NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2098437835|pdb|7RLC|A]
View 

Chain A, Transitional endoplasmic reticulum ATPase

Protein Classification

CDC48 family AAA ATPase (domain architecture ID 1001098)

CDC48 family AAA ATPase is involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus; similar to yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein)

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CDC48 super family cl36852
AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two ...
40-779 0e+00

AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.


The actual alignment was detected with superfamily member TIGR01243:

Pssm-ID: 273521 [Multi-domain]  Cd Length: 733  Bit Score: 765.61  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A         40 RLIVDEAINED--NSVVSLSQPKMDELQLFRGDTVLLKGKKRReAVCIV--LSDDTCSDEKIRMNRVVRNNLRVRLGDVI 115
Cdd:TIGR01243   3 ELRVAEAYPRDvgRGIVRIDRQTAARLGVEPGDFVEIEKGDRS-VVAIVwpLRPDDEGRGIIRMDGYLRANAGVTIGDTV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        116 SIQPCpDVKYGKRIHVLPiddTVEGITGNLFEVYLKPYFLEayRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT 195
Cdd:TIGR01243  82 TVERA-EVKEAKKVVLAP---TQPIRFGRDFVDYVKEFLLG--KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEAT 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        196 VIHCEGEPIkREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVAN 275
Cdd:TIGR01243 156 EVEIREKPV-REEIERKVPKVTYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVAN 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        276 ETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH 355
Cdd:TIGR01243 235 EAGAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGLKGRGR 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        356 VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL 435
Cdd:TIGR01243 315 VIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILKVHTRNMPLAEDVDLDKLAEVTHGFVGADLAALAKEAAM 394
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        436 QAIRKKMDL--IDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVE 513
Cdd:TIGR01243 395 AALRRFIREgkINFEAEEIPAEVLKELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLK 474
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        514 HPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDE 593
Cdd:TIGR01243 475 HPEIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRKARQAAPAIIFFDE 554
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        594 LDSIAKARggNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILK 673
Cdd:TIGR01243 555 IDAIAPAR--GARFDTSVTDRIVNQLLTEMDGIQELSNVVVIAATNRPDILDPALLRPGRFDRLILVPPPDEEARKEIFK 632
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        674 ANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRrererqtnpSAMEVEEDDPVPE--IRRDHF 751
Cdd:TIGR01243 633 IHTRSMPLAEDVDLEELAEMTEGYTGADIEAVCREAAMAALRESIGSPAK---------EKLEVGEEEFLKDlkVEMRHF 703
                         730       740
                  ....*....|....*....|....*...
7RLC_A        752 EEAMRFARRSVSDNDIRKYEMFAQTLQQ 779
Cdd:TIGR01243 704 LEALKKVKPSVSKEDMLRYERLAKELKR 731
 
Name Accession Description Interval E-value
CDC48 TIGR01243
AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two ...
40-779 0e+00

AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.


Pssm-ID: 273521 [Multi-domain]  Cd Length: 733  Bit Score: 765.61  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A         40 RLIVDEAINED--NSVVSLSQPKMDELQLFRGDTVLLKGKKRReAVCIV--LSDDTCSDEKIRMNRVVRNNLRVRLGDVI 115
Cdd:TIGR01243   3 ELRVAEAYPRDvgRGIVRIDRQTAARLGVEPGDFVEIEKGDRS-VVAIVwpLRPDDEGRGIIRMDGYLRANAGVTIGDTV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        116 SIQPCpDVKYGKRIHVLPiddTVEGITGNLFEVYLKPYFLEayRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT 195
Cdd:TIGR01243  82 TVERA-EVKEAKKVVLAP---TQPIRFGRDFVDYVKEFLLG--KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEAT 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        196 VIHCEGEPIkREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVAN 275
Cdd:TIGR01243 156 EVEIREKPV-REEIERKVPKVTYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVAN 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        276 ETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH 355
Cdd:TIGR01243 235 EAGAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGLKGRGR 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        356 VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL 435
Cdd:TIGR01243 315 VIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILKVHTRNMPLAEDVDLDKLAEVTHGFVGADLAALAKEAAM 394
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        436 QAIRKKMDL--IDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVE 513
Cdd:TIGR01243 395 AALRRFIREgkINFEAEEIPAEVLKELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLK 474
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        514 HPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDE 593
Cdd:TIGR01243 475 HPEIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRKARQAAPAIIFFDE 554
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        594 LDSIAKARggNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILK 673
Cdd:TIGR01243 555 IDAIAPAR--GARFDTSVTDRIVNQLLTEMDGIQELSNVVVIAATNRPDILDPALLRPGRFDRLILVPPPDEEARKEIFK 632
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        674 ANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRrererqtnpSAMEVEEDDPVPE--IRRDHF 751
Cdd:TIGR01243 633 IHTRSMPLAEDVDLEELAEMTEGYTGADIEAVCREAAMAALRESIGSPAK---------EKLEVGEEEFLKDlkVEMRHF 703
                         730       740
                  ....*....|....*....|....*...
7RLC_A        752 EEAMRFARRSVSDNDIRKYEMFAQTLQQ 779
Cdd:TIGR01243 704 LEALKKVKPSVSKEDMLRYERLAKELKR 731
SpoVK COG0464
AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle ...
236-775 0e+00

AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms];


Pssm-ID: 223540 [Multi-domain]  Cd Length: 494  Bit Score: 547.89  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      236 ELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANEtGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI 315
Cdd:COG0464   1 ELPLKEPELFKKLGIEPPKGVLLHGPPGTGKTLLARALANE-GAEFLSINGPEILSKYVGESELRLRELFEEAEKLAPSI 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      316 IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKqRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEI 395
Cdd:COG0464  80 IFIDEIDALAPKRSSDQGEVERRVVAQLLALMDGLK-RGQVIVIGATNRPDGLDPAKRRPGRFDREIEVNLPDEAGRLEI 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      396 LQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEdetidaevmnsLAVTMDDFRWALSQSN 475
Cdd:COG0464 159 LQIHTRLMFLGPPGTGKTLAARTVGKSGADLGALAKEAALRELRRAIDLVGEY-----------IGVTEDDFEEALKKVL 227
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      476 PSalRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI 555
Cdd:COG0464 228 PS--RGVLFEDEDVTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGLRPPKGVLLYGPPGTGKTLLAKAVALESRSRFI 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      556 SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARggnIGDGGGAADRVINQILTEMDGMSTKKNVFII 635
Cdd:COG0464 306 SVKGSELLSKWVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGR---GPSEDGSGRRVVGQLLTELDGIEKAEGVLVI 382
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      636 GATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKS--PVAKDVDLEFLAKMTNGFSGADLTEICQRAckla 713
Cdd:COG0464 383 AATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKkpPLAEDVDLEELAEITEGYSGADIAALVREA---- 458
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|..
7RLC_A      714 iresieseirrererqtnpsAMEVEEDDPVPEIRRDHFEEAMRFARRSVSdndirkYEMFAQ 775
Cdd:COG0464 459 --------------------ALEALREARRREVTLDDFLDALKKIKPSVT------YEEWKE 494
PRK03992 PRK03992
proteasome-activating nucleotidase; Provisional
215-449 1.09e-94

proteasome-activating nucleotidase; Provisional


Pssm-ID: 179699 [Multi-domain]  Cd Length: 389  Bit Score: 301.37  E-value: 1.09e-94
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       215 EVGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLA 294
Cdd:PRK03992 127 NVTYEDIGGLEEQIREVREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVGSELVQKFI 206
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       295 GESESNLRKAFEEAEKNAPAIIFIDELDAIAPKR--EKTHGEVE-RRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPA 371
Cdd:PRK03992 207 GEGARLVRELFELAREKAPSIIFIDEIDAIAAKRtdSGTSGDREvQRTLMQLLAEMDGFDPRGNVKIIAATNRIDILDPA 286
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
7RLC_A       372 LRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLED 449
Cdd:PRK03992 287 ILRPGRFDRIIEVPLPDEEGRLEILKIHTRKMNLADDVDLEELAELTEGASGADLKAICTEAGMFAIRDDRTEVTMED 364
AAA pfam00004
ATPase family associated with various cellular activities (AAA). AAA family proteins often ...
256-385 7.34e-55

ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.


Pssm-ID: 365803  Cd Length: 131  Bit Score: 185.11  E-value: 7.34e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        256 ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEV 335
Cdd:pfam00004   1 VLLYGPPGTGKTTLAKAVAKELGAPFIEISGSELLSKYVGESEKRLRELFEAAKKLAPCVIFIDEIDALAGSRGSGGDSE 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
7RLC_A        336 ERRIVSQLLTLMDGLKQR-AHVIVMAATNRPNSIDPALRRfGRFDREVDIG 385
Cdd:pfam00004  81 SRRVVNQLLTELDGFTSSlSKVIVIGATNRPDKLDPALLR-GRFDRIIEVP 130
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
495-662 3.94e-30

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707 [Multi-domain]  Cd Length: 151  Bit Score: 116.09  E-value: 3.94e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      495 GGLEDVKRELQELVQYPvehpdkflkfgmtPSKGVLFYGPPGCGKTLLAKAIANEC---QANFISIKGPELLTMWFGESE 571
Cdd:cd00009   1 VGQEEAIEALREALELP-------------PPKNLLLYGPPGTGKTTLARAIANELfrpGAPFLYLNASDLLEGLVVAEL 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      572 AN---VREIFDKARQAAPCVLFFDELDSIAKArggnigdgggAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAI 648
Cdd:cd00009  68 FGhflVRLLFELAEKAKPGVLFIDEIDSLSRG----------AQNALLRVLETLNDLRIDRENVRVIGATNRPLLGDLDR 137
                       170
                ....*....|....
7RLC_A      649 LRPGRLDQLIYIPL 662
Cdd:cd00009 138 ALYDRLDIRIVIPL 151
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
525-664 3.19e-20

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 87.81  E-value: 3.19e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A         525 PSKGVLFYGPPGCGKTLLAKAIANECQAN---FISIKGPELL--------------TMWFGESEANVREIFDKARQAAPC 587
Cdd:smart00382   1 PGEVILIVGPPGSGKTTLARALARELGPPgggVIYIDGEDILeevldqllliivggKKASGSGELRLRLALALARKLKPD 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
7RLC_A         588 VLFFDELDSIAKARggnigdggGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPgRLDQLIYIPLPD 664
Cdd:smart00382  81 VLILDEITSLLDAE--------QEALLLLLEELRLLLLLKSEKNLTVILTTNDEKDLGPALLRR-RFDRRIVLLLIL 148
 
Name Accession Description Interval E-value
CDC48 TIGR01243
AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two ...
40-779 0e+00

AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.


Pssm-ID: 273521 [Multi-domain]  Cd Length: 733  Bit Score: 765.61  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A         40 RLIVDEAINED--NSVVSLSQPKMDELQLFRGDTVLLKGKKRReAVCIV--LSDDTCSDEKIRMNRVVRNNLRVRLGDVI 115
Cdd:TIGR01243   3 ELRVAEAYPRDvgRGIVRIDRQTAARLGVEPGDFVEIEKGDRS-VVAIVwpLRPDDEGRGIIRMDGYLRANAGVTIGDTV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        116 SIQPCpDVKYGKRIHVLPiddTVEGITGNLFEVYLKPYFLEayRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT 195
Cdd:TIGR01243  82 TVERA-EVKEAKKVVLAP---TQPIRFGRDFVDYVKEFLLG--KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEAT 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        196 VIHCEGEPIkREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVAN 275
Cdd:TIGR01243 156 EVEIREKPV-REEIERKVPKVTYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVAN 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        276 ETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH 355
Cdd:TIGR01243 235 EAGAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGLKGRGR 314
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        356 VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL 435
Cdd:TIGR01243 315 VIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILKVHTRNMPLAEDVDLDKLAEVTHGFVGADLAALAKEAAM 394
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        436 QAIRKKMDL--IDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVE 513
Cdd:TIGR01243 395 AALRRFIREgkINFEAEEIPAEVLKELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLK 474
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        514 HPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDE 593
Cdd:TIGR01243 475 HPEIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRKARQAAPAIIFFDE 554
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        594 LDSIAKARggNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILK 673
Cdd:TIGR01243 555 IDAIAPAR--GARFDTSVTDRIVNQLLTEMDGIQELSNVVVIAATNRPDILDPALLRPGRFDRLILVPPPDEEARKEIFK 632
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        674 ANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRrererqtnpSAMEVEEDDPVPE--IRRDHF 751
Cdd:TIGR01243 633 IHTRSMPLAEDVDLEELAEMTEGYTGADIEAVCREAAMAALRESIGSPAK---------EKLEVGEEEFLKDlkVEMRHF 703
                         730       740
                  ....*....|....*....|....*...
7RLC_A        752 EEAMRFARRSVSDNDIRKYEMFAQTLQQ 779
Cdd:TIGR01243 704 LEALKKVKPSVSKEDMLRYERLAKELKR 731
SpoVK COG0464
AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle ...
236-775 0e+00

AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms];


Pssm-ID: 223540 [Multi-domain]  Cd Length: 494  Bit Score: 547.89  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      236 ELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANEtGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI 315
Cdd:COG0464   1 ELPLKEPELFKKLGIEPPKGVLLHGPPGTGKTLLARALANE-GAEFLSINGPEILSKYVGESELRLRELFEEAEKLAPSI 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      316 IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKqRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEI 395
Cdd:COG0464  80 IFIDEIDALAPKRSSDQGEVERRVVAQLLALMDGLK-RGQVIVIGATNRPDGLDPAKRRPGRFDREIEVNLPDEAGRLEI 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      396 LQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEdetidaevmnsLAVTMDDFRWALSQSN 475
Cdd:COG0464 159 LQIHTRLMFLGPPGTGKTLAARTVGKSGADLGALAKEAALRELRRAIDLVGEY-----------IGVTEDDFEEALKKVL 227
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      476 PSalRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI 555
Cdd:COG0464 228 PS--RGVLFEDEDVTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGLRPPKGVLLYGPPGTGKTLLAKAVALESRSRFI 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      556 SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARggnIGDGGGAADRVINQILTEMDGMSTKKNVFII 635
Cdd:COG0464 306 SVKGSELLSKWVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGR---GPSEDGSGRRVVGQLLTELDGIEKAEGVLVI 382
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      636 GATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKS--PVAKDVDLEFLAKMTNGFSGADLTEICQRAckla 713
Cdd:COG0464 383 AATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKkpPLAEDVDLEELAEITEGYSGADIAALVREA---- 458
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|..
7RLC_A      714 iresieseirrererqtnpsAMEVEEDDPVPEIRRDHFEEAMRFARRSVSdndirkYEMFAQ 775
Cdd:COG0464 459 --------------------ALEALREARRREVTLDDFLDALKKIKPSVT------YEEWKE 494
RPT1 COG1222
ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein ...
209-449 7.56e-96

ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 224143 [Multi-domain]  Cd Length: 406  Bit Score: 304.96  E-value: 7.56e-96
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      209 EEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPE 288
Cdd:COG1222 141 EVEEKPDVTYEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVVGSE 220
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      289 IMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKR--EKTHGEVE-RRIVSQLLTLMDGLKQRAHVIVMAATNRP 365
Cdd:COG1222 221 LVQKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRfdSGTSGDREvQRTMLELLNQLDGFDPRGNVKVIMATNRP 300
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      366 NSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLI 445
Cdd:COG1222 301 DILDPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRKMNLADDVDLELLARLTEGFSGADLKAICTEAGMFAIRERRDEV 380

                ....
7RLC_A      446 DLED 449
Cdd:COG1222 381 TMED 384
PRK03992 PRK03992
proteasome-activating nucleotidase; Provisional
215-449 1.09e-94

proteasome-activating nucleotidase; Provisional


Pssm-ID: 179699 [Multi-domain]  Cd Length: 389  Bit Score: 301.37  E-value: 1.09e-94
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       215 EVGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLA 294
Cdd:PRK03992 127 NVTYEDIGGLEEQIREVREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVGSELVQKFI 206
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       295 GESESNLRKAFEEAEKNAPAIIFIDELDAIAPKR--EKTHGEVE-RRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPA 371
Cdd:PRK03992 207 GEGARLVRELFELAREKAPSIIFIDEIDAIAAKRtdSGTSGDREvQRTLMQLLAEMDGFDPRGNVKIIAATNRIDILDPA 286
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
7RLC_A       372 LRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLED 449
Cdd:PRK03992 287 ILRPGRFDRIIEVPLPDEEGRLEILKIHTRKMNLADDVDLEELAELTEGASGADLKAICTEAGMFAIRDDRTEVTMED 364
PRK03992 PRK03992
proteasome-activating nucleotidase; Provisional
483-709 4.17e-88

proteasome-activating nucleotidase; Provisional


Pssm-ID: 179699 [Multi-domain]  Cd Length: 389  Bit Score: 284.03  E-value: 4.17e-88
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       483 VVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPEL 562
Cdd:PRK03992 122 VIESPNVTYEDIGGLEEQIREVREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVGSEL 201
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       563 LTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARggniGDGGGAADRVIN----QILTEMDGMSTKKNVFIIGAT 638
Cdd:PRK03992 202 VQKFIGEGARLVRELFELAREKAPSIIFIDEIDAIAAKR----TDSGTSGDREVQrtlmQLLAEMDGFDPRGNVKIIAAT 277
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
7RLC_A       639 NRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA 709
Cdd:PRK03992 278 NRIDILDPAILRPGRFDRIIEVPLPDEEGRLEILKIHTRKMNLADDVDLEELAELTEGASGADLKAICTEA 348
RPT1 COG1222
ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein ...
476-709 4.88e-88

ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 224143 [Multi-domain]  Cd Length: 406  Bit Score: 284.54  E-value: 4.88e-88
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      476 PSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI 555
Cdd:COG1222 135 PRVSVMEVEEKPDVTYEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFI 214
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      556 SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFII 635
Cdd:COG1222 215 RVVGSELVQKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPRGNVKVI 294
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
7RLC_A      636 GATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA 709
Cdd:COG1222 295 MATNRPDILDPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRKMNLADDVDLELLARLTEGFSGADLKAICTEA 368
26Sp45 TIGR01242
26S proteasome subunit P45 family; Many proteins may score above the trusted cutoff because an ...
196-449 1.75e-85

26S proteasome subunit P45 family; Many proteins may score above the trusted cutoff because an internal


Pssm-ID: 130309 [Multi-domain]  Cd Length: 364  Bit Score: 276.29  E-value: 1.75e-85
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        196 VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVAN 275
Cdd:TIGR01242  99 VLPTSKDPLVKGMEVEERPNVSYEDIGGLEEQIREIREAVELPLKHPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAH 178
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        276 ETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKR--EKTHGEVE-RRIVSQLLTLMDGLKQ 352
Cdd:TIGR01242 179 ETNATFIRVVGSELVRKYIGEGARLVREIFELAKEKAPSIIFIDEIDAIAAKRtdSGTSGDREvQRTLMQLLAELDGFDP 258
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        353 RAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSE 432
Cdd:TIGR01242 259 RGNVKVIAATNRPDILDPALLRPGRFDRIIEVPLPDFEGRLEILKIHTRKMKLAEDVDLEAIAKMTEGASGADLKAICTE 338
                         250
                  ....*....|....*..
7RLC_A        433 AALQAIRKKMDLIDLED 449
Cdd:TIGR01242 339 AGMFAIREERDYVTMDD 355
SpoVK COG0464
AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle ...
204-478 3.05e-85

AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms];


Pssm-ID: 223540 [Multi-domain]  Cd Length: 494  Bit Score: 280.17  E-value: 3.05e-85
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      204 IKREDEEESLNE-------------VGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIA 270
Cdd:COG0464 214 VTEDDFEEALKKvlpsrgvlfededVTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGLRPPKGVLLYGPPGTGKTLLA 293
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      271 RAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL 350
Cdd:COG0464 294 KAVALESRSRFISVKGSELLSKWVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGRGPSEDGSGRRVVGQLLTELDGI 373
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      351 KQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMK--LADDVDLEQVANETHGHVGADLAA 428
Cdd:COG0464 374 EKAEGVLVIAATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKKppLAEDVDLEELAEITEGYSGADIAA 453
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|
7RLC_A      429 LCSEAALQAIRkkmdlidledETIDAEvmnslaVTMDDFRWALSQSNPSA 478
Cdd:COG0464 454 LVREAALEALR----------EARRRE------VTLDDFLDALKKIKPSV 487
26Sp45 TIGR01242
26S proteasome subunit P45 family; Many proteins may score above the trusted cutoff because an ...
472-709 1.65e-80

26S proteasome subunit P45 family; Many proteins may score above the trusted cutoff because an internal


Pssm-ID: 130309 [Multi-domain]  Cd Length: 364  Bit Score: 263.20  E-value: 1.65e-80
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        472 SQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQ 551
Cdd:TIGR01242 102 TSKDPLVKGMEVEERPNVSYEDIGGLEEQIREIREAVELPLKHPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETN 181
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        552 ANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKN 631
Cdd:TIGR01242 182 ATFIRVVGSELVRKYIGEGARLVREIFELAKEKAPSIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAELDGFDPRGN 261
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
7RLC_A        632 VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA 709
Cdd:TIGR01242 262 VKVIAATNRPDILDPALLRPGRFDRIIEVPLPDFEGRLEILKIHTRKMKLAEDVDLEAIAKMTEGASGADLKAICTEA 339
FtsH_fam TIGR01241
ATP-dependent metalloprotease FtsH; HflB(FtsH) is a pleiotropic protein required for correct ...
210-457 6.15e-77

ATP-dependent metalloprotease FtsH; HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 273520 [Multi-domain]  Cd Length: 495  Bit Score: 257.98  E-value: 6.15e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        210 EESLNEVGYDDIGGCRKQLAQIKEMVELpLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEI 289
Cdd:TIGR01241  46 NEEKPKVTFKDVAGIDEAKEELMEIVDF-LKNPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDF 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        290 MSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREK----THGEVERRIvSQLLTLMDGLKQRAHVIVMAATNRP 365
Cdd:TIGR01241 125 VEMFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAglggGNDEREQTL-NQLLVEMDGFGTNTGVIVIAATNRP 203
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        366 NSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLI 445
Cdd:TIGR01241 204 DVLDPALLRPGRFDRQVVVDLPDIKGREEILKVHAKNKKLAPDVDLKAVARRTPGFSGADLANLLNEAALLAARKNKTEI 283
                         250
                  ....*....|....
7RLC_A        446 DLED--ETIDAEVM 457
Cdd:TIGR01241 284 TMNDieEAIDRVIA 297
PTZ00361 PTZ00361
26 proteosome regulatory subunit 4-like protein; Provisional
218-449 5.51e-73

26 proteosome regulatory subunit 4-like protein; Provisional


Pssm-ID: 185575 [Multi-domain]  Cd Length: 438  Bit Score: 245.45  E-value: 5.51e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       218 YDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGES 297
Cdd:PTZ00361 182 YADIGGLEQQIQEIKEAVELPLTHPELYDDIGIKPPKGVILYGPPGTGKTLLAKAVANETSATFLRVVGSELIQKYLGDG 261
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       298 ESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTH--GEVE-RRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRR 374
Cdd:PTZ00361 262 PKLVRELFRVAEENAPSIVFIDEIDAIGTKRYDATsgGEKEiQRTMLELLNQLDGFDSRGDVKVIMATNRIESLDPALIR 341
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
7RLC_A       375 FGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLED 449
Cdd:PTZ00361 342 PGRIDRKIEFPNPDEKTKRRIFEIHTSKMTLAEDVDLEEFIMAKDELSGADIKAICTEAGLLALRERRMKVTQAD 416
FtsH_fam TIGR01241
ATP-dependent metalloprotease FtsH; HflB(FtsH) is a pleiotropic protein required for correct ...
485-713 7.84e-73

ATP-dependent metalloprotease FtsH; HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 273520 [Multi-domain]  Cd Length: 495  Bit Score: 246.81  E-value: 7.84e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        485 EVPQVTWEDIGGLEDVKRELQELVQYpVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLT 564
Cdd:TIGR01241  48 EKPKVTFKDVAGIDEAKEELMEIVDF-LKNPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVE 126
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        565 MWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDII 644
Cdd:TIGR01241 127 MFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLVEMDGFGTNTGVIVIAATNRPDVL 206
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
7RLC_A        645 DPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLA 713
Cdd:TIGR01241 207 DPALLRPGRFDRQVVVDLPDIKGREEILKVHAKNKKLAPDVDLKAVARRTPGFSGADLANLLNEAALLA 275
PTZ00454 PTZ00454
26S protease regulatory subunit 6B-like protein; Provisional
215-440 1.24e-70

26S protease regulatory subunit 6B-like protein; Provisional


Pssm-ID: 240423 [Multi-domain]  Cd Length: 398  Bit Score: 237.74  E-value: 1.24e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       215 EVGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLA 294
Cdd:PTZ00454 141 DVTYSDIGGLDIQKQEIREAVELPLTCPELYEQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTATFIRVVGSEFVQKYL 220
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       295 GESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVER---RIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPA 371
Cdd:PTZ00454 221 GEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGADRevqRILLELLNQMDGFDQTTNVKVIMATNRADTLDPA 300
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
7RLC_A       372 LRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRK 440
Cdd:PTZ00454 301 LLRPGRLDRKIEFPLPDRRQKRLIFQTITSKMNLSEEVDLEDFVSRPEKISAADIAAICQEAGMQAVRK 369
ftsH CHL00176
cell division protein; Validated
489-702 9.54e-68

cell division protein; Validated


Pssm-ID: 214386 [Multi-domain]  Cd Length: 638  Bit Score: 236.87  E-value: 9.54e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       489 VTWEDIGGLEDVKRELQELVQYpVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFG 568
Cdd:CHL00176 180 ITFRDIAGIEEAKEEFEEVVSF-LKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAEVPFFSISGSEFVEMFVG 258
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       569 ESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAI 648
Cdd:CHL00176 259 VGAARVRDLFKKAKENSPCIVFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEMDGFKGNKGVIVIAATNRVDILDAAL 338
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
7RLC_A       649 LRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADL 702
Cdd:CHL00176 339 LRPGRFDRQITVSLPDREGRLDILKVHARNKKLSPDVSLELIARRTPGFSGADL 392
HflB COG0465
ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones];
216-453 1.56e-65

ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223541 [Multi-domain]  Cd Length: 596  Bit Score: 229.51  E-value: 1.56e-65
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      216 VGYDDIGGCRKQLAQIKEMVElPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGP---EIMSK 292
Cdd:COG0465 147 VTFADVAGVDEAKEELSELVD-FLKNPKKYQALGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSdfvEMFVG 225
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      293 LaGESESnlRKAFEEAEKNAPAIIFIDELDAIAPKREKT--HGEVERRIV-SQLLTLMDGLKQRAHVIVMAATNRPNSID 369
Cdd:COG0465 226 V-GASRV--RDLFEQAKKNAPCIIFIDEIDAVGRQRGAGlgGGNDEREQTlNQLLVEMDGFGGNEGVIVIAATNRPDVLD 302
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      370 PALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLED 449
Cdd:COG0465 303 PALLRPGRFDRQILVELPDIKGREQILKVHAKNKPLAEDVDLKKIARGTPGFSGADLANLLNEAALLAARRNKKEITMRD 382

                ....*.
7RLC_A      450 --ETID 453
Cdd:COG0465 383 ieEAID 388
HflB COG0465
ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones];
487-709 1.49e-62

ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223541 [Multi-domain]  Cd Length: 596  Bit Score: 221.42  E-value: 1.49e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      487 PQVTWEDIGGLEDVKRELQELVQYpVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMW 566
Cdd:COG0465 145 VKVTFADVAGVDEAKEELSELVDF-LKNPKKYQALGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMF 223
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      567 FGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDP 646
Cdd:COG0465 224 VGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLVEMDGFGGNEGVIVIAATNRPDVLDP 303
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|...
7RLC_A      647 AILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA 709
Cdd:COG0465 304 ALLRPGRFDRQILVELPDIKGREQILKVHAKNKPLAEDVDLKKIARGTPGFSGADLANLLNEA 366
ftsH CHL00176
cell division protein; Validated
216-453 1.04e-61

cell division protein; Validated


Pssm-ID: 214386 [Multi-domain]  Cd Length: 638  Bit Score: 219.92  E-value: 1.04e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       216 VGYDDIGGCRKQLAQIKEMVELpLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAG 295
Cdd:CHL00176 180 ITFRDIAGIEEAKEEFEEVVSF-LKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAEVPFFSISGSEFVEMFVG 258
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       296 ESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREK----THGEVERrIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPA 371
Cdd:CHL00176 259 VGAARVRDLFKKAKENSPCIVFIDEIDAVGRQRGAgiggGNDEREQ-TLNQLLTEMDGFKGNKGVIVIAATNRVDILDAA 337
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       372 LRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLE--D 449
Cdd:CHL00176 338 LLRPGRFDRQITVSLPDREGRLDILKVHARNKKLSPDVSLELIARRTPGFSGADLANLLNEAAILTARRKKATITMKeiD 417

                 ....
7RLC_A       450 ETID 453
Cdd:CHL00176 418 TAID 421
PTZ00454 PTZ00454
26S protease regulatory subunit 6B-like protein; Provisional
485-713 7.32e-61

26S protease regulatory subunit 6B-like protein; Provisional


Pssm-ID: 240423 [Multi-domain]  Cd Length: 398  Bit Score: 211.16  E-value: 7.32e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       485 EVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLT 564
Cdd:PTZ00454 138 EKPDVTYSDIGGLDIQKQEIREAVELPLTCPELYEQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTATFIRVVGSEFVQ 217
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       565 MWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDII 644
Cdd:PTZ00454 218 KYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTL 297
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
7RLC_A       645 DPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLA 713
Cdd:PTZ00454 298 DPALLRPGRLDRKIEFPLPDRRQKRLIFQTITSKMNLSEEVDLEDFVSRPEKISAADIAAICQEAGMQA 366
hflB PRK10733
ATP-dependent zinc metalloprotease FtsH;
488-713 5.83e-60

ATP-dependent zinc metalloprotease FtsH;


Pssm-ID: 182683 [Multi-domain]  Cd Length: 644  Bit Score: 215.28  E-value: 5.83e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       488 QVTWEDIGGLEDVKRELQELVQYpVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWF 567
Cdd:PRK10733 148 KTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFV 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       568 GESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPA 647
Cdd:PRK10733 227 GVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPA 306
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
7RLC_A       648 ILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLA 713
Cdd:PRK10733 307 LLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFA 372
pup_AAA TIGR03689
proteasome ATPase; In the Actinobacteria, as shown for Mycobacterium tuberculosis, some ...
202-458 1.76e-58

proteasome ATPase; In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity. [Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 200312 [Multi-domain]  Cd Length: 512  Bit Score: 208.02  E-value: 1.76e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        202 EPIKR-EDEEESLNE---VGYDDIGGCRKQLAQIKEMVELPLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANET 277
Cdd:TIGR03689 161 EAIPRtEVEDLVLEEvpdVTYADIGGLGSQIEQIRDAVELPFLHPELYREYGLKPPKGVLLYGPPGCGKTLIAKAVANSL 240
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        278 G----------AFFFLINGPEIMSKLAGESESNLRKAFEEAEKNA----PAIIFIDELDAIApkreKTHG-----EVERR 338
Cdd:TIGR03689 241 AarigaegggkSYFLNIKGPELLNKYVGETERQIRLIFQRAREKAsegrPVIVFFDEMDSLF----RTRGsgvssDVETT 316
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        339 IVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHtknmkLADDVDLEQVANET 418
Cdd:TIGR03689 317 VVPQLLAEIDGVESLDNVIVIGASNREDMIDPAILRPGRLDVKIRIERPDAEAAADIFAKY-----LTDDLPLPEDLAAH 391
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|..
7RLC_A        419 HGHVGADLAALCSEA--ALQAIRKKMDLIDLEDETIDAEVMN 458
Cdd:TIGR03689 392 DGDREATAAALIQRVvdALYARSEANRYVEVTYANGSTEVLY 433
pup_AAA TIGR03689
proteasome ATPase; In the Actinobacteria, as shown for Mycobacterium tuberculosis, some ...
468-684 2.41e-58

proteasome ATPase; In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity. [Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 200312 [Multi-domain]  Cd Length: 512  Bit Score: 207.64  E-value: 2.41e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        468 RWALSQSNPSALRETVV-EVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAI 546
Cdd:TIGR03689 157 GYAFEAIPRTEVEDLVLeEVPDVTYADIGGLGSQIEQIRDAVELPFLHPELYREYGLKPPKGVLLYGPPGCGKTLIAKAV 236
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        547 ANE-CQ---------ANFISIKGPELLTMWFGESEANVREIFDKARQAA----PCVLFFDELDSIAKARGGNIGDGGGAA 612
Cdd:TIGR03689 237 ANSlAArigaegggkSYFLNIKGPELLNKYVGETERQIRLIFQRAREKAsegrPVIVFFDEMDSLFRTRGSGVSSDVETT 316
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
7RLC_A        613 drVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKS-PVAKD 684
Cdd:TIGR03689 317 --VVPQLLAEIDGVESLDNVIVIGASNREDMIDPAILRPGRLDVKIRIERPDAEAAADIFAKYLTDDlPLPED 387
hflB PRK10733
ATP-dependent zinc metalloprotease FtsH;
218-439 4.06e-58

ATP-dependent zinc metalloprotease FtsH;


Pssm-ID: 182683 [Multi-domain]  Cd Length: 644  Bit Score: 209.89  E-value: 4.06e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       218 YDDIGGCRKQLAQIKEMVELpLRHPALFKEIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGES 297
Cdd:PRK10733 151 FADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVG 229
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       298 ESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKT----HGEVERRIvSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALR 373
Cdd:PRK10733 230 ASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGlgggHDEREQTL-NQMLVEMDGFEGNEGIIVIAATNRPDVLDPALL 308
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
7RLC_A       374 RFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIR 439
Cdd:PRK10733 309 RPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAAR 374
PTZ00361 PTZ00361
26 proteosome regulatory subunit 4-like protein; Provisional
483-713 5.44e-55

26 proteosome regulatory subunit 4-like protein; Provisional


Pssm-ID: 185575 [Multi-domain]  Cd Length: 438  Bit Score: 196.15  E-value: 5.44e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       483 VVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPEL 562
Cdd:PTZ00361 174 VDKAPLESYADIGGLEQQIQEIKEAVELPLTHPELYDDIGIKPPKGVILYGPPGTGKTLLAKAVANETSATFLRVVGSEL 253
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       563 LTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPD 642
Cdd:PTZ00361 254 IQKYLGDGPKLVRELFRVAEENAPSIVFIDEIDAIGTKRYDATSGGEKEIQRTMLELLNQLDGFDSRGDVKVIMATNRIE 333
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
7RLC_A       643 IIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLA 713
Cdd:PTZ00361 334 SLDPALIRPGRIDRKIEFPNPDEKTKRRIFEIHTSKMTLAEDVDLEEFIMAKDELSGADIKAICTEAGLLA 404
AAA pfam00004
ATPase family associated with various cellular activities (AAA). AAA family proteins often ...
256-385 7.34e-55

ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.


Pssm-ID: 365803  Cd Length: 131  Bit Score: 185.11  E-value: 7.34e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        256 ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEV 335
Cdd:pfam00004   1 VLLYGPPGTGKTTLAKAVAKELGAPFIEISGSELLSKYVGESEKRLRELFEAAKKLAPCVIFIDEIDALAGSRGSGGDSE 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
7RLC_A        336 ERRIVSQLLTLMDGLKQR-AHVIVMAATNRPNSIDPALRRfGRFDREVDIG 385
Cdd:pfam00004  81 SRRVVNQLLTELDGFTSSlSKVIVIGATNRPDKLDPALLR-GRFDRIIEVP 130
AAA pfam00004
ATPase family associated with various cellular activities (AAA). AAA family proteins often ...
529-662 3.98e-54

ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.


Pssm-ID: 365803  Cd Length: 131  Bit Score: 183.18  E-value: 3.98e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        529 VLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARggnIGDG 608
Cdd:pfam00004   1 VLLYGPPGTGKTTLAKAVAKELGAPFIEISGSELLSKYVGESEKRLRELFEAAKKLAPCVIFIDEIDALAGSR---GSGG 77
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
7RLC_A        609 GGAADRVINQILTEMDGMSTKK-NVFIIGATNRPDIIDPAILRpGRLDQLIYIPL 662
Cdd:pfam00004  78 DSESRRVVNQLLTELDGFTSSLsKVIVIGATNRPDKLDPALLR-GRFDRIIEVPL 131
COG1223 COG1223
Predicted ATPase, AAA+ superfamily [General function prediction only];
145-449 5.17e-54

Predicted ATPase, AAA+ superfamily [General function prediction only];


Pssm-ID: 224144 [Multi-domain]  Cd Length: 368  Bit Score: 191.18  E-value: 5.17e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      145 LFEVYLKPYFlEAYRpIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEpikREDEEESLNEVGYDDIGGc 224
Cdd:COG1223  52 VFNIYARDQW-LGEV-VREGDYLFDTRMFPDYAFKVIRVVPSGGGIITSTTIFVLETP---REEDREIISDITLDDVIG- 125
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      225 rKQLAQIK-EMVELPLRHPALFKEIGvkpPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRK 303
Cdd:COG1223 126 -QEEAKRKcRLIMEYLENPERFGDWA---PKNVLFYGPPGTGKTMMAKALANEAKVPLLLVKATELIGEHVGDGARRIHE 201
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      304 AFEEAEKNAPAIIFIDELDAIAPKRE--KTHGEVErRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRrfGRFDRE 381
Cdd:COG1223 202 LYERARKAAPCIVFIDELDAIALDRRyqELRGDVS-EIVNALLTELDGIKENEGVVTIAATNRPELLDPAIR--SRFEEE 278
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
7RLC_A      382 VDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL-QAIRKKMDLIDLED 449
Cdd:COG1223 279 IEFKLPNDEERLEILEYYAKKFPLPVDADLRYLAAKTKGMSGRDIKEKVLKTALhRAIAEDREKVERED 347
COG1223 COG1223
Predicted ATPase, AAA+ superfamily [General function prediction only];
485-704 1.68e-52

Predicted ATPase, AAA+ superfamily [General function prediction only];


Pssm-ID: 224144 [Multi-domain]  Cd Length: 368  Bit Score: 186.94  E-value: 1.68e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      485 EVPQVTWEDIGGLEDVKRELQELVQYpVEHPDKFLKFGmtpSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLT 564
Cdd:COG1223 114 IISDITLDDVIGQEEAKRKCRLIMEY-LENPERFGDWA---PKNVLFYGPPGTGKTMMAKALANEAKVPLLLVKATELIG 189
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      565 MWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAadRVINQILTEMDGMSTKKNVFIIGATNRPDII 644
Cdd:COG1223 190 EHVGDGARRIHELYERARKAAPCIVFIDELDAIALDRRYQELRGDVS--EIVNALLTELDGIKENEGVVTIAATNRPELL 267
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      645 DPAIlrPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTE 704
Cdd:COG1223 268 DPAI--RSRFEEEIEFKLPNDEERLEILEYYAKKFPLPVDADLRYLAAKTKGMSGRDIKE 325
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
495-662 3.94e-30

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707 [Multi-domain]  Cd Length: 151  Bit Score: 116.09  E-value: 3.94e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      495 GGLEDVKRELQELVQYPvehpdkflkfgmtPSKGVLFYGPPGCGKTLLAKAIANEC---QANFISIKGPELLTMWFGESE 571
Cdd:cd00009   1 VGQEEAIEALREALELP-------------PPKNLLLYGPPGTGKTTLARAIANELfrpGAPFLYLNASDLLEGLVVAEL 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      572 AN---VREIFDKARQAAPCVLFFDELDSIAKArggnigdgggAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAI 648
Cdd:cd00009  68 FGhflVRLLFELAEKAKPGVLFIDEIDSLSRG----------AQNALLRVLETLNDLRIDRENVRVIGATNRPLLGDLDR 137
                       170
                ....*....|....
7RLC_A      649 LRPGRLDQLIYIPL 662
Cdd:cd00009 138 ALYDRLDIRIVIPL 151
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
222-385 9.62e-30

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707 [Multi-domain]  Cd Length: 151  Bit Score: 114.94  E-value: 9.62e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      222 GGCRKQLAQIKEMVELPlrhpalfkeigvkPPRGILLYGPPGTGKTLIARAVANET---GAFFFLINGPEIMSKLAGESE 298
Cdd:cd00009   1 VGQEEAIEALREALELP-------------PPKNLLLYGPPGTGKTTLARAIANELfrpGAPFLYLNASDLLEGLVVAEL 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      299 ---SNLRKAFEEAEKNAPAIIFIDELDAIAPkrekthgEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF 375
Cdd:cd00009  68 fghFLVRLLFELAEKAKPGVLFIDEIDSLSR-------GAQNALLRVLETLNDLRIDRENVRVIGATNRPLLGDLDRALY 140
                       170
                ....*....|
7RLC_A      376 GRFDREVDIG 385
Cdd:cd00009 141 DRLDIRIVIP 150
ycf46 CHL00195
Ycf46; Provisional
425-707 5.47e-26

Ycf46; Provisional


Pssm-ID: 177094 [Multi-domain]  Cd Length: 489  Bit Score: 112.42  E-value: 5.47e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       425 DLAALCSEAALQAIRKKMDLIDLEDETIDAevmNSLAVTMDDFRWALSQSNpsalretVVEV--PQVTWEDIGGLEDVKR 502
Cdd:CHL00195 169 NLTRACQGLSLERIRRVLSKIIATYKTIDE---NSIPLILEEKKQIISQTE-------ILEFysVNEKISDIGGLDNLKD 238
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       503 ELQelvQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKAR 582
Cdd:CHL00195 239 WLK---KRSTSFSKQASNYGLPTPRGLLLVGIQGTGKSLTAKAIANDWQLPLLRLDVGKLFGGIVGESESRMRQMIRIAE 315
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       583 QAAPCVLFFDELDsiaKA-RGGNIGDGGGAADRVINQILTemdGMSTKKN-VFIIGATNRPDIIDPAILRPGRLDQLIYI 660
Cdd:CHL00195 316 ALSPCILWIDEID---KAfSNSESKGDSGTTNRVLATFIT---WLSEKKSpVFVVATANNIDLLPLEILRKGRFDEIFFL 389
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
7RLC_A       661 PLPDEKSRVAILKANLRKS-PVA-KDVDLEFLAKMTNGFSGAdltEICQ 707
Cdd:CHL00195 390 DLPSLEEREKIFKIHLQKFrPKSwKKYDIKKLSKLSNKFSGA---EIEQ 435
CDC48_N pfam02359
Cell division protein 48 (CDC48), N-terminal domain. This domain has a double psi-beta barrel ...
40-121 2.68e-23

Cell division protein 48 (CDC48), N-terminal domain. This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the N-terminus. The VAT-N domain found in AAA ATPases pfam00004 is a substrate 185-residue recognition domain.


Pssm-ID: 376770  Cd Length: 84  Bit Score: 94.19  E-value: 2.68e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A         40 RLIVDEAINED--NSVVSLSQPKMDELQLFRGDTVLLKGKKRreAVCIVLSDDTC--SDEKIRMNRVVRNNLRVRLGDVI 115
Cdd:pfam02359   1 RLRVAEAPDRDvgRGIARLDPEDMEELGLFPGDVVEIKGKRK--TVAIVWSAYPEdeGPGIIRMDGVTRKNAGVSIGDTV 78

                  ....*.
7RLC_A        116 SIQPCP 121
Cdd:pfam02359  79 TVRPAE 84
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
525-664 3.19e-20

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 87.81  E-value: 3.19e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A         525 PSKGVLFYGPPGCGKTLLAKAIANECQAN---FISIKGPELL--------------TMWFGESEANVREIFDKARQAAPC 587
Cdd:smart00382   1 PGEVILIVGPPGSGKTTLARALARELGPPgggVIYIDGEDILeevldqllliivggKKASGSGELRLRLALALARKLKPD 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
7RLC_A         588 VLFFDELDSIAKARggnigdggGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPgRLDQLIYIPLPD 664
Cdd:smart00382  81 VLILDEITSLLDAE--------QEALLLLLEELRLLLLLKSEKNLTVILTTNDEKDLGPALLRR-RFDRRIVLLLIL 148
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
252-388 9.16e-20

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 86.66  E-value: 9.16e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A         252 PPRGILLYGPPGTGKTLIARAVANE---TGAFFFLINGPEIMS--------------KLAGESESNLRKAFEEAEKNAPA 314
Cdd:smart00382   1 PGEVILIVGPPGSGKTTLARALARElgpPGGGVIYIDGEDILEevldqllliivggkKASGSGELRLRLALALARKLKPD 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
7RLC_A         315 IIFIDELDAIAPKREKthgevERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFgRFDREVDIGIPD 388
Cdd:smart00382  81 VLILDEITSLLDAEQE-----ALLLLLEELRLLLLLKSEKNLTVILTTNDEKDLGPALLRR-RFDRRIVLLLIL 148
CDC48_N smart01073
Cell division protein 48 (CDC48) N-terminal domain; This domain has a double psi-beta barrel ...
41-120 1.28e-19

Cell division protein 48 (CDC48) N-terminal domain; This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the N-terminus. The VAT-N domain found in AAA ATPases is a substrate 185-residue recognition domain.


Pssm-ID: 215012 [Multi-domain]  Cd Length: 82  Bit Score: 83.81  E-value: 1.28e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A          41 LIVDEAINED---NSVVSLSQPKMDELQLFRGDTVLLKGKKRreAVCIVLSDDTC-SDEKIRMNRVVRNNLRVRLGDVIS 116
Cdd:smart01073   1 LRVAEAPSDEdvgRGIARLSPEDMDELGLFPGDYVLITGKRR--TVAIVWPAYPEdPGGIIRIDGVQRKNAGVSIGDTVT 78

                   ....
7RLC_A         117 IQPC 120
Cdd:smart01073  79 VRKA 82
ycf46 CHL00195
Ycf46; Provisional
219-426 6.73e-18

Ycf46; Provisional


Pssm-ID: 177094 [Multi-domain]  Cd Length: 489  Bit Score: 87.38  E-value: 6.73e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       219 DDIGGcrkqLAQIKEMveLPLRHPALFK---EIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAG 295
Cdd:CHL00195 228 SDIGG----LDNLKDW--LKKRSTSFSKqasNYGLPTPRGLLLVGIQGTGKSLTAKAIANDWQLPLLRLDVGKLFGGIVG 301
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       296 ESESNLRKAFEEAEKNAPAIIFIDELD-AIAPKREKTHGEVERRIVSQLLTLMDglKQRAHVIVMAATNRPNSIDPALRR 374
Cdd:CHL00195 302 ESESRMRQMIRIAEALSPCILWIDEIDkAFSNSESKGDSGTTNRVLATFITWLS--EKKSPVFVVATANNIDLLPLEILR 379
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
7RLC_A       375 FGRFDREVDIGIPDATGRLEILQIHTKNM--KLADDVDLEQVANETHGHVGADL 426
Cdd:CHL00195 380 KGRFDEIFFLDLPSLEEREKIFKIHLQKFrpKSWKKYDIKKLSKLSNKFSGAEI 433
CDC48_2 smart01072
Cell division protein 48 (CDC48) domain 2; This domain has a double psi-beta barrel fold and ...
146-206 4.11e-13

Cell division protein 48 (CDC48) domain 2; This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the C-terminus. The VAT-N domain found in AAA ATPases is a substrate 185-residue recognition domain.


Pssm-ID: 215011  Cd Length: 64  Bit Score: 64.54  E-value: 4.11e-13
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
7RLC_A         146 FEVYLKPYFLEayRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKR 206
Cdd:smart01072   6 FAEYVKRKLLG--RPVTKGDTIVVPFLGKALPFVVVSTEPSGPVIVTDDTEIEILEKPVEE 64
AAA_lid_3 pfam17862
AAA+ lid domain. This entry represents the alpha helical AAA+ lid domain that is found to the ...
408-449 1.58e-12

AAA+ lid domain. This entry represents the alpha helical AAA+ lid domain that is found to the C-terminus of AAA domains.


Pssm-ID: 380037  Cd Length: 45  Bit Score: 62.19  E-value: 1.58e-12
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
7RLC_A        408 DVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLED 449
Cdd:pfam17862   1 DVDLEELAERTEGFSGADLEALCREAALAALRRGLEAITQED 42
PRK13342 PRK13342
recombination factor protein RarA; Reviewed
256-320 5.58e-12

recombination factor protein RarA; Reviewed


Pssm-ID: 237355 [Multi-domain]  Cd Length: 413  Bit Score: 68.57  E-value: 5.58e-12
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
7RLC_A       256 ILLYGPPGTGKTLIARAVANETGAFFFLINGPeimskLAGESEsnLRKAFEEAEKNAPA----IIFIDE 320
Cdd:PRK13342  39 MILWGPPGTGKTTLARIIAGATDAPFEALSAV-----TSGVKD--LREVIEEARQRRSAgrrtILFIDE 100
CDC48_2 pfam02933
Cell division protein 48 (CDC48), domain 2. This domain has a double psi-beta barrel fold and ...
146-205 1.57e-10

Cell division protein 48 (CDC48), domain 2. This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the C-terminus. The VAT-N domain found in AAA ATPases pfam00004 is a substrate 185-residue recognition domain.


Pssm-ID: 376967  Cd Length: 63  Bit Score: 57.16  E-value: 1.57e-10
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        146 FEVYLKPYFLEayRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIK 205
Cdd:pfam02933   5 ELAYVKRNLEG--RPVSKGDTIVVEFLGQPIDLKVVSTEPSGPVVVTETTEIEIGEKPVQ 62
PRK13342 PRK13342
recombination factor protein RarA; Reviewed
517-593 1.63e-09

recombination factor protein RarA; Reviewed


Pssm-ID: 237355 [Multi-domain]  Cd Length: 413  Bit Score: 60.48  E-value: 1.63e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       517 KFLKFGMTPSkgVLFYGPPGCGKTLLAKAIANECQANFISIKGPElltmwfgESEANVREIFDKARQAA----PCVLFFD 592
Cdd:PRK13342  29 RMIEAGRLSS--MILWGPPGTGKTTLARIIAGATDAPFEALSAVT-------SGVKDLREVIEEARQRRsagrRTILFID 99

                 .
7RLC_A       593 E 593
Cdd:PRK13342 100 E 100
MoxR COG0714
MoxR-like ATPase [General function prediction only];
254-425 2.01e-09

MoxR-like ATPase [General function prediction only];


Pssm-ID: 223786 [Multi-domain]  Cd Length: 329  Bit Score: 59.76  E-value: 2.01e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      254 RGILLYGPPGTGKTLIARAVANETGAFFFLING-PEIM-SKLAGESESNLRKAFEEAEK--------NAPAIIFIDELDA 323
Cdd:COG0714  44 GHVLLEGPPGVGKTLLARALARALGLPFVRIQCtPDLLpSDLLGTYAYAALLLEPGEFRfvpgplfaAVRVILLLDEINR 123
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      324 IAPKREKT-HGEVERRIVSqlLTLMDGLKQRAHVIVMAATNRPNSID-----PALRRfgRFDREVDIGIPDA-------- 389
Cdd:COG0714 124 APPEVQNAlLEALEERQVT--VPGLTTIRLPPPFIVIATQNPGEYEGtyplpEALLD--RFLLRIYVDYPDSeeeeriil 199
                       170       180       190
                ....*....|....*....|....*....|....*...
7RLC_A      390 --TGRLEILQIHTKNMKLADDVDLEQVANETHGHVGAD 425
Cdd:COG0714 200 arVGGVDELDLESLVKPVLSDEELLRLQKEVKKVPVSD 237
RarA COG2256
Replication-associated recombination protein RarA (DNA-dependent ATPase) [Replication, ...
258-320 2.73e-09

Replication-associated recombination protein RarA (DNA-dependent ATPase) [Replication, recombination and repair];


Pssm-ID: 225165 [Multi-domain]  Cd Length: 436  Bit Score: 59.94  E-value: 2.73e-09
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
7RLC_A      258 LYGPPGTGKTLIARAVANETGAFFFLINGpeIMSKLAgesesNLRKAFEEAEKNAPA----IIFIDE 320
Cdd:COG2256  53 LWGPPGTGKTTLARLIAGTTNAAFEALSA--VTSGVK-----DLREIIEEARKNRLLgrrtILFLDE 112
T7SS_EccA TIGR03922
type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the ...
225-418 7.72e-09

type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc. [Protein fate, Protein and peptide secretion and trafficking]


Pssm-ID: 188437 [Multi-domain]  Cd Length: 557  Bit Score: 59.09  E-value: 7.72e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        225 RKQLAQIKEMVELPLRHpalfKEIGVKPP---RGILLYGPPGTGKTLIARAVANETgAFFFLINGPEIM----SKLAGES 297
Cdd:TIGR03922 285 KRQVAALKSSTAMALAR----AERGLPVAqtsNHMLFAGPPGTGKTTIARVVAKIY-CGLGVLRKPLVRevsrADLIGQY 359
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        298 ESNLRKAFEEA-EKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVM---AATNRPNSIDPALR 373
Cdd:TIGR03922 360 IGESEAKTNEIiDSALGGVLFLDEAYTLVETGYGQKDPFGLEAIDTLLARMENDRDRLVVIGAgyrKDLDKFLEVNEGLR 439
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
7RLC_A        374 RfgRFDREVDIgipDATGRLEILQIhTKNMKLADDVDLEQVANET 418
Cdd:TIGR03922 440 S--RFTRVIEF---PSYSPDELVEI-ARRMATERDSVLDDAAADA 478
AAA_lid_3 pfam17862
AAA+ lid domain. This entry represents the alpha helical AAA+ lid domain that is found to the ...
684-713 3.12e-08

AAA+ lid domain. This entry represents the alpha helical AAA+ lid domain that is found to the C-terminus of AAA domains.


Pssm-ID: 380037  Cd Length: 45  Bit Score: 50.25  E-value: 3.12e-08
                          10        20        30
                  ....*....|....*....|....*....|
7RLC_A        684 DVDLEFLAKMTNGFSGADLTEICQRACKLA 713
Cdd:pfam17862   1 DVDLEELAERTEGFSGADLEALCREAALAA 30
AAA_5 pfam07728
AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not ...
255-378 8.97e-08

AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 336785  Cd Length: 135  Bit Score: 51.51  E-value: 8.97e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        255 GILLYGPPGTGKTLIARAVANET-GAFFFLINGP------------EIMSKLAGESESNLRKAFEEAEknapaIIFIDEL 321
Cdd:pfam07728   1 GVLLVGPPGTGKSTLARRLAAALcNRPVFYVQLTrdtteedlfgrrDIANGTTEWVDGPLVRAAREGE-----IAVLDEI 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
7RLC_A        322 DAIAPK-REKTHGEVERRIvsqlLTLMDG----LKQRAHVIVMAATNRP----NSIDPALRRfgRF 378
Cdd:pfam07728  76 NRANPDvLNSLLSLLDERR----LLLPDGgelvKAPPNGFRLIATMNPLprglNELSPALRS--RF 135
DnaA COG0593
Chromosomal replication initiation ATPase DnaA [Replication, recombination and repair];
256-466 1.34e-07

Chromosomal replication initiation ATPase DnaA [Replication, recombination and repair];


Pssm-ID: 223666 [Multi-domain]  Cd Length: 408  Bit Score: 54.60  E-value: 1.34e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      256 ILLYGPPGTGKTLIARAVANEtgaffFLINGPEimSKLAGESESNLRKAFEEAEKNAPAIIF----------IDELDAIA 325
Cdd:COG0593 116 LFIYGGVGLGKTHLLQAIGNE-----ALANGPN--ARVVYLTSEDFTNDFVKALRDNEMEKFkekysldlllIDDIQFLA 188
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      326 PKREKthgevERRIVSQLLTLMDGLKQrahvIVMAATNRP---NSIDPALRRfgRFDR--EVDIGIPDATGRLEILQIH- 399
Cdd:COG0593 189 GKERT-----QEEFFHTFNALLENGKQ----IVLTSDRPPkelNGLEDRLRS--RLEWglVVEIEPPDDETRLAILRKKa 257
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
7RLC_A      400 -TKNMKLADDVdLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDD 466
Cdd:COG0593 258 eDRGIEIPDEV-LEFLAKRLDRNVRELEGALNRLDAFALFTKRAITIDLVKEILKDLLRAGEKITIED 324
44 PHA02544
clamp loader, small subunit; Provisional
231-395 2.65e-07

clamp loader, small subunit; Provisional


Pssm-ID: 222866 [Multi-domain]  Cd Length: 316  Bit Score: 53.07  E-value: 2.65e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       231 IKEMVeLPLRHPALFKEIgVKPPR--GILLYGP-PGTGKTLIARAVANETGAFFFLINGpeimSKLAGESESNLRKAFEE 307
Cdd:PHA02544  20 IDECI-LPAADKETFKSI-VKKGRipNMLLHSPsPGTGKTTVAKALCNEVGAEVLFVNG----SDCRIDFVRNRLTRFAS 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       308 A--EKNAPAIIFIDELDaiapkREKTHgEVERrivsQLLTLMDGLKQRAHVIVMAatNRPNSIDPALRrfGRFdREVDIG 385
Cdd:PHA02544  94 TvsLTGGGKVIIIDEFD-----RLGLA-DAQR----HLRSFMEAYSKNCSFIITA--NNKNGIIEPLR--SRC-RVIDFG 158
                        170
                 ....*....|
7RLC_A       386 IPDATGRLEI 395
Cdd:PHA02544 159 VPTKEEQIEM 168
RarA COG2256
Replication-associated recombination protein RarA (DNA-dependent ATPase) [Replication, ...
531-593 2.99e-07

Replication-associated recombination protein RarA (DNA-dependent ATPase) [Replication, recombination and repair];


Pssm-ID: 225165 [Multi-domain]  Cd Length: 436  Bit Score: 53.39  E-value: 2.99e-07
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
7RLC_A      531 FYGPPGCGKTLLAKAIANECQANFISIKGpelltMWFGESEanVREIFDKARQAAPC----VLFFDE 593
Cdd:COG2256  53 LWGPPGTGKTTLARLIAGTTNAAFEALSA-----VTSGVKD--LREIIEEARKNRLLgrrtILFLDE 112
PRK13341 PRK13341
AAA family ATPase;
257-320 3.18e-07

AAA family ATPase;


Pssm-ID: 237354 [Multi-domain]  Cd Length: 725  Bit Score: 53.91  E-value: 3.18e-07
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
7RLC_A       257 LLYGPPGTGKTLIARAVANETGAFFFLINgpeimSKLAGESEsnLRKAFEEAEK-----NAPAIIFIDE 320
Cdd:PRK13341  56 ILYGPPGVGKTTLARIIANHTRAHFSSLN-----AVLAGVKD--LRAEVDRAKErlerhGKRTILFIDE 117
RuvB_N pfam05496
Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC ...
529-562 9.13e-07

Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalyzed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.


Pssm-ID: 377518  Cd Length: 159  Bit Score: 49.42  E-value: 9.13e-07
                          10        20        30
                  ....*....|....*....|....*....|....
7RLC_A        529 VLFYGPPGCGKTLLAKAIANECQANFISIKGPEL 562
Cdd:pfam05496  36 VLLYGPPGLGKTTLANIIANEMGVNIRITSGPAI 69
T7SS_EccA TIGR03922
type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the ...
496-642 1.39e-06

type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc. [Protein fate, Protein and peptide secretion and trafficking]


Pssm-ID: 188437 [Multi-domain]  Cd Length: 557  Bit Score: 51.77  E-value: 1.39e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        496 GLEDVKRELqELVQYPVEHPDKFLKFGMT---PSKGVLFYGPPGCGKTLLAKAIANE-C------QANFISIKGPELLTM 565
Cdd:TIGR03922 280 GLERVKRQV-AALKSSTAMALARAERGLPvaqTSNHMLFAGPPGTGKTTIARVVAKIyCglgvlrKPLVREVSRADLIGQ 358
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
7RLC_A        566 WFGESEANVREIFDKARQAapcVLFFDELDSIAKARGGNIGDGGGAAdrvINQILTEMDGMSTKKNVFIIGATNRPD 642
Cdd:TIGR03922 359 YIGESEAKTNEIIDSALGG---VLFLDEAYTLVETGYGQKDPFGLEA---IDTLLARMENDRDRLVVIGAGYRKDLD 429
ruvB PRK00080
Holliday junction branch migration DNA helicase RuvB;
529-562 1.68e-06

Holliday junction branch migration DNA helicase RuvB;


Pssm-ID: 234619 [Multi-domain]  Cd Length: 328  Bit Score: 50.90  E-value: 1.68e-06
                         10        20        30
                 ....*....|....*....|....*....|....
7RLC_A       529 VLFYGPPGCGKTLLAKAIANECQANFISIKGPEL 562
Cdd:PRK00080  54 VLLYGPPGLGKTTLANIIANEMGVNIRITSGPAL 87
RuvB COG2255
Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit [Replication, ...
256-326 1.82e-06

Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit [Replication, recombination and repair];


Pssm-ID: 225164 [Multi-domain]  Cd Length: 332  Bit Score: 50.63  E-value: 1.82e-06
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
7RLC_A      256 ILLYGPPGTGKTLIARAVANETGAFFFLINGPEImsklagESESNLRKAFEEAEKNapAIIFIDELDAIAP 326
Cdd:COG2255  55 VLLFGPPGLGKTTLAHIIANELGVNLKITSGPAL------EKPGDLAAILTNLEEG--DVLFIDEIHRLSP 117
ruvB TIGR00635
Holliday junction DNA helicase, RuvB subunit; All proteins in this family for which functions ...
230-329 4.33e-06

Holliday junction DNA helicase, RuvB subunit; All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129721 [Multi-domain]  Cd Length: 305  Bit Score: 49.22  E-value: 4.33e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        230 QIKEMVELPLRHPALFKEigvkPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIM--SKLAGesesnLRKAFEE 307
Cdd:TIGR00635  11 KVKEQLQLFIEAAKMRQE----ALDHLLLYGPPGLGKTTLAHIIANEMGVNLKITSGPALEkpGDLAA-----ILTNLEE 81
                          90       100
                  ....*....|....*....|..
7RLC_A        308 AEknapaIIFIDELDAIAPKRE 329
Cdd:TIGR00635  82 GD-----VLFIDEIHRLSPAVE 98
RuvB COG2255
Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit [Replication, ...
529-562 4.40e-06

Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit [Replication, recombination and repair];


Pssm-ID: 225164 [Multi-domain]  Cd Length: 332  Bit Score: 49.48  E-value: 4.40e-06
                        10        20        30
                ....*....|....*....|....*....|....
7RLC_A      529 VLFYGPPGCGKTLLAKAIANECQANFISIKGPEL 562
Cdd:COG2255  55 VLLFGPPGLGKTTLAHIIANELGVNLKITSGPAL 88
PRK04195 PRK04195
replication factor C large subunit; Provisional
251-374 4.61e-06

replication factor C large subunit; Provisional


Pssm-ID: 235250 [Multi-domain]  Cd Length: 482  Bit Score: 49.92  E-value: 4.61e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       251 KPPRGILLYGPPGTGKTLIARAVANETGafFFLI--NGP-----EIMSKLAGESeSNLRKAFEEAEKnapaIIFIDELDA 323
Cdd:PRK04195  37 KPKKALLLYGPPGVGKTSLAHALANDYG--WEVIelNASdqrtaDVIERVAGEA-ATSGSLFGARRK----LILLDEVDG 109
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
7RLC_A       324 IapkrektHGEVERRIVSQLLTLmdgLKQRAHVIVMAATN---------------------RPNSIDPALRR 374
Cdd:PRK04195 110 I-------HGNEDRGGARAILEL---IKKAKQPIILTANDpydpslrelrnaclmiefkrlSTRSIVPVLKR 171
PRK04195 PRK04195
replication factor C large subunit; Provisional
490-549 6.08e-06

replication factor C large subunit; Provisional


Pssm-ID: 235250 [Multi-domain]  Cd Length: 482  Bit Score: 49.53  E-value: 6.08e-06
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       490 TWEDIGGLEDVKRELQELVqypvehpDKFLKfgMTPSKGVLFYGPPGCGKTLLAKAIANE 549
Cdd:PRK04195  12 TLSDVVGNEKAKEQLREWI-------ESWLK--GKPKKALLLYGPPGVGKTSLAHALAND 62
AAA_16 pfam13191
AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of ...
253-359 8.51e-06

AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.


Pssm-ID: 379062  Cd Length: 166  Bit Score: 46.75  E-value: 8.51e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        253 PRGILLYGPPGTGKTLIARAV---ANETGAFFFLINGPEIMSKLA---GESESNLRKAFEEAEKNAPAIIFIDELDAIAP 326
Cdd:pfam13191  23 PPLVLLTGEAGTGKTSLLRELlraLEEDGVYVLRGKCDECLRPSAlleALTREGLLRQLLDELESSLLEAWRDRLLEELA 102
                          90       100       110
                  ....*....|....*....|....*....|...
7RLC_A        327 KREKTHGEVERRIVSQLLTLMDGLKQRAHVIVM 359
Cdd:pfam13191 103 PVPELAGDLAERLLDLLLRLLDLLARDERPLVL 135
TIP49 COG1224
DNA helicase TIP49, TBP-interacting protein [Transcription];
254-304 1.57e-05

DNA helicase TIP49, TBP-interacting protein [Transcription];


Pssm-ID: 224145 [Multi-domain]  Cd Length: 450  Bit Score: 48.12  E-value: 1.57e-05
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
7RLC_A      254 RGILLYGPPGTGKTLIARAVANETGA--FFFLINGPEIMSKLAGESES---NLRKA 304
Cdd:COG1224  66 RGILIVGPPGTGKTALAMGIARELGEdvPFVAISGSEIYSLEVKKTEAltqALRRA 121
ruvB PRK00080
Holliday junction branch migration DNA helicase RuvB;
256-326 1.98e-05

Holliday junction branch migration DNA helicase RuvB;


Pssm-ID: 234619 [Multi-domain]  Cd Length: 328  Bit Score: 47.43  E-value: 1.98e-05
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
7RLC_A       256 ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSK--LAGeSESNLrkafEEAEknapaIIFIDELDAIAP 326
Cdd:PRK00080  54 VLLYGPPGLGKTTLANIIANEMGVNIRITSGPALEKPgdLAA-ILTNL----EEGD-----VLFIDEIHRLSP 116
ruvB TIGR00635
Holliday junction DNA helicase, RuvB subunit; All proteins in this family for which functions ...
490-562 2.09e-05

Holliday junction DNA helicase, RuvB subunit; All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129721 [Multi-domain]  Cd Length: 305  Bit Score: 47.29  E-value: 2.09e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
7RLC_A        490 TWEDIGGLEDVKRELQ------ELVQYPVEHpdkflkfgmtpskgVLFYGPPGCGKTLLAKAIANECQANFISIKGPEL 562
Cdd:TIGR00635   2 LLAEFIGQEKVKEQLQlfieaaKMRQEALDH--------------LLLYGPPGLGKTTLAHIIANEMGVNLKITSGPAL 66
TIP49 pfam06068
TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and ...
254-304 2.33e-05

TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear factors and have DNA helicase activities.TIP49a has been suggested to act as an autoantigen in some patients with autoimmune diseases.


Pssm-ID: 368730  Cd Length: 347  Bit Score: 47.30  E-value: 2.33e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
7RLC_A        254 RGILLYGPPGTGKTLIARAVANETGAF--FFLINGPEIMSKLAGESES---NLRKA 304
Cdd:pfam06068  51 RAVLIAGPPGTGKTALAIAISKELGEDtpFTSISGSEVYSLEMKKTEAltqAFRKA 106
ClpA COG0542
ATP-dependent Clp protease ATP-binding subunit ClpA [Posttranslational modification, protein ...
257-561 3.77e-05

ATP-dependent Clp protease ATP-binding subunit ClpA [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223616 [Multi-domain]  Cd Length: 786  Bit Score: 47.27  E-value: 3.77e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      257 LLYGPPGTGKTLIARAVANEtgafffLING--PEIMS----------------KLAGESESNLRKAFEEAEKNAPAIIFI 318
Cdd:COG0542 195 VLVGEPGVGKTAIVEGLAQR------IVNGdvPESLKdkriysldlgslvagaKYRGEFEERLKAVLKEVEKSKNVILFI 268
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      319 DELDAI--ApkrEKTHGEVerrivsqlltlMDG---LKQ---RAHVIVMAATN----RPN-SIDPAL-RRFgrfdREVDI 384
Cdd:COG0542 269 DEIHTIvgA---GATEGGA-----------MDAanlLKPalaRGELRCIGATTldeyRKYiEKDAALeRRF----QKVLV 330
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      385 GIPDATGRLEILQ-IHTK-----NMKLADDVdLEQVANETHGHVGA----DLA-----ALCSEAALQaIRKKMDLIDLED 449
Cdd:COG0542 331 DEPSVEDTIAILRgLKERyeahhGVRITDEA-LVAAVTLSDRYIPDrflpDKAidlldEAGARVRLE-IDKPEELDELER 408
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      450 ETIDAEVMNSLAVTMDDFR--------WALSQSNPSALRETVVEvpQVTWEDIGG--------------------LEDVK 501
Cdd:COG0542 409 ELAQLEIEKEALEREQDEKekklideiIKLKEGRIPELEKELEA--EVDEDDIAEvvarwtgipvaklledekekLLNLE 486
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
7RLC_A      502 RELQELV--Q----YPVEHPDKFLKFGMT-PSKGV---LFYGPPGCGKTLLAKAIA---NECQANFISIKGPE 561
Cdd:COG0542 487 RRLKKRVigQdeavEAVSDAIRRARAGLGdPNRPIgsfLFLGPTGVGKTELAKALAealFGDEQALIRIDMSE 559
CDC6 COG1474
Cdc6-related protein, AAA superfamily ATPase [Replication, recombination and repair];
253-504 5.34e-05

Cdc6-related protein, AAA superfamily ATPase [Replication, recombination and repair];


Pssm-ID: 224391 [Multi-domain]  Cd Length: 366  Bit Score: 46.19  E-value: 5.34e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      253 PRGILLYGPPGTGKTLIARAVANE-----TGAFFFLING----------PEIMSKLAGESESNLR-----KAFEEA--EK 310
Cdd:COG1474  42 PSNIIIYGPTGTGKTATVKFVMEEleessANVEVVYINClelrtpyqvlSKILNKLGKVPLTGDSsleilKRLYDNlsKK 121
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      311 NAPAIIFIDELDAIAPKREKthgeverrIVSQLLTLMDGLKQRAHVIVMAAT-NRPNSIDPALR-RFGRFD---REVDIG 385
Cdd:COG1474 122 GKTVIVILDEVDALVDKDGE--------VLYSLLRAPGENKVKVSIIAVSNDdKFLDYLDPRVKsSLGPSEivfPPYTAE 193
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      386 ipdatgrlEILQIHTK--NMKLADDVDLEQV-------ANETHGHVGADLaALCSEAALQAIRKKMDLIDlEDETIDAEV 456
Cdd:COG1474 194 --------ELYDILRErvEEGFSAGVIDDDVlkliaalVAAESGDARKAI-DILRRAGEIAEREGSRKVS-EDHVREAQE 263
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
7RLC_A      457 MNSLAVTMDDFRwALSQSNPSALRETVVevpQVTWEDIGGLEDVKREL 504
Cdd:COG1474 264 EIERDVLEEVLK-TLPLHQKIVLLAIVE---LTVEISTGELYDVYESL 307
MoxR COG0714
MoxR-like ATPase [General function prediction only];
529-704 5.93e-05

MoxR-like ATPase [General function prediction only];


Pssm-ID: 223786 [Multi-domain]  Cd Length: 329  Bit Score: 45.89  E-value: 5.93e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      529 VLFYGPPGCGKTLLAKAIANECQANFISIKG-PELL-TMWFGESEANVREIFDKAR--------QAAPCVLFFDELDsia 598
Cdd:COG0714  46 VLLEGPPGVGKTLLARALARALGLPFVRIQCtPDLLpSDLLGTYAYAALLLEPGEFrfvpgplfAAVRVILLLDEIN--- 122
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A      599 karggnigdggGAADRVINQILTEMD-------GMSTKK---NVFIIGATNRPDIID-----PAILRpgRLDQLIYIPLP 663
Cdd:COG0714 123 -----------RAPPEVQNALLEALEerqvtvpGLTTIRlppPFIVIATQNPGEYEGtyplpEALLD--RFLLRIYVDYP 189
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
7RLC_A      664 DEK-------SRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTE 704
Cdd:COG0714 190 DSEeeeriilARVGGVDELDLESLVKPVLSDEELLRLQKEVKKVPVSD 237
DnaC COG1484
DNA replication protein DnaC [Replication, recombination and repair];
253-321 6.55e-05

DNA replication protein DnaC [Replication, recombination and repair];


Pssm-ID: 224401 [Multi-domain]  Cd Length: 254  Bit Score: 45.09  E-value: 6.55e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
7RLC_A      253 PRGILLYGPPGTGKTLIARAVANE---TGAFFFLINGPEIMSKLA-----GESESNLRKAFEEAEknapaIIFIDEL 321
Cdd:COG1484 105 GENLVLLGPPGVGKTHLAIAIGNEllkAGISVLFITAPDLLSKLKaafdeGRLEEKLLRELKKVD-----LLIIDDI 176
Vps4_C pfam09336
Vps4 C terminal oligomerization domain. This domain is found at the C terminal of ATPase ...
733-775 7.93e-05

Vps4 C terminal oligomerization domain. This domain is found at the C terminal of ATPase proteins involved in vacuolar sorting. It forms an alpha helix structure and is required for oligomerization.


Pssm-ID: 370443  Cd Length: 61  Bit Score: 40.94  E-value: 7.93e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
7RLC_A        733 SAMEVEEDD-PVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQ 775
Cdd:pfam09336  15 TWMDIPSDKlLEPPVTMKDFLKALKNSRPTVSKEDLEKHEEFTK 58
RuvB_N pfam05496
Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC ...
256-320 8.87e-05

Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalyzed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.


Pssm-ID: 377518  Cd Length: 159  Bit Score: 43.64  E-value: 8.87e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
7RLC_A        256 ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSK--LAGesesnLRKAFEEAEknapaIIFIDE 320
Cdd:pfam05496  36 VLLYGPPGLGKTTLANIIANEMGVNIRITSGPAIERAgdLAA-----ILTNLEPGD-----VLFIDE 92
PRK13341 PRK13341
AAA family ATPase;
530-557 1.37e-04

AAA family ATPase;


Pssm-ID: 237354 [Multi-domain]  Cd Length: 725  Bit Score: 45.43  E-value: 1.37e-04
                         10        20
                 ....*....|....*....|....*...
7RLC_A       530 LFYGPPGCGKTLLAKAIANECQANFISI 557
Cdd:PRK13341  56 ILYGPPGVGKTTLARIIANHTRAHFSSL 83
AAA_2 pfam07724
AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected ...
529-599 1.43e-04

AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 369486  Cd Length: 168  Bit Score: 42.95  E-value: 1.43e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        529 VLFYGPPGCGKTLLAKAIANE---CQANFISIKGPELL-----TMWFGESEANVR-----EIFDKARQAAPCVLFFDELD 595
Cdd:pfam07724   6 FLFLGPTGVGKTELAKALAELlfgDERALIRIDMSEYMeehsvSRLIGAPPGYVGyeeggQLTEAVRRKPYSIVLIDEIE 85

                  ....
7RLC_A        596 SIAK 599
Cdd:pfam07724  86 KAHP 89
DnaC COG1484
DNA replication protein DnaC [Replication, recombination and repair];
527-594 1.48e-04

DNA replication protein DnaC [Replication, recombination and repair];


Pssm-ID: 224401 [Multi-domain]  Cd Length: 254  Bit Score: 44.32  E-value: 1.48e-04
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
7RLC_A      527 KGVLFYGPPGCGKTLLAKAIANECQANFIS---IKGPELLTMW-FGESEANVREIFDKARQAAPcVLFFDEL 594
Cdd:COG1484 106 ENLVLLGPPGVGKTHLAIAIGNELLKAGISvlfITAPDLLSKLkAAFDEGRLEEKLLRELKKVD-LLIIDDI 176
TIGR02928 TIGR02928
orc1/cdc6 family replication initiation protein; Members of this protein family are found ...
230-276 2.93e-04

orc1/cdc6 family replication initiation protein; Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 274354 [Multi-domain]  Cd Length: 365  Bit Score: 43.78  E-value: 2.93e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
7RLC_A        230 QIKEMVELpLRhPALFkeiGVKPPRgILLYGPPGTGKTLIARAVANE 276
Cdd:TIGR02928  23 QIEELAKA-LR-PILR---GSRPSN-VFIYGKTGTGKTAVTKYVMKE 63
AAA_2 pfam07724
AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected ...
256-381 3.15e-04

AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 369486  Cd Length: 168  Bit Score: 42.18  E-value: 3.15e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        256 ILLYGPPGTGKTLIARAVANETGAF---FFLINGPEIM-----SKLAGESESNLRKA-----FEEAEKNAPAIIFIDELd 322
Cdd:pfam07724   6 FLFLGPTGVGKTELAKALAELLFGDeraLIRIDMSEYMeehsvSRLIGAPPGYVGYEeggqlTEAVRRKPYSIVLIDEI- 84
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
7RLC_A        323 aiapkrEKTHGEVErRIVSQLL---TLMDGLKQRA---HVIVMAATNRpNSIDPALRRFGRFDRE 381
Cdd:pfam07724  85 ------EKAHPGVQ-NDLLQILeggTLTDKQGRTVdfkNTLFIMTGNF-GSEKISDASRIGFSPD 141
PRK08116 PRK08116
hypothetical protein; Validated
245-323 3.65e-04

hypothetical protein; Validated


Pssm-ID: 236153 [Multi-domain]  Cd Length: 268  Bit Score: 43.09  E-value: 3.65e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A       245 FKEIGvKPPRGILLYGPPGTGKTLIARAVAN---ETGAFFFLINGPEIMSKLAgeSESNLRKAFEEAE-----KNAPAII 316
Cdd:PRK08116 107 FEEMK-KENVGLLLWGSVGTGKTYLAACIANeliEKGVPVIFVNFPQLLNRIK--STYKSSGKEDENEiirslVNADLLI 183

                 ....*..
7RLC_A       317 fIDELDA 323
Cdd:PRK08116 184 -LDDLGA 189
PRK08116 PRK08116
hypothetical protein; Validated
526-549 6.25e-04

hypothetical protein; Validated


Pssm-ID: 236153 [Multi-domain]  Cd Length: 268  Bit Score: 42.32  E-value: 6.25e-04
                         10        20
                 ....*....|....*....|....
7RLC_A       526 SKGVLFYGPPGCGKTLLAKAIANE 549
Cdd:PRK08116 114 NVGLLLWGSVGTGKTYLAACIANE 137
clpX TIGR00382
endopeptidase Clp ATP-binding regulatory subunit (clpX); A member of the ATP-dependent ...
256-329 6.64e-04

endopeptidase Clp ATP-binding regulatory subunit (clpX); A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 273047 [Multi-domain]  Cd Length: 413  Bit Score: 42.83  E-value: 6.64e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        256 ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIM-SKLAGESESN-----LRKAFEEAEKNAPAIIFIDELDAIAPKRE 329
Cdd:TIGR00382 119 ILLIGPTGSGKTLLAQTLARILNVPFAIADATTLTeAGYVGEDVENillklLQAADYDVEKAQKGIIYIDEIDKISRKSE 198
TIP49 COG1224
DNA helicase TIP49, TBP-interacting protein [Transcription];
517-572 1.14e-03

DNA helicase TIP49, TBP-interacting protein [Transcription];


Pssm-ID: 224145 [Multi-domain]  Cd Length: 450  Bit Score: 41.95  E-value: 1.14e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*...
7RLC_A      517 KFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQAN--FISIKGPELLTMWFGESEA 572
Cdd:COG1224  56 KMIKQGKMAGRGILIVGPPGTGKTALAMGIARELGEDvpFVAISGSEIYSLEVKKTEA 113
ycf2 CHL00206
Ycf2; Provisional
519-660 1.34e-03

Ycf2; Provisional


Pssm-ID: 214396 [Multi-domain]  Cd Length: 2281  Bit Score: 42.59  E-value: 1.34e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        519 LKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISI----------KG-------------------------PELL 563
Cdd:CHL00206 1623 LRLALSPSRGILVIGSIGTGRSYLVKYLATNSYVPFITVflnkfldnkpKGfliddididdsddiddsddidrdldTELL 1702
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        564 TMWFG--------ESEANVREIFDKARQAAPCVLFFDELDSIakargGNIGDGGGAADRVINQILTEMDGMSTKKNVfII 635
Cdd:CHL00206 1703 TMMNAltmdmmpkIDRFYITLQFELAKAMSPCIIWIPNIHDL-----NVNESNYLSLGLLVNSLSRDCERCSTRNIL-VI 1776
                         170       180
                  ....*....|....*....|....*
7RLC_A        636 GATNRPDIIDPAILRPGRLDQLIYI 660
Cdd:CHL00206 1777 ASTHIPQKVDPALIAPNKLNTCIKI 1801
spore_V_K TIGR02881
stage V sporulation protein K; Members of this protein family are the stage V sporulation ...
496-599 1.40e-03

stage V sporulation protein K; Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination]


Pssm-ID: 163057 [Multi-domain]  Cd Length: 261  Bit Score: 41.25  E-value: 1.40e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        496 GLEDVKRELQELVQYPVEHpDKFLKFGMTPSKGVL---FYGPPGCGKTLLAKAIAN-------ECQANFISIKGPELLTM 565
Cdd:TIGR02881  10 GLDEVKALIKEIYAWIQIN-EKRKEEGLKTSKQVLhmiFKGNPGTGKTTVARILGKlfkemnvLSKGHLIEVERADLVGE 88
                          90       100       110
                  ....*....|....*....|....*....|....
7RLC_A        566 WFGESEANVREIFDKARQAapcVLFFDELDSIAK 599
Cdd:TIGR02881  89 YIGHTAQKTREVIKKALGG---VLFIDEAYSLAR 119
RNA_helicase pfam00910
RNA helicase. This family includes RNA helicases thought to be involved in duplex unwinding ...
529-549 1.42e-03

RNA helicase. This family includes RNA helicases thought to be involved in duplex unwinding during viral RNA replication. Members of this family are found in a variety of single stranded RNA viruses.


Pssm-ID: 366365  Cd Length: 101  Bit Score: 38.73  E-value: 1.42e-03
                          10        20
                  ....*....|....*....|.
7RLC_A        529 VLFYGPPGCGKTLLAKAIANE 549
Cdd:pfam00910   1 IWLYGPPGCGKSTLAKYLARA 21
AAA_22 pfam13401
AAA domain;
256-327 1.98e-03

AAA domain;


Pssm-ID: 379165 [Multi-domain]  Cd Length: 129  Bit Score: 38.86  E-value: 1.98e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
7RLC_A        256 ILLYGPPGTGKTLIARAVAN---ETGAFFFLINGP------EIMSKLAGE---------SESNLRKAFEEA--EKNAPAI 315
Cdd:pfam13401   8 LVLTGESGTGKTTLLRRLLEqlpEVRDSVVFVDLPsgtspkDLLRALLRAlglplsgrlSKEELLAALQQLllALAVAVV 87
                          90
                  ....*....|..
7RLC_A        316 IFIDELDAIAPK 327
Cdd:pfam13401  88 LIIDEAQHLSLE 99
PRK06835 PRK06835
DNA replication protein DnaC; Validated
524-549 2.56e-03

DNA replication protein DnaC; Validated


Pssm-ID: 235871 [Multi-domain]  Cd Length: 329  Bit Score: 40.65  E-value: 2.56e-03
                         10        20
                 ....*....|....*....|....*.
7RLC_A       524 TPSKGVLFYGPPGCGKTLLAKAIANE 549
Cdd:PRK06835 181 KNNENLLFYGNTGTGKTFLSNCIAKE 206
Parvo_NS1 pfam01057
Parvovirus non-structural protein NS1; This family also contains the NS2 protein. Parvoviruses ...
529-548 4.05e-03

Parvovirus non-structural protein NS1; This family also contains the NS2 protein. Parvoviruses encode two non-structural proteins, NS1 and NS2. The mRNA for NS2 contains the coding sequence for the first 87 amino acids of NS1, then by an alternative splicing mechanism mRNA from a different reading frame, encoding the last 78 amino acids, makes up the full length of the NS2 mRNA. NS1, is the major non-structural protein. It is essential for DNA replication. It is an 83-kDa nuclear phosphoprotein. It has DNA helicase and ATPase activity.


Pssm-ID: 366441  Cd Length: 271  Bit Score: 39.98  E-value: 4.05e-03
                          10        20
                  ....*....|....*....|
7RLC_A        529 VLFYGPPGCGKTLLAKAIAN 548
Cdd:pfam01057 116 VWFYGPASTGKTNLAQAIAH 135
Mg_chelatase pfam01078
Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that ...
529-546 4.07e-03

Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that catalyzes the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.


Pssm-ID: 307292  Cd Length: 207  Bit Score: 39.44  E-value: 4.07e-03
                          10
                  ....*....|....*...
7RLC_A        529 VLFYGPPGCGKTLLAKAI 546
Cdd:pfam01078  25 LLMIGPPGSGKTMLAKRL 42
TIP49 pfam06068
TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and ...
527-572 9.37e-03

TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear factors and have DNA helicase activities.TIP49a has been suggested to act as an autoantigen in some patients with autoimmune diseases.


Pssm-ID: 368730  Cd Length: 347  Bit Score: 38.83  E-value: 9.37e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
7RLC_A        527 KGVLFYGPPGCGKTLLAKAIANECQAN--FISIKGPELLTMWFGESEA 572
Cdd:pfam06068  51 RAVLIAGPPGTGKTALAIAISKELGEDtpFTSISGSEVYSLEMKKTEA 98
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH