMkaatEEVKRTLENAGQKVSLEgNPIclsqaELNDLPVLD---SIIK 334
Cdd:PLN02774 265 IIDQIITILYSGYETVSTTsMMAVKYLHDHPKAL----QELRKEHLAIRERKRPE-DPI-----DWNDYKSMRftrAVIF 334
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       335 ESLRLSSASLNI--RTAKEdftlhLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDengktkttfycNGLK 412
Cdd:PLN02774 335 ETSRLATIVNGVlrKTTQD-----MELNGYVIPKGWRIYVYTREINYDPFLYPDPMTFNPWRWLD-----------KSLE 398
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
3DAX_B       413 LKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEG 455
Cdd:PLN02774 399 SHNYFFLFGGGTRLCPGKELGIVEISTFLHYFVTRYRWEEVGG 441
PLN00168 PLN00168
Cytochrome P450; Provisional
279-457 1.53e-07

Cytochrome P450; Provisional


Pssm-ID: 215086  Cd Length: 519  Bit Score: 53.80  E-value: 1.53e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       279 WSLFQMIRNPEAMKAATEEVKRTLENAGQKVSLEgnpiclsqaELNDLPVLDSIIKESLR--------LSSAslnirtAK 350
Cdd:PLN00168 328 WIMAELVKNPSIQSKLHDEIKAKTGDDQEEVSEE---------DVHKMPYLKAVVLEGLRkhppahfvLPHK------AA 392
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       351 EDftlhLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYL---DENGKTKTTfyCNGLKLkyyyMPFGSGATIC 427
Cdd:PLN00168 393 ED----MEVGGYLIPKGATVNFMVAEMGRDEREWERPMEFVPERFLaggDGEGVDVTG--SREIRM----MPFGVGRRIC 462
                        170       180       190
                 ....*....|....*....|....*....|
3DAX_B       428 PGRLFAIHEIKQFLILMLSYFELELIEGQA 457
Cdd:PLN00168 463 AGLGIAMLHLEYFVANMVREFEWKEVPGDE 492
PLN03018 PLN03018
homomethionine N-hydroxylase
279-475 3.72e-07

homomethionine N-hydroxylase


Pssm-ID: 178592  Cd Length: 534  Bit Score: 52.32  E-value: 3.72e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       279 WSLFQMIRNPEAMKAATEEVKRTLenagqkvsleGNPICLSQAELNDLPVLDSIIKESLRLSSASLNI--RTAKEDFTLh 356
Cdd:PLN03018 336 WTLGEMLKNPEILRKALKELDEVV----------GKDRLVQESDIPNLNYLKACCRETFRIHPSAHYVppHVARQDTTL- 404
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       357 ledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYcngLKLKYYYMPFGSGATICPGRLFAIHE 436
Cdd:PLN03018 405 ---GGYFIPKGSHIHVCRPGLGRNPKIWKDPLVYEPERHLQGDGITKEVTL---VETEMRFVSFSTGRRGCVGVKVGTIM 478
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
3DAX_B       437 IKQFLILMLSYFELELIEGqakCPP--LDQSRAGLGILPPL 475
Cdd:PLN03018 479 MVMMLARFLQGFNWKLHQD---FGPlsLEEDDASLLMAKPL 516
PTZ00404 PTZ00404
cytochrome P450; Provisional
279-456 6.26e-07

cytochrome P450; Provisional


Pssm-ID: 173595  Cd Length: 482  Bit Score: 51.65  E-value: 6.26e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       279 WSLFQMIRNPEAMKAATEEVKRTLeNAGQKVSLEGNPiclsqaelnDLPVLDSIIKESLRLSSASLN--IRTAKEDFTLh 356
Cdd:PTZ00404 305 WMVLMLCNYPEIQEKAYNEIKSTV-NGRNKVLLSDRQ---------STPYTVAIIKETLRYKPVSPFglPRSTSNDIII- 373
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       357 leDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLdeNGKTKTTFycnglklkyyyMPFGSGATICPGRLFAIHE 436
Cdd:PTZ00404 374 --GGGHFIPKDAQILINYYSLGRNEKYFENPEQFDPSRFL--NPDSNDAF-----------MPFSIGPRNCVGQQFAQDE 438
                        170       180
                 ....*....|....*....|
3DAX_B       437 IKQFLILMLSYFELELIEGQ 456
Cdd:PTZ00404 439 LYLAFSNIILNFKLKSIDGK 458
PLN02966 PLN02966
cytochrome P450 83A1
252-447 6.74e-07

cytochrome P450 83A1


Pssm-ID: 178550  Cd Length: 502  Bit Score: 51.67  E-value: 6.74e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       252 TFDDLEKAKTHLVVlwASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKVslegnpicLSQAELNDLPVLDS 331
Cdd:PLN02966 286 TVDNVKAVILDIVV--AGTDTAAAAVVWGMTYLMKYPQVLKKAQAEVREYMKEKGSTF--------VTEDDVKNLPYFRA 355
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       332 IIKESLRLSSAS--LNIRTAKEDFTLhledGSYNIRKDDIIALYPQLMHLDPEIY-PDPLTFKYDRYLDENGKTKTTfyc 408
Cdd:PLN02966 356 LVKETLRIEPVIplLIPRACIQDTKI----AGYDIPAGTTVNVNAWAVSRDEKEWgPNPDEFRPERFLEKEVDFKGT--- 428
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
3DAX_B       409 nglklKYYYMPFGSGATICPG-RLFAIHEIKQFLILMLSY 447
Cdd:PLN02966 429 -----DYEFIPFGSGRRMCPGmRLGAAMLEVPYANLLLNF 463
PLN02290 PLN02290
cytokinin trans-hydroxylase
279-448 3.24e-06

cytokinin trans-hydroxylase


Pssm-ID: 215164  Cd Length: 516  Bit Score: 49.43  E-value: 3.24e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       279 WSLFQMIRNPEAMKAATEEVKRTLEnagqkvsleGNPICLSQaeLNDLPVLDSIIKESLRL-SSASLNIRTAKEDFTLhl 357
Cdd:PLN02290 338 WTLMLLASNPTWQDKVRAEVAEVCG---------GETPSVDH--LSKLTLLNMVINESLRLyPPATLLPRMAFEDIKL-- 404
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       358 edGSYNIRKDDIIALYPQLMHLDPEIY-PDPLTFKYDRYldengkTKTTFYCNGlklkyYYMPFGSGATICPGRLFAIHE 436
Cdd:PLN02290 405 --GDLHIPKGLSIWIPVLAIHHSEELWgKDANEFNPDRF------AGRPFAPGR-----HFIPFAAGPRNCIGQAFAMME 471
                        170
                 ....*....|..
3DAX_B       437 IKQFLILMLSYF 448
Cdd:PLN02290 472 AKIILAMLISKF 483
PLN02648 PLN02648
allene oxide synthase
296-401 4.33e-06

allene oxide synthase


Pssm-ID: 215350  Cd Length: 480  Bit Score: 48.78  E-value: 4.33e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       296 EEVKRTLENAGQKVSLegnpiclsqAELNDLPVLDSIIKESLRLS-SASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYP 374
Cdd:PLN02648 312 EEVRSAVKAGGGGVTF---------AALEKMPLVKSVVYEALRIEpPVPFQYGRAREDFVIESHDAAFEIKKGEMLFGYQ 382
                         90       100
                 ....*....|....*....|....*..
3DAX_B       375 QLMHLDPEIYPDPLTFKYDRYLDENGK 401
Cdd:PLN02648 383 PLVTRDPKVFDRPEEFVPDRFMGEEGE 409
PLN02738 PLN02738
carotene beta-ring hydroxylase
279-463 9.17e-06

carotene beta-ring hydroxylase


Pssm-ID: 215393 [Multi-domain]  Cd Length: 633  Bit Score: 47.99  E-value: 9.17e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       279 WSLFQMIRNPEAMKAATEEVKRTLenaGQKV-SLEgnpiclsqaELNDLPVLDSIIKESLRL-SSASLNIRTAKEDFTLh 356
Cdd:PLN02738 413 WTFYLLSKEPSVVAKLQEEVDSVL---GDRFpTIE---------DMKKLKYTTRVINESLRLyPQPPVLIRRSLENDML- 479
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       357 ledGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRY-LDENGKTKTTfycnglkLKYYYMPFGSGATICPGRLFAIH 435
Cdd:PLN02738 480 ---GGYPIKRGEDIFISVWNLHRSPKHWDDAEKFNPERWpLDGPNPNETN-------QNFSYLPFGGGPRKCVGDMFASF 549
                        170       180
                 ....*....|....*....|....*...
3DAX_B       436 EIKQFLILMLSYFELELIEGqakCPPLD 463
Cdd:PLN02738 550 ENVVATAMLVRRFDFQLAPG---APPVK 574
PLN02426 PLN02426
cytochrome P450, family 94, subfamily C protein
271-460 1.15e-05

cytochrome P450, family 94, subfamily C protein


Pssm-ID: 215235  Cd Length: 502  Bit Score: 47.76  E-value: 1.15e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       271 ANTIPATFWSLFQmirNPEAMKAATEEVKRTLENAGQKVSLEgnpiclsqaELNDLPVLDSIIKESLRL-SSASLNIRTA 349
Cdd:PLN02426 310 ASALTSFFWLLSK---HPEVASAIREEADRVMGPNQEAASFE---------EMKEMHYLHAALYESMRLfPPVQFDSKFA 377
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       350 KEDFTLhlEDGSYnIRKDDIIALYPQLMHLDPEIY-PDPLTFKYDRYLDeNGktktTFYCNGLklkYYYMPFGSGATICP 428
Cdd:PLN02426 378 AEDDVL--PDGTF-VAKGTRVTYHPYAMGRMERIWgPDCLEFKPERWLK-NG----VFVPENP---FKYPVFQAGLRVCL 446
                        170       180       190
                 ....*....|....*....|....*....|..
3DAX_B       429 GRLFAIHEIKQFLILMLSYFELELIEGQAKCP 460
Cdd:PLN02426 447 GKEMALMEMKSVAVAVVRRFDIEVVGRSNRAP 478
PLN03112 PLN03112
cytochrome P450 family protein; Provisional
279-429 4.59e-05

cytochrome P450 family protein; Provisional


Pssm-ID: 215583  Cd Length: 514  Bit Score: 45.58  E-value: 4.59e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       279 WSLFQMIRNPEAMKAATEEVKrtlenagqkvSLEGNPICLSQAELNDLPVLDSIIKESLRLSSAS--LNIRTAKEDFTLH 356
Cdd:PLN03112 318 WAMAEVIKNPRVLRKIQEELD----------SVVGRNRMVQESDLVHLNYLRCVVRETFRMHPAGpfLIPHESLRATTIN 387
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
3DAX_B       357 ledgSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLkyyyMPFGSGATICPG 429
Cdd:PLN03112 388 ----GYYIPAKTRVFINTHGLGRNTKIWDDVEEFRPERHWPAEGSRVEISHGPDFKI----LPFSAGKRKCPG 452
PLN02183 PLN02183
ferulate 5-hydroxylase
279-455 2.75e-04

ferulate 5-hydroxylase


Pssm-ID: 165828  Cd Length: 516  Bit Score: 43.30  E-value: 2.75e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       279 WSLFQMIRNPEAMKAATEEVKRTlenagqkVSLEGNpicLSQAELNDLPVLDSIIKESLRLSSA-SLNIRTAKEDFTLhl 357
Cdd:PLN02183 326 WAMAELMKSPEDLKRVQQELADV-------VGLNRR---VEESDLEKLTYLKCTLKETLRLHPPiPLLLHETAEDAEV-- 393
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       358 edGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTkttFYCNglklKYYYMPFGSGATICPGRLFAIHEI 437
Cdd:PLN02183 394 --AGYFIPKRSRVMINAWAIGRDKNSWEDPDTFKPSRFLKPGVPD---FKGS----HFEFIPFGSGRRSCPGMQLGLYAL 464
                        170
                 ....*....|....*...
3DAX_B       438 KQFLILMLSYFELELIEG 455
Cdd:PLN02183 465 DLAVAHLLHCFTWELPDG 482
PLN02500 PLN02500
cytochrome P450 90B1
377-454 3.42e-04

cytochrome P450 90B1


Pssm-ID: 215276  Cd Length: 490  Bit Score: 42.93  E-value: 3.42e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
3DAX_B       377 MHLDPEIYPDPLTFKYDRYLDENGKTKTTfyCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIE 454
Cdd:PLN02500 391 VHLDSSLYDQPQLFNPWRWQQNNNRGGSS--GSSSATTNNFMPFGGGPRLCAGSELAKLEMAVFIHHLVLNFNWELAE 466
PLN03141 PLN03141
3-epi-6-deoxocathasterone 23-monooxygenase; Provisional
287-441 5.21e-04

3-epi-6-deoxocathasterone 23-monooxygenase; Provisional


Pssm-ID: 215600  Cd Length: 452  Bit Score: 42.42  E-value: 5.21e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DAX_B       287 NPEAMKAATEEvkrTLENAGQKvSLEGNPICLSqaELNDLPVLDSIIKESLRLSSASLNI-RTAKEDftlhLEDGSYNIR 365
Cdd:PLN03141 281 CPVALQQLTEE---NMKLKRLK-ADTGEPLYWT--DYMSLPFTQNVITETLRMGNIINGVmRKAMKD----VEIKGYLIP 350
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
3DAX_B       366 KDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTtfycnglklkyyYMPFGSGATICPGRLFAIHEIKQFL 441
Cdd:PLN03141 351 KGWCVLAYFRSVHLDEENYDNPYQFNPWRWQEKDMNNSS------------FTPFGGGQRLCPGLDLARLEASIFL 414
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH