NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|3891482|pdb|5GAL|B]
View 

Chain B, Crystal Structure Of Human Galectin-7 In Complex With N- Acetyllactosamine

Protein Classification

GLECT and Gal-bind_lectin domain-containing protein (domain architecture ID 10658251)

GLECT and Gal-bind_lectin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Gal-bind_lectin smart00908
Galactoside-binding lectin; Animal lectins display a wide variety of architectures. They are ...
10-132 1.06e-53

Galactoside-binding lectin; Animal lectins display a wide variety of architectures. They are classified according to the carbohydrate-recognition domain (CRD) of which there are two main types, S-type and C-type. Galectins (previously S-lectins) bind exclusively beta-galactosides like lactose. They do not require metal ions for activity. Galectins are found predominantly, but not exclusively in mammals. Their function is unclear. They are developmentally regulated and may be involved in differentiation, cellular regulation and tissue construction.


:

Pssm-ID: 214904  Cd Length: 122  Bit Score: 164.69  E-value: 1.06e-53
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5GAL_B          10 PEGIRPGTVLRIRGLVPPNASRFHVNLLCGEeqGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVL 89
Cdd:smart00908   1 PGGLSPGSSITIRGIVLPDAKRFSINLQCGP--NADIALHFNPRFDEGTIVRNSKQNGKWGKEERSGGFPFQPGQPFELE 78
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
5GAL_B          90 IIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 132
Cdd:smart00908  79 ILVEEDEFKVAVNGQHFLEFPHRLPLESIDTLEISGDVQLTSV 121
 
Name Accession Description Interval E-value
Gal-bind_lectin smart00908
Galactoside-binding lectin; Animal lectins display a wide variety of architectures. They are ...
10-132 1.06e-53

Galactoside-binding lectin; Animal lectins display a wide variety of architectures. They are classified according to the carbohydrate-recognition domain (CRD) of which there are two main types, S-type and C-type. Galectins (previously S-lectins) bind exclusively beta-galactosides like lactose. They do not require metal ions for activity. Galectins are found predominantly, but not exclusively in mammals. Their function is unclear. They are developmentally regulated and may be involved in differentiation, cellular regulation and tissue construction.


Pssm-ID: 214904  Cd Length: 122  Bit Score: 164.69  E-value: 1.06e-53
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5GAL_B          10 PEGIRPGTVLRIRGLVPPNASRFHVNLLCGEeqGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVL 89
Cdd:smart00908   1 PGGLSPGSSITIRGIVLPDAKRFSINLQCGP--NADIALHFNPRFDEGTIVRNSKQNGKWGKEERSGGFPFQPGQPFELE 78
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
5GAL_B          90 IIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 132
Cdd:smart00908  79 ILVEEDEFKVAVNGQHFLEFPHRLPLESIDTLEISGDVQLTSV 121
GLECT cd00070
Galectin/galactose-binding lectin. This domain exclusively binds beta-galactosides, such as ...
4-132 4.05e-52

Galectin/galactose-binding lectin. This domain exclusively binds beta-galactosides, such as lactose, and does not require metal ions for activity. GLECT domains occur as homodimers or tandemly repeated domains. They are developmentally regulated and may be involved in differentiation, cell-cell interaction and cellular regulation.


Pssm-ID: 238025  Cd Length: 127  Bit Score: 160.88  E-value: 4.05e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5GAL_B        4 PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGeeqGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRG 83
Cdd:cd00070   1 PYKLPLPGGLKPGSTLTVKGRVLPNAKRFSINLGTG---SSDIALHFNPRFDENVIVRNSFLNGNWGPEERSGGFPFQPG 77
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
5GAL_B       84 QPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 132
Cdd:cd00070  78 QPFELTILVEEDKFQIFVNGQHFFSFPHRLPLESIDYLSINGDVSLTSV 126
Gal-bind_lectin pfam00337
Galactoside-binding lectin; This family contains galactoside binding lectins. The family also ...
4-132 3.67e-51

Galactoside-binding lectin; This family contains galactoside binding lectins. The family also includes enzymes such as human eosinophil lysophospholipase (EC:3.1.1.5).


Pssm-ID: 334017  Cd Length: 129  Bit Score: 158.17  E-value: 3.67e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5GAL_B          4 PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRG 83
Cdd:pfam00337   1 PFLGTLPGGLSPGSSLTISGIVLPNADRFSINLQTGPEPSGDIALHFNPRFDENVIVRNSRQNGAWGQEEREGGFPFQPG 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
5GAL_B         84 QPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 132
Cdd:pfam00337  81 QPFELTILVGDDHFKIAVNGQHFTEFKHRLPPEDIDALQVRGDVKLTSV 129
 
Name Accession Description Interval E-value
Gal-bind_lectin smart00908
Galactoside-binding lectin; Animal lectins display a wide variety of architectures. They are ...
10-132 1.06e-53

Galactoside-binding lectin; Animal lectins display a wide variety of architectures. They are classified according to the carbohydrate-recognition domain (CRD) of which there are two main types, S-type and C-type. Galectins (previously S-lectins) bind exclusively beta-galactosides like lactose. They do not require metal ions for activity. Galectins are found predominantly, but not exclusively in mammals. Their function is unclear. They are developmentally regulated and may be involved in differentiation, cellular regulation and tissue construction.


Pssm-ID: 214904  Cd Length: 122  Bit Score: 164.69  E-value: 1.06e-53
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5GAL_B          10 PEGIRPGTVLRIRGLVPPNASRFHVNLLCGEeqGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVL 89
Cdd:smart00908   1 PGGLSPGSSITIRGIVLPDAKRFSINLQCGP--NADIALHFNPRFDEGTIVRNSKQNGKWGKEERSGGFPFQPGQPFELE 78
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
5GAL_B          90 IIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 132
Cdd:smart00908  79 ILVEEDEFKVAVNGQHFLEFPHRLPLESIDTLEISGDVQLTSV 121
GLECT cd00070
Galectin/galactose-binding lectin. This domain exclusively binds beta-galactosides, such as ...
4-132 4.05e-52

Galectin/galactose-binding lectin. This domain exclusively binds beta-galactosides, such as lactose, and does not require metal ions for activity. GLECT domains occur as homodimers or tandemly repeated domains. They are developmentally regulated and may be involved in differentiation, cell-cell interaction and cellular regulation.


Pssm-ID: 238025  Cd Length: 127  Bit Score: 160.88  E-value: 4.05e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5GAL_B        4 PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGeeqGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRG 83
Cdd:cd00070   1 PYKLPLPGGLKPGSTLTVKGRVLPNAKRFSINLGTG---SSDIALHFNPRFDENVIVRNSFLNGNWGPEERSGGFPFQPG 77
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
5GAL_B       84 QPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 132
Cdd:cd00070  78 QPFELTILVEEDKFQIFVNGQHFFSFPHRLPLESIDYLSINGDVSLTSV 126
Gal-bind_lectin pfam00337
Galactoside-binding lectin; This family contains galactoside binding lectins. The family also ...
4-132 3.67e-51

Galactoside-binding lectin; This family contains galactoside binding lectins. The family also includes enzymes such as human eosinophil lysophospholipase (EC:3.1.1.5).


Pssm-ID: 334017  Cd Length: 129  Bit Score: 158.17  E-value: 3.67e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5GAL_B          4 PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRG 83
Cdd:pfam00337   1 PFLGTLPGGLSPGSSLTISGIVLPNADRFSINLQTGPEPSGDIALHFNPRFDENVIVRNSRQNGAWGQEEREGGFPFQPG 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
5GAL_B         84 QPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 132
Cdd:pfam00337  81 QPFELTILVGDDHFKIAVNGQHFTEFKHRLPPEDIDALQVRGDVKLTSV 129
GLECT smart00276
Galectin; Galectin - galactose-binding lectin
6-134 4.09e-51

Galectin; Galectin - galactose-binding lectin


Pssm-ID: 214596  Cd Length: 128  Bit Score: 158.16  E-value: 4.09e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5GAL_B           6 KSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGeeqGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQP 85
Cdd:smart00276   2 TLPIPGGLKPGQTLTVRGIVLPDAKRFSINLLTG---GDDIALHFNPRFNENKIVCNSKLNGSWGSEEREGGFPFQPGQP 78
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
5GAL_B          86 FEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRI 134
Cdd:smart00276  79 FDLTIIVQPDHFQIFVNGVHITTFPHRLPLESIDYLSINGDVQLTSVSF 127
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH