NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|528315051|gb|EPY49632|]
View 

elongin-A [Schizosaccharomyces cryophilus OY26]

Protein Classification

elongin A domain-containing protein( domain architecture ID 10536397)

elongin A domain-containing protein such as Caenorhabditis elegans elongin A (also known as Transcription elongation factor B polypeptide 3) that acts as an activator of the RNA polymerase II elongation complex

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Elongin_A pfam06881
RNA polymerase II transcription factor SIII (Elongin) subunit A; This family represents a ...
19-123 7.00e-35

RNA polymerase II transcription factor SIII (Elongin) subunit A; This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A. In mammals, the Elongin complex activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin is a heterotrimer composed of A, B, and C subunits of 110, 18, and 15 kilodaltons, respectively. Subunit A has been shown to function as the transcriptionally active component of Elongin.


:

Pssm-ID: 429170  Cd Length: 105  Bit Score: 120.78  E-value: 7.00e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 528315051   19 IEDIGDYPYALLEPILERAPPDRLHLLEERSPHIKQESQSLWKLHVLRDFALELQQFKAPLPSITDWRSLYQRLKKRRNT 98
Cdd:pfam06881   1 IDDVGDVPYHLLRPILLKCNPEQLRRIEENSPHLAGDTDELWKRFIKRDFPNWAEEKDYEPKNPKSWRKLYEKLKEEREE 80
                          90       100
                  ....*....|....*....|....*
gi 528315051   99 QYNEASEKLRNAYTKLEQTKQTKRI 123
Cdd:pfam06881  81 KLKAATERLRQAYAGLQKEKQSKQI 105
 
Name Accession Description Interval E-value
Elongin_A pfam06881
RNA polymerase II transcription factor SIII (Elongin) subunit A; This family represents a ...
19-123 7.00e-35

RNA polymerase II transcription factor SIII (Elongin) subunit A; This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A. In mammals, the Elongin complex activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin is a heterotrimer composed of A, B, and C subunits of 110, 18, and 15 kilodaltons, respectively. Subunit A has been shown to function as the transcriptionally active component of Elongin.


Pssm-ID: 429170  Cd Length: 105  Bit Score: 120.78  E-value: 7.00e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 528315051   19 IEDIGDYPYALLEPILERAPPDRLHLLEERSPHIKQESQSLWKLHVLRDFALELQQFKAPLPSITDWRSLYQRLKKRRNT 98
Cdd:pfam06881   1 IDDVGDVPYHLLRPILLKCNPEQLRRIEENSPHLAGDTDELWKRFIKRDFPNWAEEKDYEPKNPKSWRKLYEKLKEEREE 80
                          90       100
                  ....*....|....*....|....*
gi 528315051   99 QYNEASEKLRNAYTKLEQTKQTKRI 123
Cdd:pfam06881  81 KLKAATERLRQAYAGLQKEKQSKQI 105
 
Name Accession Description Interval E-value
Elongin_A pfam06881
RNA polymerase II transcription factor SIII (Elongin) subunit A; This family represents a ...
19-123 7.00e-35

RNA polymerase II transcription factor SIII (Elongin) subunit A; This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A. In mammals, the Elongin complex activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin is a heterotrimer composed of A, B, and C subunits of 110, 18, and 15 kilodaltons, respectively. Subunit A has been shown to function as the transcriptionally active component of Elongin.


Pssm-ID: 429170  Cd Length: 105  Bit Score: 120.78  E-value: 7.00e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 528315051   19 IEDIGDYPYALLEPILERAPPDRLHLLEERSPHIKQESQSLWKLHVLRDFALELQQFKAPLPSITDWRSLYQRLKKRRNT 98
Cdd:pfam06881   1 IDDVGDVPYHLLRPILLKCNPEQLRRIEENSPHLAGDTDELWKRFIKRDFPNWAEEKDYEPKNPKSWRKLYEKLKEEREE 80
                          90       100
                  ....*....|....*....|....*
gi 528315051   99 QYNEASEKLRNAYTKLEQTKQTKRI 123
Cdd:pfam06881  81 KLKAATERLRQAYAGLQKEKQSKQI 105
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH