NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|60360330|dbj|BAD90409|]
View 

mKIAA0519 protein, partial [Mus musculus]

Protein Classification

Exostosin and Glyco_transf_64 domain-containing protein (domain architecture ID 13381400)

Exostosin and Glyco_transf_64 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Glyco_transf_64 pfam09258
Glycosyl transferase family 64 domain; Members of this family catalyze the transfer reaction ...
665-902 1.21e-136

Glycosyl transferase family 64 domain; Members of this family catalyze the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.


:

Pssm-ID: 401264  Cd Length: 240  Bit Score: 407.44  E-value: 1.21e-136
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   665 FTVVMLTYE-REEVLMNSLERLNGLPYLNKVVVVWNSPKLPSEDLLWPDIGVPIMVVRTEKNSLNNRFLPWNEIETEAIL 743
Cdd:pfam09258   1 FTAVIHTYYsRIDLLLKLLQRYAASPHLAKIVVLWNNPKPPPELSRWPSTGVPVTVIRQKSNSLNNRFLPYPEIETDAVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   744 SIDDDAHLRHDEIMFGFRVWREARDRIVGFPGRYHAWDIPHQSWLYNSNYSCELSMVLTGAAFFHKYYAYLYSYVMPQAI 823
Cdd:pfam09258  81 SLDDDILLSTDEIDFAFRVWRSFPDRIVGFPPRSHFWDLSSGRWGYTSEWTNEYSMVLTGAAFYHRYYLYLYTHSLPAAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   824 RDMVDEYINCEDIAMNFLVSHITRKPPIKVTSRWTFRCPGCP-QALSHDDSHFHERHKCINFFVKVYGYMPLLYTQFRVD 902
Cdd:pfam09258 161 RTLVDETRNCEDILMNFLVANVTRKPPVKVTSRKQFKEPRNGkVGLSSDPGHFEQRSKCINKFARVFGYMPLVYSQGRVD 240
Exostosin pfam03016
Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on ...
192-502 1.17e-45

Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear.


:

Pssm-ID: 397245  Cd Length: 290  Bit Score: 166.06  E-value: 1.17e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   192 LTSGFPVYVYD-----------------SDQFAFGSYLDPLVKQAFQatvranVYVTENAAIACLYVVLVGEMQEPTVLR 254
Cdd:pfam03016   1 SCKGLKVYVYDlpprfnedllqpcrsltGWYSAEQFLLESILHSRIE------CRTSDPDEADCFFVPFYASLDASRHLL 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   255 PAD--------LEKQLFSLPHW-RTDGHNHVIINLSRKSDTQNLLYNVSTGRAMVA--QSTFYAAQYRAGFDLVVsPLVH 323
Cdd:pfam03016  75 NSAltdlfrelLDWLKSQYPYWnRSGGRDHFIVSGHPAWSFRRTAPDVDWGRAMLLnlTVLFSEDQFRPGKDVAL-PYPT 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   324 AMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEarSFEEEMEGDPPADYDDRIIATlkavqdskldqvlveftck 403
Cdd:pfam03016 154 PFHPDIGQWQDISPSNRRKTLLFFAGNRRRGYSGKIRP--LLLEECKGNPDADICGGLQCT------------------- 212
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   404 nqpkpslptewalcGEREDRLELLKLSTFALiITPGDPrlliSSGCatRLFEALEVGAVPVVLGEQVQLPYHDMLQWNEA 483
Cdd:pfam03016 213 --------------PGRDKYMELLRSSRFCL-QPPGDT----PTSP--RLFDALLAGCIPVIISDGWELPFADVIDWRKF 271
                         330
                  ....*....|....*....
gi 60360330   484 ALVVPKPRVTEVHFLLRSL 502
Cdd:pfam03016 272 SVFVPENDIPELKSILRSL 290
Smc super family cl34174
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
88-147 1.26e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


The actual alignment was detected with superfamily member COG1196:

Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 45.86  E-value: 1.26e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   88 RESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKEL 147
Cdd:COG1196  823 RERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKEL 882
 
Name Accession Description Interval E-value
Glyco_transf_64 pfam09258
Glycosyl transferase family 64 domain; Members of this family catalyze the transfer reaction ...
665-902 1.21e-136

Glycosyl transferase family 64 domain; Members of this family catalyze the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.


Pssm-ID: 401264  Cd Length: 240  Bit Score: 407.44  E-value: 1.21e-136
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   665 FTVVMLTYE-REEVLMNSLERLNGLPYLNKVVVVWNSPKLPSEDLLWPDIGVPIMVVRTEKNSLNNRFLPWNEIETEAIL 743
Cdd:pfam09258   1 FTAVIHTYYsRIDLLLKLLQRYAASPHLAKIVVLWNNPKPPPELSRWPSTGVPVTVIRQKSNSLNNRFLPYPEIETDAVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   744 SIDDDAHLRHDEIMFGFRVWREARDRIVGFPGRYHAWDIPHQSWLYNSNYSCELSMVLTGAAFFHKYYAYLYSYVMPQAI 823
Cdd:pfam09258  81 SLDDDILLSTDEIDFAFRVWRSFPDRIVGFPPRSHFWDLSSGRWGYTSEWTNEYSMVLTGAAFYHRYYLYLYTHSLPAAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   824 RDMVDEYINCEDIAMNFLVSHITRKPPIKVTSRWTFRCPGCP-QALSHDDSHFHERHKCINFFVKVYGYMPLLYTQFRVD 902
Cdd:pfam09258 161 RTLVDETRNCEDILMNFLVANVTRKPPVKVTSRKQFKEPRNGkVGLSSDPGHFEQRSKCINKFARVFGYMPLVYSQGRVD 240
Exostosin pfam03016
Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on ...
192-502 1.17e-45

Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear.


Pssm-ID: 397245  Cd Length: 290  Bit Score: 166.06  E-value: 1.17e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   192 LTSGFPVYVYD-----------------SDQFAFGSYLDPLVKQAFQatvranVYVTENAAIACLYVVLVGEMQEPTVLR 254
Cdd:pfam03016   1 SCKGLKVYVYDlpprfnedllqpcrsltGWYSAEQFLLESILHSRIE------CRTSDPDEADCFFVPFYASLDASRHLL 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   255 PAD--------LEKQLFSLPHW-RTDGHNHVIINLSRKSDTQNLLYNVSTGRAMVA--QSTFYAAQYRAGFDLVVsPLVH 323
Cdd:pfam03016  75 NSAltdlfrelLDWLKSQYPYWnRSGGRDHFIVSGHPAWSFRRTAPDVDWGRAMLLnlTVLFSEDQFRPGKDVAL-PYPT 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   324 AMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEarSFEEEMEGDPPADYDDRIIATlkavqdskldqvlveftck 403
Cdd:pfam03016 154 PFHPDIGQWQDISPSNRRKTLLFFAGNRRRGYSGKIRP--LLLEECKGNPDADICGGLQCT------------------- 212
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   404 nqpkpslptewalcGEREDRLELLKLSTFALiITPGDPrlliSSGCatRLFEALEVGAVPVVLGEQVQLPYHDMLQWNEA 483
Cdd:pfam03016 213 --------------PGRDKYMELLRSSRFCL-QPPGDT----PTSP--RLFDALLAGCIPVIISDGWELPFADVIDWRKF 271
                         330
                  ....*....|....*....
gi 60360330   484 ALVVPKPRVTEVHFLLRSL 502
Cdd:pfam03016 272 SVFVPENDIPELKSILRSL 290
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
88-147 1.26e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 45.86  E-value: 1.26e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   88 RESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKEL 147
Cdd:COG1196  823 RERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKEL 882
THOC7 pfam05615
Tho complex subunit 7; The Tho complex is involved in transcription elongation and mRNA export ...
87-137 5.48e-03

Tho complex subunit 7; The Tho complex is involved in transcription elongation and mRNA export from the nucleus.


Pssm-ID: 398958 [Multi-domain]  Cd Length: 135  Bit Score: 38.02  E-value: 5.48e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 60360330    87 IRESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQdllQLKNVI 137
Cdd:pfam05615  66 LLEANERERENYEAEKEEIEEEIEAVREEIEELKERLEEAKR---TRKNRK 113
 
Name Accession Description Interval E-value
Glyco_transf_64 pfam09258
Glycosyl transferase family 64 domain; Members of this family catalyze the transfer reaction ...
665-902 1.21e-136

Glycosyl transferase family 64 domain; Members of this family catalyze the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.


Pssm-ID: 401264  Cd Length: 240  Bit Score: 407.44  E-value: 1.21e-136
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   665 FTVVMLTYE-REEVLMNSLERLNGLPYLNKVVVVWNSPKLPSEDLLWPDIGVPIMVVRTEKNSLNNRFLPWNEIETEAIL 743
Cdd:pfam09258   1 FTAVIHTYYsRIDLLLKLLQRYAASPHLAKIVVLWNNPKPPPELSRWPSTGVPVTVIRQKSNSLNNRFLPYPEIETDAVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   744 SIDDDAHLRHDEIMFGFRVWREARDRIVGFPGRYHAWDIPHQSWLYNSNYSCELSMVLTGAAFFHKYYAYLYSYVMPQAI 823
Cdd:pfam09258  81 SLDDDILLSTDEIDFAFRVWRSFPDRIVGFPPRSHFWDLSSGRWGYTSEWTNEYSMVLTGAAFYHRYYLYLYTHSLPAAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   824 RDMVDEYINCEDIAMNFLVSHITRKPPIKVTSRWTFRCPGCP-QALSHDDSHFHERHKCINFFVKVYGYMPLLYTQFRVD 902
Cdd:pfam09258 161 RTLVDETRNCEDILMNFLVANVTRKPPVKVTSRKQFKEPRNGkVGLSSDPGHFEQRSKCINKFARVFGYMPLVYSQGRVD 240
Exostosin pfam03016
Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on ...
192-502 1.17e-45

Exostosin family; The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear.


Pssm-ID: 397245  Cd Length: 290  Bit Score: 166.06  E-value: 1.17e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   192 LTSGFPVYVYD-----------------SDQFAFGSYLDPLVKQAFQatvranVYVTENAAIACLYVVLVGEMQEPTVLR 254
Cdd:pfam03016   1 SCKGLKVYVYDlpprfnedllqpcrsltGWYSAEQFLLESILHSRIE------CRTSDPDEADCFFVPFYASLDASRHLL 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   255 PAD--------LEKQLFSLPHW-RTDGHNHVIINLSRKSDTQNLLYNVSTGRAMVA--QSTFYAAQYRAGFDLVVsPLVH 323
Cdd:pfam03016  75 NSAltdlfrelLDWLKSQYPYWnRSGGRDHFIVSGHPAWSFRRTAPDVDWGRAMLLnlTVLFSEDQFRPGKDVAL-PYPT 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   324 AMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEarSFEEEMEGDPPADYDDRIIATlkavqdskldqvlveftck 403
Cdd:pfam03016 154 PFHPDIGQWQDISPSNRRKTLLFFAGNRRRGYSGKIRP--LLLEECKGNPDADICGGLQCT------------------- 212
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   404 nqpkpslptewalcGEREDRLELLKLSTFALiITPGDPrlliSSGCatRLFEALEVGAVPVVLGEQVQLPYHDMLQWNEA 483
Cdd:pfam03016 213 --------------PGRDKYMELLRSSRFCL-QPPGDT----PTSP--RLFDALLAGCIPVIISDGWELPFADVIDWRKF 271
                         330
                  ....*....|....*....
gi 60360330   484 ALVVPKPRVTEVHFLLRSL 502
Cdd:pfam03016 272 SVFVPENDIPELKSILRSL 290
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
88-147 1.26e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 45.86  E-value: 1.26e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   88 RESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKEL 147
Cdd:COG1196  823 RERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKEL 882
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
73-152 2.19e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 45.09  E-value: 2.19e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 60360330   73 SELCEVKHVLDLCRIR-ESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQN 151
Cdd:COG1196  842 EKLDELEEELEELEKElEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKL 921

                 .
gi 60360330  152 Q 152
Cdd:COG1196  922 E 922
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
84-150 7.11e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 43.55  E-value: 7.11e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 60360330   84 LCRIRESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQ 150
Cdd:COG1196  272 LKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEERLEELKEKIEALKEE 338
THOC7 pfam05615
Tho complex subunit 7; The Tho complex is involved in transcription elongation and mRNA export ...
87-137 5.48e-03

Tho complex subunit 7; The Tho complex is involved in transcription elongation and mRNA export from the nucleus.


Pssm-ID: 398958 [Multi-domain]  Cd Length: 135  Bit Score: 38.02  E-value: 5.48e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 60360330    87 IRESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQdllQLKNVI 137
Cdd:pfam05615  66 LLEANERERENYEAEKEEIEEEIEAVREEIEELKERLEEAKR---TRKNRK 113
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
89-150 9.60e-03

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 39.70  E-value: 9.60e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 60360330   89 ESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQ 150
Cdd:COG1196  831 EELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEE 892
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH