NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|325184391|emb|CCA18882|]
View 

similar to sodium channel putative [Albugo laibachii Nc14]

Protein Classification

Ion_trans and Na_channel_gate domain-containing protein (domain architecture ID 11998098)

protein containing domains Ion_trans, Na_channel_gate, and GPHH

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
549-785 3.67e-45

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 163.59  E-value: 3.67e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   549 HQAFSGVIMLVIMANTTVMALDHYPMP-PTLSSNLEVINFGLSCVFVVEMLLKVFGLGFCV-YARDRFNLFDAFIVVMSM 626
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPeEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   627 LELILSPPSflsknrpSRGNVSALRTFRLFRVFKLARNWKSFRELLALIIRAVAGIANFAVLLFLFIYIYALLGIQFYAN 706
Cdd:pfam00520   81 ISLVLSSVG-------SLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   707 TMRFDAdayavsaahgtdlafwNAQLPRSNFDSLLWAFVTVFQVITGENWNNVMYDAIRANG-FTASIYFISLVILGNFI 785
Cdd:pfam00520  154 KLKTWE----------------NPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKGeFWAYIYFVSFIILGGFL 217
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
980-1297 8.01e-44

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 159.74  E-value: 8.01e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   980 HPVFDNIVLLLIAVSSIALAVDNPlSDPTSSSAKSLKTLEKFCTILFTIEMLFKVFALGLFMHkdaYLRNKWNVLDGIIV 1059
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETY-FQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKR---YFRSPWNILDFVVV 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1060 VTSWVTLIAESSSQVANLKFLRplrGLRAFRPLRMISRRPGLKLVVNALFESVPAVMNVMFVCVLFYLIFSIIAVNNLKG 1139
Cdd:pfam00520   77 LPSLISLVLSSVGSLSGLRVLR---LLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1140 TFYKctgkvfdrlneaqlefltipspwislkneqkswfdnttcqnfttfqpyadasdltritsryicecwgasWEPPIP- 1218
Cdd:pfam00520  154 KLKT---------------------------------------------------------------------WENPDNg 164
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1219 -WNFNNIGWAMLTFFELSTTEGWVTVMTQAIDATDIDMQPIrdhqmkwayFFVIFNLVGSFFVVNLFVGVIIDNFNRMKA 1297
Cdd:pfam00520  165 rTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKGEFWAYI---------YFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1345-1602 9.89e-42

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 153.96  E-value: 9.89e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1345 ASWFEWFSMICIIINTLLMAAQ-YFGEASMQLRAVNLINELFAGVFTAEALMKGIAYGSK--YFEDAWNRFDFFVVggtL 1421
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALEtYFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKkrYFRSPWNILDFVVV---L 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1422 LSVIVEAITGTSVRSMAMLIRVFRVTRIMRLIKASKSIQQILTTLYVALPGLSNVASILFLMLFIYATMGVQLFAKVAH- 1500
Cdd:pfam00520   78 PSLISLVLSSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKt 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1501 -GDNIDNHSNFQGFWTAILLLLRSATGEAWDALMHDyasktpgcvsdppfnasmcgfhnfdgciPLNGCGNPMAYIYFCT 1579
Cdd:pfam00520  158 wENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYD----------------------------TIDGKGEFWAYIYFVS 209
                          250       260
                   ....*....|....*....|...
gi 325184391  1580 FTLLVTYVMLNLTIAIILEGFSS 1602
Cdd:pfam00520  210 FIILGGFLLLNLFIAVIIDNFQE 232
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
107-485 8.77e-29

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 116.60  E-value: 8.77e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   107 SRILDIVVVSAIIANSAILgitdhsVVDHHMNPSvigykydngamveaySQSNWIVQSSELPFTALFTVECALKIIAMGF 186
Cdd:pfam00520    1 SRYFELFILLLILLNTIFL------ALETYFQPE---------------EPLTTVLEILDYVFTGIFTLEMLLKIIAAGF 59
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   187 IRSkgaYLRDAWNVLDFVVVLMSLIGILP----SIPNVSAIRTIRVLRPLRSLSMIPGMRRLISALLKALPALANVVILQ 262
Cdd:pfam00520   60 KKR---YFRSPWNILDFVVVLPSLISLVLssvgSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLL 136
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   263 LFVFLIFGILGIQLFGGlmtsrcrltpypikmpvdkdgtyqwpipseylakvisdpvtyqclnepllshedrssrlytke 342
Cdd:pfam00520  137 LLFLFIFAIIGYQLFGG--------------------------------------------------------------- 153
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   343 tspwrfpqdcfwpinstdetlctftsesgvhkcsqvnvcgsDYDAFGNPrfknekvmqkavfsiafDYGYTTFDNIGKAF 422
Cdd:pfam00520  154 -----------------------------------------KLKTWENP-----------------DNGRTNFDNFPNAF 175
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 325184391   423 FTIFQAITQEGWTVIMYMTMDTSQPIVASLFFVILMIFASFFLMNLTLAVISDEFNLDDQKRQ 485
Cdd:pfam00520  176 LWLFQTMTTEGWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1290-1339 3.01e-15

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


:

Pssm-ID: 240441  Cd Length: 54  Bit Score: 71.44  E-value: 3.01e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 325184391 1290 DNFNRMKAALGG--DFMLTPEQKKWIEAQKAALRIGPVRLVKVPKNKYRKWI 1339
Cdd:cd13433     1 DNFNQLKKKYGGglDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFI 52
GPHH super family cl25190
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1618-1651 1.74e-03

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


The actual alignment was detected with superfamily member pfam16905:

Pssm-ID: 407139  Cd Length: 54  Bit Score: 38.01  E-value: 1.74e-03
                           10        20        30
                   ....*....|....*....|....*....|....
gi 325184391  1618 EFTTKWSWIDPKAVGYIRVQALCVLANILGPPLG 1651
Cdd:pfam16905    1 EFVRIWAEYDPAATGRISYQDMYELLRRISPPLG 34
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
549-785 3.67e-45

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 163.59  E-value: 3.67e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   549 HQAFSGVIMLVIMANTTVMALDHYPMP-PTLSSNLEVINFGLSCVFVVEMLLKVFGLGFCV-YARDRFNLFDAFIVVMSM 626
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPeEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   627 LELILSPPSflsknrpSRGNVSALRTFRLFRVFKLARNWKSFRELLALIIRAVAGIANFAVLLFLFIYIYALLGIQFYAN 706
Cdd:pfam00520   81 ISLVLSSVG-------SLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   707 TMRFDAdayavsaahgtdlafwNAQLPRSNFDSLLWAFVTVFQVITGENWNNVMYDAIRANG-FTASIYFISLVILGNFI 785
Cdd:pfam00520  154 KLKTWE----------------NPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKGeFWAYIYFVSFIILGGFL 217
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
980-1297 8.01e-44

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 159.74  E-value: 8.01e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   980 HPVFDNIVLLLIAVSSIALAVDNPlSDPTSSSAKSLKTLEKFCTILFTIEMLFKVFALGLFMHkdaYLRNKWNVLDGIIV 1059
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETY-FQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKR---YFRSPWNILDFVVV 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1060 VTSWVTLIAESSSQVANLKFLRplrGLRAFRPLRMISRRPGLKLVVNALFESVPAVMNVMFVCVLFYLIFSIIAVNNLKG 1139
Cdd:pfam00520   77 LPSLISLVLSSVGSLSGLRVLR---LLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1140 TFYKctgkvfdrlneaqlefltipspwislkneqkswfdnttcqnfttfqpyadasdltritsryicecwgasWEPPIP- 1218
Cdd:pfam00520  154 KLKT---------------------------------------------------------------------WENPDNg 164
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1219 -WNFNNIGWAMLTFFELSTTEGWVTVMTQAIDATDIDMQPIrdhqmkwayFFVIFNLVGSFFVVNLFVGVIIDNFNRMKA 1297
Cdd:pfam00520  165 rTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKGEFWAYI---------YFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1345-1602 9.89e-42

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 153.96  E-value: 9.89e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1345 ASWFEWFSMICIIINTLLMAAQ-YFGEASMQLRAVNLINELFAGVFTAEALMKGIAYGSK--YFEDAWNRFDFFVVggtL 1421
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALEtYFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKkrYFRSPWNILDFVVV---L 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1422 LSVIVEAITGTSVRSMAMLIRVFRVTRIMRLIKASKSIQQILTTLYVALPGLSNVASILFLMLFIYATMGVQLFAKVAH- 1500
Cdd:pfam00520   78 PSLISLVLSSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKt 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1501 -GDNIDNHSNFQGFWTAILLLLRSATGEAWDALMHDyasktpgcvsdppfnasmcgfhnfdgciPLNGCGNPMAYIYFCT 1579
Cdd:pfam00520  158 wENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYD----------------------------TIDGKGEFWAYIYFVS 209
                          250       260
                   ....*....|....*....|...
gi 325184391  1580 FTLLVTYVMLNLTIAIILEGFSS 1602
Cdd:pfam00520  210 FIILGGFLLLNLFIAVIIDNFQE 232
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
107-485 8.77e-29

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 116.60  E-value: 8.77e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   107 SRILDIVVVSAIIANSAILgitdhsVVDHHMNPSvigykydngamveaySQSNWIVQSSELPFTALFTVECALKIIAMGF 186
Cdd:pfam00520    1 SRYFELFILLLILLNTIFL------ALETYFQPE---------------EPLTTVLEILDYVFTGIFTLEMLLKIIAAGF 59
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   187 IRSkgaYLRDAWNVLDFVVVLMSLIGILP----SIPNVSAIRTIRVLRPLRSLSMIPGMRRLISALLKALPALANVVILQ 262
Cdd:pfam00520   60 KKR---YFRSPWNILDFVVVLPSLISLVLssvgSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLL 136
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   263 LFVFLIFGILGIQLFGGlmtsrcrltpypikmpvdkdgtyqwpipseylakvisdpvtyqclnepllshedrssrlytke 342
Cdd:pfam00520  137 LLFLFIFAIIGYQLFGG--------------------------------------------------------------- 153
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   343 tspwrfpqdcfwpinstdetlctftsesgvhkcsqvnvcgsDYDAFGNPrfknekvmqkavfsiafDYGYTTFDNIGKAF 422
Cdd:pfam00520  154 -----------------------------------------KLKTWENP-----------------DNGRTNFDNFPNAF 175
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 325184391   423 FTIFQAITQEGWTVIMYMTMDTSQPIVASLFFVILMIFASFFLMNLTLAVISDEFNLDDQKRQ 485
Cdd:pfam00520  176 LWLFQTMTTEGWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1290-1339 3.01e-15

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 71.44  E-value: 3.01e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 325184391 1290 DNFNRMKAALGG--DFMLTPEQKKWIEAQKAALRIGPVRLVKVPKNKYRKWI 1339
Cdd:cd13433     1 DNFNQLKKKYGGglDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFI 52
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1618-1651 1.74e-03

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 407139  Cd Length: 54  Bit Score: 38.01  E-value: 1.74e-03
                           10        20        30
                   ....*....|....*....|....*....|....
gi 325184391  1618 EFTTKWSWIDPKAVGYIRVQALCVLANILGPPLG 1651
Cdd:pfam16905    1 EFVRIWAEYDPAATGRISYQDMYELLRRISPPLG 34
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
549-785 3.67e-45

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 163.59  E-value: 3.67e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   549 HQAFSGVIMLVIMANTTVMALDHYPMP-PTLSSNLEVINFGLSCVFVVEMLLKVFGLGFCV-YARDRFNLFDAFIVVMSM 626
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPeEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   627 LELILSPPSflsknrpSRGNVSALRTFRLFRVFKLARNWKSFRELLALIIRAVAGIANFAVLLFLFIYIYALLGIQFYAN 706
Cdd:pfam00520   81 ISLVLSSVG-------SLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   707 TMRFDAdayavsaahgtdlafwNAQLPRSNFDSLLWAFVTVFQVITGENWNNVMYDAIRANG-FTASIYFISLVILGNFI 785
Cdd:pfam00520  154 KLKTWE----------------NPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKGeFWAYIYFVSFIILGGFL 217
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
980-1297 8.01e-44

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 159.74  E-value: 8.01e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   980 HPVFDNIVLLLIAVSSIALAVDNPlSDPTSSSAKSLKTLEKFCTILFTIEMLFKVFALGLFMHkdaYLRNKWNVLDGIIV 1059
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETY-FQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKR---YFRSPWNILDFVVV 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1060 VTSWVTLIAESSSQVANLKFLRplrGLRAFRPLRMISRRPGLKLVVNALFESVPAVMNVMFVCVLFYLIFSIIAVNNLKG 1139
Cdd:pfam00520   77 LPSLISLVLSSVGSLSGLRVLR---LLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1140 TFYKctgkvfdrlneaqlefltipspwislkneqkswfdnttcqnfttfqpyadasdltritsryicecwgasWEPPIP- 1218
Cdd:pfam00520  154 KLKT---------------------------------------------------------------------WENPDNg 164
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1219 -WNFNNIGWAMLTFFELSTTEGWVTVMTQAIDATDIDMQPIrdhqmkwayFFVIFNLVGSFFVVNLFVGVIIDNFNRMKA 1297
Cdd:pfam00520  165 rTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKGEFWAYI---------YFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1345-1602 9.89e-42

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 153.96  E-value: 9.89e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1345 ASWFEWFSMICIIINTLLMAAQ-YFGEASMQLRAVNLINELFAGVFTAEALMKGIAYGSK--YFEDAWNRFDFFVVggtL 1421
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALEtYFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKkrYFRSPWNILDFVVV---L 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1422 LSVIVEAITGTSVRSMAMLIRVFRVTRIMRLIKASKSIQQILTTLYVALPGLSNVASILFLMLFIYATMGVQLFAKVAH- 1500
Cdd:pfam00520   78 PSLISLVLSSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKt 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391  1501 -GDNIDNHSNFQGFWTAILLLLRSATGEAWDALMHDyasktpgcvsdppfnasmcgfhnfdgciPLNGCGNPMAYIYFCT 1579
Cdd:pfam00520  158 wENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYD----------------------------TIDGKGEFWAYIYFVS 209
                          250       260
                   ....*....|....*....|...
gi 325184391  1580 FTLLVTYVMLNLTIAIILEGFSS 1602
Cdd:pfam00520  210 FIILGGFLLLNLFIAVIIDNFQE 232
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
107-485 8.77e-29

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 116.60  E-value: 8.77e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   107 SRILDIVVVSAIIANSAILgitdhsVVDHHMNPSvigykydngamveaySQSNWIVQSSELPFTALFTVECALKIIAMGF 186
Cdd:pfam00520    1 SRYFELFILLLILLNTIFL------ALETYFQPE---------------EPLTTVLEILDYVFTGIFTLEMLLKIIAAGF 59
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   187 IRSkgaYLRDAWNVLDFVVVLMSLIGILP----SIPNVSAIRTIRVLRPLRSLSMIPGMRRLISALLKALPALANVVILQ 262
Cdd:pfam00520   60 KKR---YFRSPWNILDFVVVLPSLISLVLssvgSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLL 136
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   263 LFVFLIFGILGIQLFGGlmtsrcrltpypikmpvdkdgtyqwpipseylakvisdpvtyqclnepllshedrssrlytke 342
Cdd:pfam00520  137 LLFLFIFAIIGYQLFGG--------------------------------------------------------------- 153
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   343 tspwrfpqdcfwpinstdetlctftsesgvhkcsqvnvcgsDYDAFGNPrfknekvmqkavfsiafDYGYTTFDNIGKAF 422
Cdd:pfam00520  154 -----------------------------------------KLKTWENP-----------------DNGRTNFDNFPNAF 175
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 325184391   423 FTIFQAITQEGWTVIMYMTMDTSQPIVASLFFVILMIFASFFLMNLTLAVISDEFNLDDQKRQ 485
Cdd:pfam00520  176 LWLFQTMTTEGWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1290-1339 3.01e-15

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 71.44  E-value: 3.01e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 325184391 1290 DNFNRMKAALGG--DFMLTPEQKKWIEAQKAALRIGPVRLVKVPKNKYRKWI 1339
Cdd:cd13433     1 DNFNQLKKKYGGglDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFI 52
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1618-1651 1.74e-03

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 407139  Cd Length: 54  Bit Score: 38.01  E-value: 1.74e-03
                           10        20        30
                   ....*....|....*....|....*....|....
gi 325184391  1618 EFTTKWSWIDPKAVGYIRVQALCVLANILGPPLG 1651
Cdd:pfam16905    1 EFVRIWAEYDPAATGRISYQDMYELLRRISPPLG 34
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
583-789 4.80e-03

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 400395  Cd Length: 424  Bit Score: 41.56  E-value: 4.80e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   583 EVINFGLSCVFVVEMLLKVFGLGFCvYARDRFNLFDAFIVVMSMLELIL-----------------SPPSFLSKNRPSR- 644
Cdd:pfam08016  213 EIVFVVFFLYFVVEEILKIRKHRPS-YLRSVWNLLDLAIVILSVVLIVLniyrdflvdrliksveaSPVTFIDFDRVAQl 291
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325184391   645 ----GNVSA----LRTFRLFRVFKLARNWKSFRELLAliiRAVAGIANFAVLLFLFIYIYALLGIQFYANTMrfdadaya 716
Cdd:pfam08016  292 dnlyRIILAflvfLTWLKLFKVLRFNKTMSLFTKTLS---RAWKDLAGFALMFVIFFFAYAQFGYLLFGTQA-------- 360
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 325184391   717 vsaahgtdlafwnaqlprSNFDSLLWAFVTVFQVITG-ENWNNVMYdairANGFTASIYFISLVILGNFILMNL 789
Cdd:pfam08016  361 ------------------PNFSNFVKSILTLFRTILGdFGYNEIFS----GNRVLGPLLFLTFVFLVIFILLNL 412
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH