NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1407938637|pdb|6G79|S]
View 

Chain S, 5-hydroxytryptamine receptor 1B

Protein Classification

7tmA_5-HT1B_1D domain-containing protein (domain architecture ID 11607419)

7tmA_5-HT1B_1D domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_5-HT1B_1D cd15333
serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G ...
14-348 5.20e-171

serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


:

Pssm-ID: 320455 [Multi-domain]  Cd Length: 265  Bit Score: 476.59  E-value: 5.20e-171
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       14 LPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFW 93
Cdd:cd15333   1 LGLKISLAVLLALITLATTLSNAFVIATIYLTRKLHTPANYLIASLAVTDLLVSILVMPISIVYTVTGTWTLGQVVCDIW 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       94 LSSDITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDH 173
Cdd:cd15333  81 LSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPKRAAVMIALVWVISISISLPPFFWRQAKAEEEVSECVVNTDH 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      174 ILYTVYSTVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspv 253
Cdd:cd15333 161 ILYTVYSTVGAFYIPTLLLIALYGRIYVEAR------------------------------------------------- 191
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      254 yvnqvkvrvsdallekkklmaARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLIN 333
Cdd:cd15333 192 ---------------------ARERKATKTLGIILGAFIVCWLPFFIISLVLPICKDACWFHLAIFDFFTWLGYLNSLIN 250
                       330
                ....*....|....*
6G79_S      334 PIIYTMSNEDFKQAF 348
Cdd:cd15333 251 PIIYTMSNEDFKQAF 265
 
Name Accession Description Interval E-value
7tmA_5-HT1B_1D cd15333
serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G ...
14-348 5.20e-171

serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320455 [Multi-domain]  Cd Length: 265  Bit Score: 476.59  E-value: 5.20e-171
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       14 LPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFW 93
Cdd:cd15333   1 LGLKISLAVLLALITLATTLSNAFVIATIYLTRKLHTPANYLIASLAVTDLLVSILVMPISIVYTVTGTWTLGQVVCDIW 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       94 LSSDITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDH 173
Cdd:cd15333  81 LSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPKRAAVMIALVWVISISISLPPFFWRQAKAEEEVSECVVNTDH 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      174 ILYTVYSTVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspv 253
Cdd:cd15333 161 ILYTVYSTVGAFYIPTLLLIALYGRIYVEAR------------------------------------------------- 191
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      254 yvnqvkvrvsdallekkklmaARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLIN 333
Cdd:cd15333 192 ---------------------ARERKATKTLGIILGAFIVCWLPFFIISLVLPICKDACWFHLAIFDFFTWLGYLNSLIN 250
                       330
                ....*....|....*
6G79_S      334 PIIYTMSNEDFKQAF 348
Cdd:cd15333 251 PIIYTMSNEDFKQAF 265
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family). This family contains, amongst other ...
35-337 1.22e-69

7 transmembrane receptor (rhodopsin family). This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 365800  Cd Length: 256  Bit Score: 218.70  E-value: 1.22e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S         35 NAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVT-GRWTLGQVVCDFWLSSDITCCTASIWHLCVIAL 113
Cdd:pfam00001   2 NLLVILVILRNKKLRTPTNIFLLNLAVADLLFGLLTLPFWLVYYLLhGDWPFGSALCKIVGALDYVNGYASIFLLTAISI 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S        114 DRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF--WRQAKAEEEVSECV-----VNTDHILYTVYSTVGAFY 186
Cdd:pfam00001  82 DRYLAIVHPLRYRRIRTPRRAKVLILLIWVLALLLSLPPLLfgWTLTVPEGNVTVCFidfpeELTWPVSYTLLSSVLGFL 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S        187 FPTLLLIALYGRIYVEARSRILKQtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnqvkvrvsdal 266
Cdd:pfam00001 162 LPLLVILVCYTLIIRTLRKSASKQ-------------------------------------------------------- 185
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
6G79_S        267 leKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPI---CKDACWFHLAIFdFFTWLGYLNSLINPIIY 337
Cdd:pfam00001 186 --KSQQRTPRRRKALKTLAVVVVVFILCWLPYHIVNLLDSLnpdCELSRLLDKALS-ITLWLAYVNSCLNPIIY 256
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
33-358 1.33e-08

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 55.55  E-value: 1.33e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S        33 LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVsILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIWHLCVIA 112
Cdd:PHA03087  55 LVGNIIVIYVLTKTKIKTPMDIYLLNLAVSDLLF-VMTLPFQIYYYILFQWSFGEFACKIVSGLYYIGFYNSMNFITVMS 133
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       113 LDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDH------ILYTVYSTVGAFY 186
Cdd:PHA03087 134 VDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFYNNktmnwkLFINFEINIIGML 213
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       187 FPTLLLIALYGRIYVearsrILKQTPNRTgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnqvkvrvsdal 266
Cdd:PHA03087 214 IPLTILLYCYSKILI-----TLKGINKSK--------------------------------------------------- 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       267 lekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPI--------CKDACWFHLAIFDFFTwLGYLNSLINPIIYT 338
Cdd:PHA03087 238 ---------KNKKAIKLVLIIVILFVIFWLPFNVSVFVYSLhilhfksgCKAVKYIQYALHVTEI-ISLSHCCINPLIYA 307
                        330       340
                 ....*....|....*....|
6G79_S       339 MSNEDFKQAFHKLIRFKCTS 358
Cdd:PHA03087 308 FVSEFFNKHKKKSLKLMFTS 327
 
Name Accession Description Interval E-value
7tmA_5-HT1B_1D cd15333
serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G ...
14-348 5.20e-171

serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320455 [Multi-domain]  Cd Length: 265  Bit Score: 476.59  E-value: 5.20e-171
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       14 LPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFW 93
Cdd:cd15333   1 LGLKISLAVLLALITLATTLSNAFVIATIYLTRKLHTPANYLIASLAVTDLLVSILVMPISIVYTVTGTWTLGQVVCDIW 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       94 LSSDITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDH 173
Cdd:cd15333  81 LSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPKRAAVMIALVWVISISISLPPFFWRQAKAEEEVSECVVNTDH 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      174 ILYTVYSTVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspv 253
Cdd:cd15333 161 ILYTVYSTVGAFYIPTLLLIALYGRIYVEAR------------------------------------------------- 191
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      254 yvnqvkvrvsdallekkklmaARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLIN 333
Cdd:cd15333 192 ---------------------ARERKATKTLGIILGAFIVCWLPFFIISLVLPICKDACWFHLAIFDFFTWLGYLNSLIN 250
                       330
                ....*....|....*
6G79_S      334 PIIYTMSNEDFKQAF 348
Cdd:cd15333 251 PIIYTMSNEDFKQAF 265
7tmA_5-HT1_5_7 cd15064
serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G ...
18-348 5.16e-144

serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes serotonin receptor subtypes 1, 5, and 7 that are activated by the neurotransmitter serotonin. The 5-HT1 and 5-HT5 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family. The 5-HT1 receptor subfamily includes 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as 5-HT2C receptor. The 5-HT5A and 5-HT5B receptors have been cloned from rat and mouse, but only the 5-HT5A isoform has been identified in human because of the presence of premature stop codons in the human 5-HT5B gene, which prevents a functional receptor from being expressed. The 5-HT7 receptor is coupled to Gs, which positively stimulates adenylate cyclase activity, leading to increased intracellular cAMP formation and calcium influx. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320192 [Multi-domain]  Cd Length: 258  Bit Score: 407.87  E-value: 5.16e-144
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15064   1 VLISVLLSLIILATILGNALVIAAILLTRKLHTPANYLIASLAVADLLVAVLVMPLSAVYELTGRWILGQVLCDIWISLD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNtDHILYT 177
Cdd:cd15064  81 VTCCTASILHLCVIALDRYWAITDAVEYAHKRTPKRAAVMIALVWTLSICISLPPLFGWRTPDSEDPSECLIS-QDIGYT 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      178 VYSTVGAFYFPTLLLIALYGRIYVEarsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnq 257
Cdd:cd15064 160 IFSTFGAFYIPLLLMLILYWKIYRA------------------------------------------------------- 184
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      258 vkvrvsdallekkklmAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDaCWFHLAIFDFFTWLGYLNSLINPIIY 337
Cdd:cd15064 185 ----------------AARERKAAKTLGIILGAFIVCWLPFFLVALIVPLCSH-CWIPLALKSFFLWLGYFNSLINPLIY 247
                       330
                ....*....|.
6G79_S      338 TMSNEDFKQAF 348
Cdd:cd15064 248 TFFNKDFRKAF 258
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
19-348 4.18e-103

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098 [Multi-domain]  Cd Length: 259  Bit Score: 304.10  E-value: 4.18e-103
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       19 LLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDI 98
Cdd:cd14967   1 LLAVFLSLIILVTVFGNLLVILAVYRNRRLRTVTNYFIVSLAVADLLVALLVMPFSAVYTLLGYWPFGPVLCRFWIALDV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       99 TCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECV-VNTDHILYT 177
Cdd:cd14967  81 LCCTASILNLCAISLDRYLAITRPLRYRQLMTKKRALIMIAAVWVYSLLISLPPLVGWRDETQPSVVDCEcEFTPNKIYV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      178 VYSTVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnq 257
Cdd:cd14967 161 LVSSVISFFIPLLIMIVLYARIFRVAR----------------------------------------------------- 187
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      258 vkvrvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPICkDACWFHLAIFDFFTWLGYLNSLINPIIY 337
Cdd:cd14967 188 ------------------RELKAAKTLAIIVGAFLLCWLPFFIIYLVSAFC-PPDCVPPILYAVFFWLGYLNSALNPIIY 248
                       330
                ....*....|.
6G79_S      338 TMSNEDFKQAF 348
Cdd:cd14967 249 ALFNRDFRRAF 259
7tmA_5-HT1E cd15335
serotonin receptor subtype 1E, member of the class A family of seven-transmembrane G ...
18-348 9.92e-99

serotonin receptor subtype 1E, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320457 [Multi-domain]  Cd Length: 258  Bit Score: 292.98  E-value: 9.92e-99
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15335   1 MLIVLTLALITILTTVLNSAVIAAICTTKKLHQPANYLICSLAVTDFLVAVLVMPLSITYIVMDTWTLGYFICEIWLSVD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYT 177
Cdd:cd15335  81 MTCCTCSILHLCVIALDRYWAITDAIEYARKRTAKRAGLMILTVWTISIFISIPPLFWRNHHDANIPSQCIIQHDHVIYT 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      178 VYSTVGAFYFPTLLLIALYGRIYVEarsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnq 257
Cdd:cd15335 161 IYSTFGAFYIPLTLILILYYRIYHA------------------------------------------------------- 185
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      258 vkvrvsdallekkklmAARERKATKTLGIILGAFIVCWLPFFIISLVMPIckDACWFHLAIFDFFTWLGYLNSLINPIIY 337
Cdd:cd15335 186 ----------------ASRERKAARILGLILGAFILSWLPFFIKELIVGL--SVMTVSPEVADFLTWLGYVNSLVNPLLY 247
                       330
                ....*....|.
6G79_S      338 TMSNEDFKQAF 348
Cdd:cd15335 248 TSFNEDFKLAF 258
7tmA_5-HT1F cd15334
serotonin receptor subtype 1F, member of the class A family of seven-transmembrane G ...
18-349 4.06e-98

serotonin receptor subtype 1F, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320456 [Multi-domain]  Cd Length: 259  Bit Score: 291.47  E-value: 4.06e-98
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15334   1 ILISLTLSILALMTTAINSLVITAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIMYIVKETWIMGQVVCDIWLSVD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQaKAEEEVSECVVNTDHILYT 177
Cdd:cd15334  81 ITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMIAVVWIISIFISMPPLFWRH-QTTSREDECIIKHDHIVFT 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      178 VYSTVGAFYFPTLLLIALYGRIYvearsrilkqtpnrtgkrltRAqlitdspgstssvtsinsrvpdvpsesgspvyvnq 257
Cdd:cd15334 160 IYSTFGAFYIPLALILILYYKIY--------------------RA----------------------------------- 184
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      258 vkvrvsdallekkklmAARERKATKTLGIILGAFIVCWLPFFIISLVMPICkDACWFHLAIFDFFTWLGYLNSLINPIIY 337
Cdd:cd15334 185 ----------------ATRERKAATTLGLILGAFVICWLPFFVKEVIVNTC-DSCYISEEMSNFLTWLGYINSLINPLIY 247
                       330
                ....*....|..
6G79_S      338 TMSNEDFKQAFH 349
Cdd:cd15334 248 TIFNEDFKKAFQ 259
7tmA_5-HT1A_invertebrates cd15331
serotonin receptor subtype 1A from invertebrates, member of the class A family of ...
18-348 5.64e-94

serotonin receptor subtype 1A from invertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320454 [Multi-domain]  Cd Length: 261  Bit Score: 281.16  E-value: 5.64e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15331   1 VLTSIILGLLILATIIGNVFVIAAILLERSLQGVSNYLILSLAVADLMVAVLVMPLSAVYEVSQHWFLGPEVCDMWISMD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDaVEYSAKRTPKRAAVMIALVWVFSISISLPPFF-WRQAKAE---EEVSECVVNTDH 173
Cdd:cd15331  81 VLCCTASILHLVAIALDRYWAVTN-IDYIRRRTAKRILIMIAVVWFVSLIISIAPLFgWKDEDDLdrvLKTGVCLISQDY 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      174 IlYTVYSTVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspv 253
Cdd:cd15331 160 G-YTIFSTVGAFYVPLLLMIIIYWKIYQAAK------------------------------------------------- 189
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      254 yvnqvkvrvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLaIFDFFTWLGYLNSLIN 333
Cdd:cd15331 190 ----------------------RERKAARTLAIITGAFVVCWLPFFLVALVMPFCGAWQISRF-LESFFLWLGYFNSLLN 246
                       330
                ....*....|....*
6G79_S      334 PIIYTMSNEDFKQAF 348
Cdd:cd15331 247 PIIYTIFSPDFRGAF 261
7tmA_5-HT7 cd15329
serotonin receptor subtype 7, member of the class A family of seven-transmembrane G ...
18-348 1.20e-92

serotonin receptor subtype 7, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT7 receptor, one of 14 mammalian serotonin receptors, is a member of the class A of GPCRs and is activated by the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). 5-HT7 receptor mainly couples to Gs protein, which positively stimulates adenylate cyclase, leading to increased intracellular cAMP formation and calcium influx. 5-HT7 receptor is expressed in various human tissues, mainly in the brain, the lower gastrointestinal tract and in vital blood vessels including the coronary artery. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320452 [Multi-domain]  Cd Length: 260  Bit Score: 277.61  E-value: 1.20e-92
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15329   1 VLIGIVLLIIILGTVVGNALVIIAVCLVKKLRTPSNYLIVSLAVSDLLVALLVMPLAIIYELSGYWPFGEILCDVWISFD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF-WRQAKAEEEVseCVVnTDHILY 176
Cdd:cd15329  81 VLLCTASILNLCAISVDRYLVITRPLTYAVKRTPKRMALMIAIVWLLSALISIPPLFgWKNKVNDPGV--CQV-SQDFGY 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      177 TVYSTVGAFYFPTLLLIALYGRIYvearsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvn 256
Cdd:cd15329 158 QIYATFGAFYIPLIVMLVLYYKIY-------------------------------------------------------- 181
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      257 qvkvrvsdallekkkLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICK--DACWFHLAIFDFFTWLGYLNSLINP 334
Cdd:cd15329 182 ---------------RAAKSERKAIKTLGIIMGAFTLCWLPFFILALLRPFLKpiKCSCIPLWLSRLFLWLGYANSFLNP 246
                       330
                ....*....|....
6G79_S      335 IIYTMSNEDFKQAF 348
Cdd:cd15329 247 IIYAKFNREFRTPF 260
7tmA_5-HT1A_vertebrates cd15330
serotonin receptor subtype 1A from vertebrates, member of the class A family of ...
18-348 1.02e-89

serotonin receptor subtype 1A from vertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320453 [Multi-domain]  Cd Length: 260  Bit Score: 270.31  E-value: 1.02e-89
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15330   1 IITSLFLGTLILCAIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF-WRQAKAEEEVSECVVNTDHiLY 176
Cdd:cd15330  81 VLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISLTWLIGFSISIPPMLgWRTPEDRSDPDACTISKDP-GY 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      177 TVYSTVGAFYFPTLLLIALYGRIYvearsrilkqtpnrtgkrltRAqlitdspgstssvtsinsrvpdvpsesgspvyvn 256
Cdd:cd15330 160 TIYSTFGAFYIPLILMLVLYGRIF--------------------KA---------------------------------- 185
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      257 qvkvrvsdallekkklmAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPII 336
Cdd:cd15330 186 -----------------AARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESTCHMPELLGAIINWLGYSNSLLNPII 248
                       330
                ....*....|..
6G79_S      337 YTMSNEDFKQAF 348
Cdd:cd15330 249 YAYFNKDFQSAF 260
7tmA_Dop1R2-like cd15067
dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the ...
19-348 2.72e-83

dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled dopamine 1-like receptor 2 is expressed in Drosophila heads and it shows significant sequence similarity with vertebrate and invertebrate dopamine receptors. Although the Drosophila Dop1R2 receptor does not cluster into the D1-like structural group, it does show pharmacological properties similar to D1-like receptors. As shown in vertebrate D1-like receptors, agonist stimulation of Dop1R2 activates adenylyl cyclase to increase cAMP levels and also generates a calcium signal through stimulation of phospholipase C.


Pssm-ID: 320195 [Multi-domain]  Cd Length: 262  Bit Score: 253.82  E-value: 2.72e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       19 LLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGR-WTLGQVVCDFWLSSD 97
Cdd:cd15067   1 LLGVVLSLFCLVTVAGNLLVILAVLRERYLRTVTNYFIVSLAVADLLVGSIVMPFSILHEMTGGyWLFGRDWCDVWHSFD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECV-VNTDHILY 176
Cdd:cd15067  81 VLASTASILNLCVISLDRYWAITDPISYPSRMTKRRALIMIALVWICSALISFPAIAWWRAVDPGPSPPNQcLFTDDSGY 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      177 TVYSTVGAFYFPTLLLIALYGRIYvearsrilkqtpnrtgkrltRAqlitdspgstssvtsinsrvpdvpsesgspvyvn 256
Cdd:cd15067 161 LIFSSCVSFYIPLVVMLFTYYRIY--------------------RA---------------------------------- 186
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      257 qvkvrvsdallekkklmAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAI-FDFFTWLGYLNSLINPI 335
Cdd:cd15067 187 -----------------AAKEQKAAKTLGIVMGVFILCWLPFFVTNILIGFCPSNCVSNPDIlFPLVTWLGYINSGMNPI 249
                       330
                ....*....|...
6G79_S      336 IYTMSNEDFKQAF 348
Cdd:cd15067 250 IYACSSRDFRRAF 262
7tmA_alpha2_AR cd15059
alpha-2 adrenergic receptors, member of the class A family of seven-transmembrane G ...
18-348 8.48e-80

alpha-2 adrenergic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320187 [Multi-domain]  Cd Length: 261  Bit Score: 244.94  E-value: 8.48e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15059   1 VAISSIVSVVILLIIVGNVLVIVAVLTSRKLRAPQNWFLVSLAVADILVGLLIMPFSLVNELMGYWYFGSVWCEIWLALD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF-WR-QAKAEEEVSECVVNTDhIL 175
Cdd:cd15059  81 VLFCTASIVNLCAISLDRYWSVTQAVEYNLKRTPRRAKAMIAAVWIISAVISLPPLFgWKdEQPWHGAEPQCELSDD-PG 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      176 YTVYSTVGAFYFPTLLLIALYGRIYVEARSrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyv 255
Cdd:cd15059 160 YVLFSSIGSFYIPLLIMIIVYARIYRAAKR-------------------------------------------------- 189
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      256 nqvkvrvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPICKDaCWFHLAIFDFFTWLGYLNSLINPI 335
Cdd:cd15059 190 --------------------KERRFTLVLGVVMGAFVLCWLPFFFTYPLVVVCKT-CGVPELLFKFFFWLGYCNSALNPV 248
                       330
                ....*....|...
6G79_S      336 IYTMSNEDFKQAF 348
Cdd:cd15059 249 IYTIFNKDFRRAF 261
7tmA_tyramine_octopamine_R-like cd15060
tyramine/octopamine receptor-like, member of the class A family of seven-transmembrane G ...
18-348 2.75e-77

tyramine/octopamine receptor-like, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes tyramine/octopamine receptors and similar proteins found in insects and other invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320188 [Multi-domain]  Cd Length: 260  Bit Score: 238.48  E-value: 2.75e-77
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15060   1 VVTTILLSVIIAFTIVGNILVILSVFTYRPLRIVQNFFIVSLAVADLAVAIFVLPLNVAYFLLGKWLFGIHLCQMWLTCD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF-WRQAKAE-EEVSECVVNTDHiL 175
Cdd:cd15060  81 ILCCTASILNLCAIALDRYWAIHDPINYAQKRTLKRVLLMIVVVWALSALISVPPLIgWNDWPENfTETTPCTLTEEK-G 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      176 YTVYSTVGAFYFPTLLLIALYGRIYVEarsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyv 255
Cdd:cd15060 160 YVIYSSSGSFFIPLLIMTIVYVKIFIA----------------------------------------------------- 186
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      256 nqvkvrvsdallekkklmAARERKATKTLGIILGAFIVCWLPFFIISLVMPICkDACWFHLAIFDFFTWLGYLNSLINPI 335
Cdd:cd15060 187 ------------------TSKERRAARTLGIIMGVFVVCWLPFFLMYVILPFC-ETCSPSAKVVNFITWLGYVNSALNPV 247
                       330
                ....*....|...
6G79_S      336 IYTMSNEDFKQAF 348
Cdd:cd15060 248 IYTIFNLDFRRAF 260
7tmA_Histamine_H2R cd15051
histamine subtype H2 receptor, member of the class A family of seven-transmembrane G ...
18-348 2.77e-74

histamine subtype H2 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine receptor subtype H2R, a member of histamine receptor family, which belongs to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H2R subtype selectively interacts with the G(s)-type G protein that activates adenylate cyclase, leading to increased cAMP production and activation of Protein Kinase A. H2R is found in various tissues such as the brain, stomach, and heart. Its most prominent role is in histamine-induced gastric acid secretion. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320179 [Multi-domain]  Cd Length: 287  Bit Score: 231.45  E-value: 2.77e-74
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15051   1 IVLGVVLAVIILLTVIGNVLVCLAVAVNRRLRNLTNYFIVSLAVTDLLLGLLVLPFSAIYELRGEWPLGPVFCNIYISLD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF--WRQA----KAEEEVSECVVNT 171
Cdd:cd15051  81 VMLCTASILNLFAISLDRYLAITAPLRYPSRVTPRRVAIALAAIWVVSLAVSFLPIHlgWNTPdgrvQNGDTPNQCRFEL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      172 DHIlYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIlkqtpnrtgKRLTRAQlitdsPGSTSSvtsinsrvpdvpsesgs 251
Cdd:cd15051 161 NPP-YVLLVAIGTFYLPLLIMCGVYLRIFRIAREQA---------KRINALT-----PASTAN----------------- 208
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      252 pvyvnqvkvrvsdallEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDAcwFHLAIFDFFTWLGYLNSL 331
Cdd:cd15051 209 ----------------SSKSAATAREHKATVTLAAVLGAFIICWFPYFTYFTYRGLCGDN--INETALSVVLWLGYANSA 270
                       330
                ....*....|....*..
6G79_S      332 INPIIYTMSNEDFKQAF 348
Cdd:cd15051 271 LNPILYAFLNRDFRRAF 287
7tmA_D1-like_dopamine_R cd15057
D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G ...
18-348 3.58e-73

D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320185 [Multi-domain]  Cd Length: 299  Bit Score: 229.24  E-value: 3.58e-73
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTP-ANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVvCDFWLSS 96
Cdd:cd15057   1 IITGCILYLLVLLTLLGNALVIAAVLRFRHLRSKvTNYFIVSLAVSDLLVAILVMPWAAVNEVAGYWPFGSF-CDVWVSF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       97 DITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF--WRQAKA-------EEEVSEC 167
Cdd:cd15057  80 DIMCSTASILNLCVISVDRYWAISSPFRYERRMTRRRAFIMIAVAWTLSALISFIPVQlgWHRADDtsealalYADPCQC 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      168 VVNTDHIlYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILK-QTPNRTGKRLTRAQlitdspgstssvtsinsrvpdvp 246
Cdd:cd15057 160 DSSLNRT-YAISSSLISFYIPVAIMIVTYTRIYRIARRQIRRiAALERAAQESTNPD----------------------- 215
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      247 sesgspvyvnqvkvrvsdallEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAI----FDFF 322
Cdd:cd15057 216 ---------------------SSLRSSLRRETKALKTLSIIMGVFVCCWLPFFILNCVLPFCDLRTAQFPCVpdttFIVF 274
                       330       340
                ....*....|....*....|....*.
6G79_S      323 TWLGYLNSLINPIIYTMsNEDFKQAF 348
Cdd:cd15057 275 VWLGWANSSLNPIIYAF-NADFRKAF 299
7tmA_D2-like_dopamine_R cd15053
D2-like dopamine receptors, member of the class A family of seven-transmembrane G ...
22-348 2.64e-72

D2-like dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320181 [Multi-domain]  Cd Length: 263  Bit Score: 225.69  E-value: 2.64e-72
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       22 MLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGR-WTLGQVVCDFWLSSDITC 100
Cdd:cd15053   5 LFLLLLPLLTVFGNVLVIMSVFRERSLQTATNYFIVSLAVADLLVAILVMPFAVYVEVNGGkWYLGPILCDIYIAMDVMC 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      101 CTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVV-NTDhilYTVY 179
Cdd:cd15053  85 STASIFNLCAISIDRYIAVTQPIKYARQKNSKRVLLTIAIVWVVSAAIACPLLFGLNNVPYRDPEECRFyNPD---FIIY 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      180 STVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnqvk 259
Cdd:cd15053 162 SSISSFYIPCIVMLLLYYRIFRALR------------------------------------------------------- 186
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      260 vrvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPIC----KDACWFHLAIFDFFTWLGYLNSLINPI 335
Cdd:cd15053 187 ----------------REKKATKTLAIVLGVFLFCWLPFFTLNILNAICpklqNQSCHVGPALFSLTTWLGYVNSFLNPI 250
                       330
                ....*....|...
6G79_S      336 IYTMSNEDFKQAF 348
Cdd:cd15053 251 IYTIFNIEFRKAF 263
7tmA_tyramine_R-like cd15061
tyramine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
19-348 1.57e-71

tyramine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes tyramine-specific receptors and similar proteins found in insects and other invertebrates. These tyramine receptors form a distinct receptor family that is phylogenetically different from the other tyramine/octopamine receptors which also found in invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320189 [Multi-domain]  Cd Length: 256  Bit Score: 223.39  E-value: 1.57e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       19 LLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDI 98
Cdd:cd15061   1 ILISFLILAIIFTIFGNLLVILAVATTRRLRTITNCYIVSLATADLLVGVLVLPLAIIRQLLGYWPLGSHLCDFWISLDV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       99 TCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDhILYTV 178
Cdd:cd15061  81 LLCTASILNLCCISLDRYFAITYPLKYRTKRSRRLAITMILAVWVISLLITSPPLVGPSWHGRRGLGSCYYTYD-KGYRI 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      179 YSTVGAFYFPTLLLIALYGRIyvearsrilkqtpnrtgkrltraqlitdspgstssvtsinSRVpdvpsesgspvyvnqv 258
Cdd:cd15061 160 YSSMGSFFLPLLLMLFVYLRI----------------------------------------FRV---------------- 183
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      259 kvrvsdallekkklmAARERKATKTLGIILGAFIVCWLPFFIISLVMPICkdACWFHLAIFDFFTWLGYLNSLINPIIYT 338
Cdd:cd15061 184 ---------------IAKERKTAKTLAIVVGCFIVCWLPFFIMYLIEPFC--DCQFSEALSTAFTWLGYFNSVINPFIYA 246
                       330
                ....*....|
6G79_S      339 MSNEDFKQAF 348
Cdd:cd15061 247 FYNKDFRRAF 256
7tmA_Beta_AR cd15058
beta adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane ...
18-348 1.98e-71

beta adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta adrenergic receptor (beta adrenoceptor), also known as beta AR, is activated by hormone adrenaline (epinephrine) and plays important roles in regulating cardiac function and heart rate, as well as pulmonary physiology. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of beta-ARs can lead to cardiac dysfunction such as arrhythmias or heart failure. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320186 [Multi-domain]  Cd Length: 305  Bit Score: 225.02  E-value: 1.98e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15058   1 PGLLLLLALIILAIVVGNLLVIIAIARTSRLQTMTNIFITSLACADLVMGLLVVPLGATIVVTGKWQLGNFWCELWTSVD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPF---FWRQAKAEE----EVSECVVN 170
Cdd:cd15058  81 VLCVTASIETLCVIAVDRYIAITRPLRYQVLLTKRRARVIVCVVWIVSALVSFVPImnqWWRANDPEAndcyQDPTCCDF 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      171 TDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKqtpnrTGKRLTRAQlitdsPGSTSSVTSINSRVPDVPSesg 250
Cdd:cd15058 161 RTNMAYAIASSVVSFYIPLLIMIFVYARVFLIATRQLQL-----IDKRRLRFQ-----SECPAPQTTSPEGKRSSGR--- 227
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      251 spvyvnqvkvrvsdallEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDAcwFHLAIFDFFTWLGYLNS 330
Cdd:cd15058 228 -----------------RPSRLTVVKEHKALKTLGIIMGTFTLCWLPFFIANIINVFNRNL--PPGEVFLLLNWLGYINS 288
                       330
                ....*....|....*...
6G79_S      331 LINPIIYTMSnEDFKQAF 348
Cdd:cd15058 289 GLNPIIYCRS-PEFRTAF 305
7tmA_Ap5-HTB1-like cd15065
serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of ...
19-348 3.52e-71

serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes Aplysia californica serotonin receptors Ap5-HTB1 and Ap5-HTB2, and similar proteins from bilateria including insects, mollusks, annelids, and worms. Ap5-HTB1 is one of the several different receptors for 5-hydroxytryptamine (5HT, serotonin). In Aplysia, serotonin plays important roles in a variety of behavioral and physiological processes mediated by the central nervous system. These include circadian clock, feeding, locomotor movement, cognition and memory, synaptic growth and synaptic plasticity. Both Ap5-HTB1 and Ap5-HTB2 receptors are coupled to G-proteins that stimulate phospholipase C, leading to the activation of phosphoinositide metabolism. Ap5-HTB1 is expressed in the reproductive system, whereas Ap5-HTB2 is expressed in the central nervous system.


Pssm-ID: 320193 [Multi-domain]  Cd Length: 300  Bit Score: 224.15  E-value: 3.52e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       19 LLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDI 98
Cdd:cd15065   1 LIGIFLSLIIVLAIFGNVLVCLAIFTDRRLRKKSNLFIVSLAVADLLVALLVMTFAVVNDLLGYWLFGETFCNIWISFDV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       99 TCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISIS-LPPFFWRQAKAEEEVSECVVNTD----- 172
Cdd:cd15065  81 MCSTASILNLCAISLDRYIHIKKPLKYERWMTTRRALVVIASVWILSALISfLPIHLGWHRLSQDEIKGLNHASNpkpsc 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      173 ----HILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIlkqtpnrtgkRLTRAQLITDSPGSTSSVTSINSRvpdvPSE 248
Cdd:cd15065 161 aldlNPTYAVVSSLISFYIPCLVMLLIYSRLYLYARKHV----------VNIKSQKLPSESGSKFQVPSLSSK----HNN 226
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      249 SGspvyvnqvkvrvsdallekkklmaARERKATKTLGIILGAFIVCWLPFFIISLVMPICKdaCWFHLAIFDFFTWLGYL 328
Cdd:cd15065 227 QG------------------------VSDHKAAVTLGIIMGVFLICWLPFFIINIIAAFCK--TCIPPKCFKILTWLGYF 280
                       330       340
                ....*....|....*....|
6G79_S      329 NSLINPIIYTMSNEDFKQAF 348
Cdd:cd15065 281 NSCLNPIIYSIFNSEFRRAF 300
7tmA_TAARs cd15055
trace amine-associated receptors, member of the class A family of seven-transmembrane G ...
18-348 1.03e-70

trace amine-associated receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptors (TAARs) are a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320183 [Multi-domain]  Cd Length: 285  Bit Score: 222.43  E-value: 1.03e-70
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15055   1 VLLYIVLSSISLLTVLGNLLVIISISHFKQLHTPTNLLLLSLAVADFLVGLLVMPFSMIRSIETCWYFGDTFCKLHSSLD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPF-----FWRQAKAEEEVSECVVNTD 172
Cdd:cd15055  81 YILTSASIFNLVLIAIDRYVAVCDPLLYPTKITIRRVKICICLCWFVSALYSSVLLydnlnQPGLIRYNSCYGECVVVVN 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      173 HILYTVySTVGAFYFPTLLLIALYGRIYVEARSRilkqtpnrtgkrltraqlitdspgstssVTSINSRVPDVPSESGsp 252
Cdd:cd15055 161 FIWGVV-DLVLTFILPCTVMIVLYMRIFVVARSQ----------------------------ARAIRSHTAQVSLEGS-- 209
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      253 vyvnqvkvrvsdalleKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDAcwfhLAIFDFFTWLGYLNSLI 332
Cdd:cd15055 210 ----------------SKKVSKKSERKAAKTLGIVVGVFLLCWLPYYIVSLVDPYISTP----SSVFDVLIWLGYFNSCL 269
                       330
                ....*....|....*.
6G79_S      333 NPIIYTMSNEDFKQAF 348
Cdd:cd15055 270 NPLIYALFYPWFRKAL 285
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family). This family contains, amongst other ...
35-337 1.22e-69

7 transmembrane receptor (rhodopsin family). This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 365800  Cd Length: 256  Bit Score: 218.70  E-value: 1.22e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S         35 NAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVT-GRWTLGQVVCDFWLSSDITCCTASIWHLCVIAL 113
Cdd:pfam00001   2 NLLVILVILRNKKLRTPTNIFLLNLAVADLLFGLLTLPFWLVYYLLhGDWPFGSALCKIVGALDYVNGYASIFLLTAISI 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S        114 DRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF--WRQAKAEEEVSECV-----VNTDHILYTVYSTVGAFY 186
Cdd:pfam00001  82 DRYLAIVHPLRYRRIRTPRRAKVLILLIWVLALLLSLPPLLfgWTLTVPEGNVTVCFidfpeELTWPVSYTLLSSVLGFL 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S        187 FPTLLLIALYGRIYVEARSRILKQtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnqvkvrvsdal 266
Cdd:pfam00001 162 LPLLVILVCYTLIIRTLRKSASKQ-------------------------------------------------------- 185
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
6G79_S        267 leKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPI---CKDACWFHLAIFdFFTWLGYLNSLINPIIY 337
Cdd:pfam00001 186 --KSQQRTPRRRKALKTLAVVVVVFILCWLPYHIVNLLDSLnpdCELSRLLDKALS-ITLWLAYVNSCLNPIIY 256
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
20-341 3.08e-66

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily. Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 381740  Cd Length: 275  Bit Score: 210.60  E-value: 3.08e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       20 LVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDIT 99
Cdd:cd00637   1 LAVLYILIFVVGVVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVGLLVIPFSLVSLLLGGWWFGDALCKLLGFLQTV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      100 CCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVV----NTDHIL 175
Cdd:cd00637  81 SLTASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLVIALIWLLSLLLALPPLLGWKVYDYGGYCCCCLcwpdLTLSKA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      176 YTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQlitdspgstssvtsinsrvpdvpsesgspvyv 255
Cdd:cd00637 161 YTIFLFVLLFLLPLLVIIVCYVRIFRKLRRHRRRIRRSSSNSSRRRRR-------------------------------- 208
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      256 nqvkvrvsdallekkklmaARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPI 335
Cdd:cd00637 209 -------------------RRERKVTKTLLIVVVVFLLCWLPYFILLLLDVFGPDLSPLPRILYFLALLLAYLNSAINPI 269

                ....*.
6G79_S      336 IYTMSN 341
Cdd:cd00637 270 IYAFFN 275
7tmA_DmOct-betaAR-like cd15066
Drosophila melanogaster beta-adrenergic receptor-like octopamine receptors and similar ...
21-348 1.56e-65

Drosophila melanogaster beta-adrenergic receptor-like octopamine receptors and similar receptors in bilateria; member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Drosophila beta-adrenergic-like octopamine receptors and similar proteins. The biogenic amine octopamine is the invertebrate equivalent of vertebrate adrenergic neurotransmitters and exerts its effects through different G protein-coupled receptor types. Insect octopamine receptors are involved in the modulation of carbohydrate metabolism, muscular tension, cognition and memory. The activation of octopamine receptors mediating these actions leads to an increase in adenylate cyclase activity, thereby increasing cAMP levels. In Drosophila melanogaster, three subgroups have been classified on the basis of their structural homology and functional equivalents with vertebrate beta-adrenergic receptors: DmOctBeta1R, DmOctBeta2R, and DmOctBeta3R.


Pssm-ID: 320194 [Multi-domain]  Cd Length: 265  Bit Score: 208.38  E-value: 1.56e-65
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       21 VMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITC 100
Cdd:cd15066   3 GFAMTLIILAAIFGNLLVIISVMRHRKLRVITNYFVVSLAMADMLVALCAMTFNASVEITGRWMFGYFMCDVWNSLDVYF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      101 CTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFF--W-------RQAKAEEEVSECVVNT 171
Cdd:cd15066  83 STASILHLCCISVDRYYAIVQPLEYPSKMTKRRVAIMLANVWISPALISFLPIFlgWytteehlQYRKTHPDQCEFVVNK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      172 dhiLYTVYSTVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgs 251
Cdd:cd15066 163 ---IYALISSSVSFWIPCIVMIFTYYRIYLEAK----------------------------------------------- 192
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      252 pvyvnqvkvrvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSL 331
Cdd:cd15066 193 ------------------------REHKAAKTLGIIMGAFILCWLPFFLWYVTTTLCGDACPYPPILVSILFWIGYFNST 248
                       330
                ....*....|....*..
6G79_S      332 INPIIYTMSNEDFKQAF 348
Cdd:cd15066 249 LNPLIYAYFNRDFREAF 265
7tmA_mAChR cd15049
muscarinic acetylcholine receptor subfamily, member of the class A family of ...
18-348 6.15e-64

muscarinic acetylcholine receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of mAChRs by agonist (acetylcholine) leads to a variety of biochemical and electrophysiological responses. In general, the exact nature of these responses and the subsequent physiological effects mainly depend on the molecular and pharmacological identity of the activated receptor subtype(s). All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341322 [Multi-domain]  Cd Length: 262  Bit Score: 204.09  E-value: 6.15e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15049   1 VLICIATGSLSLVTVGGNILVILSFRVNRQLRTVNNYFLLSLACADLIIGLVSMNLYTVYLVMGYWPLGPLLCDLWLALD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPP-FFWRQAKAEEEV--SECVVN-TDH 173
Cdd:cd15049  81 YVASNASVMNLLLISFDRYFSVTRPLTYRAKRTPKRAILMIALAWVISFVLWAPAiLGWQYFVGERTVpdGQCYIQfLDD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      174 ILYTVYSTVGAFYFPTLLLIALYGRIYvearsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspv 253
Cdd:cd15049 161 PAITFGTAIAAFYLPVLVMTILYWRIY----------------------------------------------------- 187
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      254 yvnqvkvrvsdallekkkLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLaiFDFFTWLGYLNSLIN 333
Cdd:cd15049 188 ------------------RETARERKAARTLSAILLAFIITWTPYNILVLVSTFCAKCIPDTL--WSFGYWLCYINSTIN 247
                       330
                ....*....|....*
6G79_S      334 PIIYTMSNEDFKQAF 348
Cdd:cd15049 248 PFCYALCNKTFRKTF 262
7tmA_Histamine_H1R cd15050
histamine subtype H1 receptor, member of the class A family of seven-transmembrane G ...
18-348 6.62e-64

histamine subtype H1 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine receptor subtype H1R, a member of histamine receptor family, which belongs to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). H1R selectively interacts with the G(q)-type G protein that activates phospholipase C and the phosphatidylinositol pathway. Antihistamines, a widely used anti-allergy medication, act on the H1 subtype and produce drowsiness as a side effect. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320178 [Multi-domain]  Cd Length: 263  Bit Score: 204.20  E-value: 6.62e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15050   1 APLGIALSTISLITVILNLLVLYAVRTERKLHTVGNLYIVSLSVADLIVGAVVMPLNIVYLLESKWILGRPVCLFWLSMD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFW----RQAKAEEEVSECVVN-TD 172
Cdd:cd15050  81 YVASTASIFSLFILCIDRYRSVQQPLKYLKYRTKTRASLMISGAWLLSFLWVIPILGWhhfaRGGERVVLEDKCETDfHD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      173 HILYTVYSTVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgsp 252
Cdd:cd15050 161 VTWFKVLTAILNFYIPSLLMLWFYAKIFKAVN------------------------------------------------ 192
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      253 vyvnqvkvrvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFftWLGYLNSLI 332
Cdd:cd15050 193 -----------------------RERKAAKQLGFIMAAFILCWIPYFILFMVIAFCKNCCNENLHMFTI--WLGYINSTL 247
                       330
                ....*....|....*.
6G79_S      333 NPIIYTMSNEDFKQAF 348
Cdd:cd15050 248 NPFIYPLCNENFKKTF 263
7tmA_alpha2C_AR cd15323
alpha-2 adrenergic receptors subtype C, member of the class A family of seven-transmembrane G ...
20-348 4.67e-63

alpha-2 adrenergic receptors subtype C, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320446 [Multi-domain]  Cd Length: 261  Bit Score: 202.09  E-value: 4.67e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       20 LVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDIT 99
Cdd:cd15323   3 LAAVVGFLIVFTIVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMGYWYFGQVWCNIYLALDVL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      100 CCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEV-SECVVNtDHILYTV 178
Cdd:cd15323  83 FCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKAIIVTVWLISAVISFPPLISMYRDPEGDVyPQCKLN-DETWYIL 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      179 YSTVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnqv 258
Cdd:cd15323 162 SSCIGSFFAPCLIMILVYIRIYRVAK------------------------------------------------------ 187
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      259 kvrvsdallekkklmaARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYT 338
Cdd:cd15323 188 ----------------AREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREACEVPEPLFKFFFWIGYCNSSLNPVIYT 251
                       330
                ....*....|
6G79_S      339 MSNEDFKQAF 348
Cdd:cd15323 252 IFNQDFRRSF 261
7tmA_5-HT5 cd15328
serotonin receptor subtype 5, member of the class A family of seven-transmembrane G ...
18-348 1.80e-61

serotonin receptor subtype 5, member of the class A family of seven-transmembrane G protein-coupled receptors; 5-HT5 receptor, one of 14 mammalian 5-HT receptors, is activated by the neurotransmitter and peripheral signal mediator serotonin (also known as 5-hydroxytryptamine or 5-HT). The 5-HT5A and 5-HT5B receptors have been cloned from rat and mouse, but only the 5-HT5A isoform has been identified in human because of the presence of premature stop codons in the human 5-HT5B gene, which prevents a functional receptor from being expressed. 5-HT5 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/0) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320451 [Multi-domain]  Cd Length: 259  Bit Score: 197.87  E-value: 1.80e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTG-RWTLGQVVCDFWLSS 96
Cdd:cd15328   1 VLVLTLLAMLVVATFLWNLLVLVTILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGrRWQLGRSLCQVWISF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       97 DITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILY 176
Cdd:cd15328  81 DVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRRRISNVMIALTWALSAVISLAPLLFGWGETYSEDSEECQVSQEPSY 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      177 TVYSTVGAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvn 256
Cdd:cd15328 161 TVFSTFGAFYLPLCVVLFVYWKIYKAAQ---------------------------------------------------- 188
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      257 qvkvrvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPICkdACWFHLAIFDFFTWLGYLNSLINPII 336
Cdd:cd15328 189 -------------------KEKRAALMVGILIGVFVLCWIPFFLTELISPLC--SCDIPPIWKSIFLWLGYSNSFFNPLI 247
                       330
                ....*....|..
6G79_S      337 YTMSNEDFKQAF 348
Cdd:cd15328 248 YTAFNKNYNNAF 259
7tmA_5-HT2 cd15052
serotonin receptor subtype 2, member of the class A family of seven-transmembrane G ...
21-348 2.56e-60

serotonin receptor subtype 2, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT2 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the central nervous system (CNS). The 5-HT2 subfamily is composed of three subtypes that mediate excitatory neurotransmission: 5-HT2A, 5-HT2B, and 5-HT2C. They are selectively linked to G proteins of the G(q/11) family and activate phospholipase C, which leads to activation of protein kinase C and calcium release. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in diseases such as migraine, schizophrenia, and depression. Indeed, 5-HT2 receptors are attractive targets for a variety of psychoactive drugs, ranging from atypical antipsychotic drugs, antidepressants, and anxiolytics, which have an antagonistic action on 5-HT2 receptors, to hallucinogens, which act as agonists at postsynaptic 5-HT2 receptors. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320180 [Multi-domain]  Cd Length: 262  Bit Score: 194.84  E-value: 2.56e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       21 VMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTG-RWTLGQVVCDFWLSSDIT 99
Cdd:cd15052   4 ALLLLLLVIATIGGNILVCLAISLEKRLQNVTNYFLMSLAIADLLVGLLVMPLSILTELFGgVWPLPLVLCLLWVTLDVL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      100 CCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSE--CVVNTDHilYT 177
Cdd:cd15052  84 FCTASIMHLCTISLDRYMAIRYPLRTRRNKSRTTVFLKIAIVWLISIGISSPIPVLGIIDTTNVLNNgtCVLFNPN--FV 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      178 VYSTVGAFYFPTLLLIALYGriyvearsrilkqtpnrtgkrLTRAQLitdspgstssvtsinsrvpdvpsesgspvyvnq 257
Cdd:cd15052 162 IYGSIVAFFIPLLIMVVTYA---------------------LTIRLL--------------------------------- 187
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      258 vkvrvsdallekkklmaARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDA-CWFHLAIFDFFTWLGYLNSLINPII 336
Cdd:cd15052 188 -----------------SNEQKASKVLGIVFAVFVICWCPFFITNILTGLCEECnCRISPWLLSVFVWLGYVSSTINPII 250
                       330
                ....*....|..
6G79_S      337 YTMSNEDFKQAF 348
Cdd:cd15052 251 YTIFNKTFRRAF 262
7tmA_TAAR1 cd15314
trace amine-associated receptor 1 and similar receptors, member of the class A family of ...
18-348 8.07e-60

trace amine-associated receptor 1 and similar receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptor 1 (TAAR1) is one of the 15 identified trace amine-associated receptor subtypes, which form a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. TAAR1 is coupled to the Gs protein, which leads to activation of adenylate cyclase, and is thought to play functional role in the regulation of brain monoamines. TAAR1 is also shown to be activated by psychoactive compounds such as Ecstasy (MDMA), amphetamine and LSD. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320438 [Multi-domain]  Cd Length: 282  Bit Score: 194.38  E-value: 8.07e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15314   1 VLLYIFLGLISLVTVCGNLLVIISIAHFKQLHTPTNYLILSLAVADLLVGGLVMPPSMVRSVETCWYFGDLFCKIHSSFD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVW----VFSISISLPPFFWRQAKAEEEVSE--CVVNT 171
Cdd:cd15314  81 ITLCTASILNLCFISIDRYYAVCQPLLYRSKITVRVVLVMILISWsvsaLVGFGIIFLELNIKGIYYNHVACEggCLVFF 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      172 DHILYTVYSTVgAFYFPTLLLIALYGRIYVEARsrilkqtpnrtgKRLTRAQLITDSPGSTSSvtsinsrvpdvpsesgs 251
Cdd:cd15314 161 SKVSSVVGSVF-SFYIPAVIMLCIYLKIFLVAQ------------RQARSIQSARTKSGASSS----------------- 210
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      252 pvyvnqvkvrvsdallekkklmaARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLaiFDFFTWLGYLNSL 331
Cdd:cd15314 211 -----------------------KMERKATKTLAIVMGVFLLCWTPFFLCNIIDPFINYSIPPVL--IEVLNWLGYSNST 265
                       330
                ....*....|....*..
6G79_S      332 INPIIYTMSNEDFKQAF 348
Cdd:cd15314 266 LNPFIYAFFYSWFRKAF 282
7tmA_alpha2B_AR cd15321
alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G ...
23-348 2.70e-59

alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320444 [Multi-domain]  Cd Length: 268  Bit Score: 192.44  E-value: 2.70e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       23 LLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCT 102
Cdd:cd15321  12 AITFLILFTIFGNVLVIIAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFRKTWCEIYLALDVLFCT 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      103 ASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEE--VSECVVNtDHILYTVYS 180
Cdd:cd15321  92 SSIVHLCAISLDRYWSVSRAIEYNSKRTPRRIKCIILIVWLIAAVISLPPLIYKGKQKDEQggLPQCKLN-EEAWYILSS 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      181 TVGAFYFPTLLLIALYGRIYVEARSrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnqvkv 260
Cdd:cd15321 171 SIGSFFAPCLIMILVYLRIYLIAKN------------------------------------------------------- 195
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      261 rvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMS 340
Cdd:cd15321 196 ---------------REKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPELCKVPHSLFQFFFWIGYCNSSLNPVIYTIF 260

                ....*...
6G79_S      341 NEDFKQAF 348
Cdd:cd15321 261 NQDFRRAF 268
7tmA_D1A_dopamine_R cd15320
D1A (or D1) subtype dopamine receptor, member of the class A family of seven-transmembrane G ...
17-348 1.15e-58

D1A (or D1) subtype dopamine receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320443 [Multi-domain]  Cd Length: 319  Bit Score: 192.53  E-value: 1.15e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       17 KVLLVMLLALITLATTLSNAFVIATVYRTRKLHTP-ANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVvCDFWLS 95
Cdd:cd15320   1 RVLTGCFLSVLILSTLLGNTLVCAAVIRFRHLRSKvTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSF-CNIWVA 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       96 SDITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPP--FFWRQAKA-------EEEVSE 166
Cdd:cd15320  80 FDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVAFIMISVAWTLSVLISFIPvqLNWHKAKPtsfldlnASLRDL 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      167 CVVNTDHIL---YTVYSTVGAFYFPTLLLIALYGRIYVEARSRIlkqtpnRTGKRLTRAqlitdspgstssvtSINSRVP 243
Cdd:cd15320 160 TMDNCDSSLnrtYAISSSLISFYIPVAIMIVTYTRIYRIAQKQI------RRISALERA--------------AVHAKNC 219
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      244 DVPSESGSPVYVNQVKVRVsdallekkKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAI----F 319
Cdd:cd15320 220 QNSTGNRGSGDCQQPESSF--------KMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCKPTSTEPFCIssttF 291
                       330       340
                ....*....|....*....|....*....
6G79_S      320 DFFTWLGYLNSLINPIIYTMsNEDFKQAF 348
Cdd:cd15320 292 DVFVWFGWANSSLNPIIYAF-NADFRKAF 319
7tmA_alpha1_AR cd15062
alpha-1 adrenergic receptors, member of the class A family of seven-transmembrane G ...
18-348 1.60e-58

alpha-1 adrenergic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320190 [Multi-domain]  Cd Length: 261  Bit Score: 190.39  E-value: 1.60e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15062   1 IVVGVALGAFILFAIGGNLLVILSVACNRHLRTPTHYFIVNLAVADLLLSFTVLPFSATLEVLGYWAFGRIFCDVWAAVD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHiLYT 177
Cdd:cd15062  81 VLCCTASIMSLCVISVDRYIGVRYPLNYPTIVTARRATVALLIVWVLSLVISIGPLLGWKEPAPADEQACGVNEEP-GYV 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      178 VYSTVGAFYFPTLLLIALYGRIYVEArsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnq 257
Cdd:cd15062 160 LFSSLGSFYLPLAIILVMYCRVYVVA------------------------------------------------------ 185
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      258 vkvrvsdallekkkLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDaCWFHLAIFDFFTWLGYLNSLINPIIY 337
Cdd:cd15062 186 --------------FKFSREKKAAKTLGIVVGAFVLCWFPFFVVLPLGSLFST-LKPPEPVFKVVFWLGYFNSCLNPIIY 250
                       330
                ....*....|.
6G79_S      338 TMSNEDFKQAF 348
Cdd:cd15062 251 PCSSREFKRAF 261
7tmA_alpha2A_AR cd15322
alpha-2 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
18-348 2.14e-58

alpha-2 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320445 [Multi-domain]  Cd Length: 259  Bit Score: 189.77  E-value: 2.14e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15322   1 LTLIILVGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKA-EEEVSECVVNtDHILY 176
Cdd:cd15322  81 VLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKCIIFIVWVISAVISFPPLITIEKKSgQPEGPICKIN-DEKWY 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      177 TVYSTVGAFYFPTLLLIALYGRIYVEARSrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvn 256
Cdd:cd15322 160 IISSCIGSFFAPCLIMVLVYIRIYQIAKN--------------------------------------------------- 188
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      257 qvkvrvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPICKdaCWFHLAIFDFFTWLGYLNSLINPII 336
Cdd:cd15322 189 -------------------REKRFTFVLAVVIGVFVICWFPFFFTYTLTAVCD--CSVPETLFKFFFWFGYCNSSLNPVI 247
                       330
                ....*....|..
6G79_S      337 YTMSNEDFKQAF 348
Cdd:cd15322 248 YTIFNHDFRRAF 259
7tmA_alpha-2D_AR cd15324
alpha-2 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G ...
18-348 3.32e-57

alpha-2 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320447 [Multi-domain]  Cd Length: 256  Bit Score: 186.62  E-value: 3.32e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15324   1 ALIVLVVVVIILVTIVGNVLVVVAVFTSRALRAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGSTWCAFYLALD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFwrqaKAEEEVSECVVNtDHILYT 177
Cdd:cd15324  81 VLFCTSSIVHLCAISLDRYWSVTKAVSYNLKRTPKRIKRMIAVVWVISAVISFPPLL----MTKHDEWECLLN-DETWYI 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      178 VYSTVGAFYFPTLLLIALYGRIYvearsrilkqtpnrtgkrltraqlitdspgstssvtsinsrvpdvpsesgspvyvnq 257
Cdd:cd15324 156 LSSCTVSFFAPGLIMILVYCKIY--------------------------------------------------------- 178
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      258 vkvrvsdallekkKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIY 337
Cdd:cd15324 179 -------------RVAKMREKRFTFVLAVVMGVFVLCWFPFFFTYSLHAVCRKRCGIPDALFNLFFWIGYCNSSVNPIIY 245
                       330
                ....*....|.
6G79_S      338 TMSNEDFKQAF 348
Cdd:cd15324 246 TIFNRDFRKAF 256
7tmA_Histamine_H3R_H4R cd15048
histamine receptor subtypes H3R and H4R, member of the class A family of seven-transmembrane G ...
18-348 5.21e-57

histamine receptor subtypes H3R and H4R, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine subtypes H3R and H4R, members of the histamine receptor family, which belong to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H3 and H4 receptors couple to the G(i)-proteins, which leading to the inhibition of cAMP formation. The H3R receptor functions as a presynaptic autoreceptors controlling histamine release and synthesis. The H4R plays an important role in histamine-mediated chemotaxis in mast cells and eosinophils. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320176 [Multi-domain]  Cd Length: 296  Bit Score: 187.51  E-value: 5.21e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       18 VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSD 97
Cdd:cd15048   1 IVLAVLISVLILVTVIGNLLVILAFIKDKKLRTVSNFFLLNLAVADFLVGLVSMPFYIPYTLTGKWPFGKVFCKAWLVVD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       98 ITCCTASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPP-FFWRQAKAEEEV--SECVVN-TDH 173
Cdd:cd15048  81 YTLCTASALTIVLISLDRYLSVTKAVKYRAKQTKRRTVLLMALVWILAFLLYGPAiIGWDLWTGYSIVptGDCEVEfFDH 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      174 ILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRilkqtpnrtgkrltraqlitdspgSTSSVTSINSRVPDVPSESGSPV 253
Cdd:cd15048 161 FYFTFITSVLEFFIPFISVSFFNLLIYLNIRKR------------------------SRRRPLRSVPILPASQNPSRARS 216
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      254 YVNQVKVRvsdallekkklmaaRERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACwFHLAIFDFFTWLGYLNSLIN 333
Cdd:cd15048 217 QREQVKLR--------------RDRKAAKSLAILVLVFLICWAPYTILTIIRSFCSGSC-VDSYLYEFTFWLLWTNSAIN 281
                       330
                ....*....|....*
6G79_S      334 PIIYTMSNEDFKQAF 348
Cdd:cd15048 282 PFLYAACHPRFRKAF 296
7tmA_Beta1_AR cd15958
beta-1 adrenergic receptors (adrenoceptors), member of the class A family of ...
22-348 4.60e-56

beta-1 adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta-1 adrenergic receptor (beta-1 adrenoceptor), also known as beta-1 AR, is activated by adrenaline (epinephrine) and plays important roles in regulating cardiac function and heart rate. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of betrayers can lead to cardiac dysfunction such as arrhythmias or heart failure.


Pssm-ID: 320624 [Multi-domain]  Cd Length: 298  Bit Score: 185.11  E-value: 4.60e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S       22 MLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCC 101
Cdd:cd15958   5 LLMALIVLLIVAGNVLVIVAIGRTQRLQTLTNLFITSLACADLVMGLLVVPFGATLVVRGRWLYGSFFCELWTSVDVLCV 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      102 TASIWHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPF---FWR----QAKAEEEVSECVVNTDHI 174
Cdd:cd15958  85 TASIETLCVIAIDRYLAITSPFRYQSLLTRARAKGIVCTVWAISALVSFLPImmhWWRdeddQALKCYEDPGCCDFVTNR 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
6G79_S      175 LYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKqtPNRTGKRLTraqlitdspGSTSSVTSINSRVPdvpsesgspvy 254
Cdd:cd15958 165 AYAIASSIISFYIPLLIMIFVYLRVYREAKKQIKK