NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|9988768|gb|AAG10783|]
View 

DNA polymerase, partial [Caprine lymphotropic herpesvirus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DNA_pol_B super family cl29029
DNA polymerase family B; This region of DNA polymerase B appears to consist of more than one ...
1-40 1.09e-11

DNA polymerase family B; This region of DNA polymerase B appears to consist of more than one structural domain, possibly including elongation, DNA-binding and dNTP binding activities.


The actual alignment was detected with superfamily member pfam00136:

Pssm-ID: 395085  Cd Length: 439  Bit Score: 57.24  E-value: 1.09e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 9988768      1 ASGLLPCLKIAETVTLQGRTMLERTKHYVESLQLADLERI 40
Cdd:pfam00136 172 ANGRLPCLPIAASVTAIGREMLENTKDLVEGMYTYNFRVI 211
 
Name Accession Description Interval E-value
DNA_pol_B pfam00136
DNA polymerase family B; This region of DNA polymerase B appears to consist of more than one ...
1-40 1.09e-11

DNA polymerase family B; This region of DNA polymerase B appears to consist of more than one structural domain, possibly including elongation, DNA-binding and dNTP binding activities.


Pssm-ID: 395085  Cd Length: 439  Bit Score: 57.24  E-value: 1.09e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 9988768      1 ASGLLPCLKIAETVTLQGRTMLERTKHYVESLQLADLERI 40
Cdd:pfam00136 172 ANGRLPCLPIAASVTAIGREMLENTKDLVEGMYTYNFRVI 211
POLBc_delta cd05533
DNA polymerase type-B delta subfamily catalytic domain. Three DNA-dependent DNA polymerases ...
2-31 2.22e-07

DNA polymerase type-B delta subfamily catalytic domain. Three DNA-dependent DNA polymerases type B (alpha, delta, and epsilon) have been identified as essential for nuclear DNA replication in eukaryotes. Presently, no direct data is available regarding the strand specificity of DNA polymerase during DNA replication in vivo. However, mutation analysis supports the hypothesis that DNA polymerase delta is the enzyme responsible for both elongation and maturation of Okazaki fragments on the lagging strand.


Pssm-ID: 99916  Cd Length: 393  Bit Score: 44.95  E-value: 2.22e-07
                        10        20        30
                ....*....|....*....|....*....|
gi 9988768    2 SGLLPCLKIAETVTLQGRTMLERTKHYVES 31
Cdd:cd05533 128 VGKLPCLEISSSVTSFGRQMIEKTKKLVEE 157
PTZ00166 PTZ00166
DNA polymerase delta catalytic subunit; Provisional
1-32 7.51e-07

DNA polymerase delta catalytic subunit; Provisional


Pssm-ID: 240301 [Multi-domain]  Cd Length: 1054  Bit Score: 43.48  E-value: 7.51e-07
                          10        20        30
                  ....*....|....*....|....*....|..
gi 9988768      1 ASGLLPCLKIAETVTLQGRTMLERTKHYVESL 32
Cdd:PTZ00166  665 VGGQLPCLEVSTSITSFGRQMIDKTKELVEKH 696
POLBc smart00486
DNA polymerase type-B family; DNA polymerase alpha, delta, epsilon and zeta chain (eukaryota), ...
2-32 2.68e-06

DNA polymerase type-B family; DNA polymerase alpha, delta, epsilon and zeta chain (eukaryota), DNA polymerases in archaea, DNA polymerase II in e. coli, mitochondrial DNA polymerases and and virus DNA polymerases


Pssm-ID: 214691 [Multi-domain]  Cd Length: 474  Bit Score: 41.75  E-value: 2.68e-06
                           10        20        30
                   ....*....|....*....|....*....|.
gi 9988768       2 SGLLPCLKIAETVTLQGRTMLERTKHYVESL 32
Cdd:smart00486 421 NSRLPCKPLAASVTALGREILEKTKELIEEN 451
PolB COG0417
DNA polymerase elongation subunit (family B) [Replication, recombination and repair];
1-32 2.77e-03

DNA polymerase elongation subunit (family B) [Replication, recombination and repair];


Pssm-ID: 223494 [Multi-domain]  Cd Length: 792  Bit Score: 33.55  E-value: 2.77e-03
                        10        20        30
                ....*....|....*....|....*....|..
gi 9988768    1 ASGLLPCLKIAETVTLQGRTMLERTKHYVESL 32
Cdd:COG0417 522 SNSRFYCIECAESVTAFGREILRETKELAEEM 553
 
Name Accession Description Interval E-value
DNA_pol_B pfam00136
DNA polymerase family B; This region of DNA polymerase B appears to consist of more than one ...
1-40 1.09e-11

DNA polymerase family B; This region of DNA polymerase B appears to consist of more than one structural domain, possibly including elongation, DNA-binding and dNTP binding activities.


Pssm-ID: 395085  Cd Length: 439  Bit Score: 57.24  E-value: 1.09e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 9988768      1 ASGLLPCLKIAETVTLQGRTMLERTKHYVESLQLADLERI 40
Cdd:pfam00136 172 ANGRLPCLPIAASVTAIGREMLENTKDLVEGMYTYNFRVI 211
POLBc_delta cd05533
DNA polymerase type-B delta subfamily catalytic domain. Three DNA-dependent DNA polymerases ...
2-31 2.22e-07

DNA polymerase type-B delta subfamily catalytic domain. Three DNA-dependent DNA polymerases type B (alpha, delta, and epsilon) have been identified as essential for nuclear DNA replication in eukaryotes. Presently, no direct data is available regarding the strand specificity of DNA polymerase during DNA replication in vivo. However, mutation analysis supports the hypothesis that DNA polymerase delta is the enzyme responsible for both elongation and maturation of Okazaki fragments on the lagging strand.


Pssm-ID: 99916  Cd Length: 393  Bit Score: 44.95  E-value: 2.22e-07
                        10        20        30
                ....*....|....*....|....*....|
gi 9988768    2 SGLLPCLKIAETVTLQGRTMLERTKHYVES 31
Cdd:cd05533 128 VGKLPCLEISSSVTSFGRQMIEKTKKLVEE 157
PTZ00166 PTZ00166
DNA polymerase delta catalytic subunit; Provisional
1-32 7.51e-07

DNA polymerase delta catalytic subunit; Provisional


Pssm-ID: 240301 [Multi-domain]  Cd Length: 1054  Bit Score: 43.48  E-value: 7.51e-07
                          10        20        30
                  ....*....|....*....|....*....|..
gi 9988768      1 ASGLLPCLKIAETVTLQGRTMLERTKHYVESL 32
Cdd:PTZ00166  665 VGGQLPCLEVSTSITSFGRQMIDKTKELVEKH 696
POLBc smart00486
DNA polymerase type-B family; DNA polymerase alpha, delta, epsilon and zeta chain (eukaryota), ...
2-32 2.68e-06

DNA polymerase type-B family; DNA polymerase alpha, delta, epsilon and zeta chain (eukaryota), DNA polymerases in archaea, DNA polymerase II in e. coli, mitochondrial DNA polymerases and and virus DNA polymerases


Pssm-ID: 214691 [Multi-domain]  Cd Length: 474  Bit Score: 41.75  E-value: 2.68e-06
                           10        20        30
                   ....*....|....*....|....*....|.
gi 9988768       2 SGLLPCLKIAETVTLQGRTMLERTKHYVESL 32
Cdd:smart00486 421 NSRLPCKPLAASVTALGREILEKTKELIEEN 451
PolB COG0417
DNA polymerase elongation subunit (family B) [Replication, recombination and repair];
1-32 2.77e-03

DNA polymerase elongation subunit (family B) [Replication, recombination and repair];


Pssm-ID: 223494 [Multi-domain]  Cd Length: 792  Bit Score: 33.55  E-value: 2.77e-03
                        10        20        30
                ....*....|....*....|....*....|..
gi 9988768    1 ASGLLPCLKIAETVTLQGRTMLERTKHYVESL 32
Cdd:COG0417 522 SNSRFYCIECAESVTAFGREILRETKELAEEM 553
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH