NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|118151442|ref|NP_001071627|]
View 

lysozyme C, non-stomach isozyme precursor [Bos taurus]

Protein Classification

lysozyme C family protein (domain architecture ID 13014097)

lysozyme C family protein may catalyze the hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
LYZ_C cd16897
C-type lysozyme; C-type lysozyme (chicken or conventional type; 1, 4-beta-N-acetylmuramidase). ...
19-146 2.79e-80

C-type lysozyme; C-type lysozyme (chicken or conventional type; 1, 4-beta-N-acetylmuramidase). In humans, lysozyme is found in a wide variety of tissue types and body fluids. It has bacteriolytic properties through the hydolysis of beta-1,4, glyocosidic linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan, as well as between N-acetyl-D-glucosamine residues in chitodextrins. This family also includes digestive stomach lysozyme, which allow ruminants to digest bacteria in the foregut. The mammalian enzyme is related to lysozyme found hen egg-whites and related species.


:

Pssm-ID: 340383  Cd Length: 126  Bit Score: 232.54  E-value: 2.79e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442  19 KVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQATNYNAgDQSTDYGIFQINSHWWCNDGKTPgAVNACHLP 98
Cdd:cd16897    1 KIFSRCELARILKRGGLDGYRGYSLANWVCLAYYESGFNTRATNENP-DGSTDYGIFQINSRYWCNDGKTP-SKNLCHIS 78
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 118151442  99 CGALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHCQNQDLTSYIQGC 146
Cdd:cd16897   79 CSDLLNDDITDDIKCAKKIVKDPQGMGAWVAWRLHCEGRDLSRWLDGC 126
 
Name Accession Description Interval E-value
LYZ_C cd16897
C-type lysozyme; C-type lysozyme (chicken or conventional type; 1, 4-beta-N-acetylmuramidase). ...
19-146 2.79e-80

C-type lysozyme; C-type lysozyme (chicken or conventional type; 1, 4-beta-N-acetylmuramidase). In humans, lysozyme is found in a wide variety of tissue types and body fluids. It has bacteriolytic properties through the hydolysis of beta-1,4, glyocosidic linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan, as well as between N-acetyl-D-glucosamine residues in chitodextrins. This family also includes digestive stomach lysozyme, which allow ruminants to digest bacteria in the foregut. The mammalian enzyme is related to lysozyme found hen egg-whites and related species.


Pssm-ID: 340383  Cd Length: 126  Bit Score: 232.54  E-value: 2.79e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442  19 KVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQATNYNAgDQSTDYGIFQINSHWWCNDGKTPgAVNACHLP 98
Cdd:cd16897    1 KIFSRCELARILKRGGLDGYRGYSLANWVCLAYYESGFNTRATNENP-DGSTDYGIFQINSRYWCNDGKTP-SKNLCHIS 78
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 118151442  99 CGALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHCQNQDLTSYIQGC 146
Cdd:cd16897   79 CSDLLNDDITDDIKCAKKIVKDPQGMGAWVAWRLHCEGRDLSRWLDGC 126
LYZ1 smart00263
Alpha-lactalbumin / lysozyme C;
19-147 3.53e-80

Alpha-lactalbumin / lysozyme C;


Pssm-ID: 197612  Cd Length: 127  Bit Score: 232.18  E-value: 3.53e-80
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442    19 KVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQATNYNAGDqSTDYGIFQINSHWWCNDGKTPGAVNACHLP 98
Cdd:smart00263   1 KVFTRCELARELKRLGLDGYRGISLANWVCLAFHESGYNTQATNYNNGG-STDYGIFQINSKYWCNDGKTPGSVNACGIS 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
gi 118151442    99 CGALLQDDITQAVACAKRVVSDpQGIRAWVAWRSHCQNQDLTSYIQGCG 147
Cdd:smart00263  80 CSKLLDDDITDDVKCAKKIVSD-QGIDAWVAWKNHCQGEDLSQWIRGCG 127
Lys pfam00062
C-type lysozyme/alpha-lactalbumin family; Alpha-lactalbumin is the regulatory subunit of ...
19-146 1.61e-71

C-type lysozyme/alpha-lactalbumin family; Alpha-lactalbumin is the regulatory subunit of lactose synthase, changing the substrate specificity of galactosyltransferase from N-acetylglucosamine to glucose. C-type lysozymes are secreted bacteriolytic enzymes that cleave the peptidoglycan of bacterial cell walls. Structure is a multi-domain, mixed alpha and beta fold, containing four conserved disulfide bonds.


Pssm-ID: 395016  Cd Length: 123  Bit Score: 210.36  E-value: 1.61e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442   19 KVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQATNYNagDQSTDYGIFQINSHWWCNDGKTPGAVNACHLP 98
Cdd:pfam00062   1 KQFTRCELARELKKLGMDGYRGISLAEWVCLAFHESGYDTQAIVYN--NGSTDYGIFQINDKYWCKDGKTPQSVNICGIS 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 118151442   99 CGALLQDDITQAVACAKRVVsDPQGIRAWVAWRSHCQnQDLTSYIqGC 146
Cdd:pfam00062  79 CDKLLDDDITDDIMCAKKIL-DPQGIDAWLAWKPHCS-EDLEQWI-GC 123
 
Name Accession Description Interval E-value
LYZ_C cd16897
C-type lysozyme; C-type lysozyme (chicken or conventional type; 1, 4-beta-N-acetylmuramidase). ...
19-146 2.79e-80

C-type lysozyme; C-type lysozyme (chicken or conventional type; 1, 4-beta-N-acetylmuramidase). In humans, lysozyme is found in a wide variety of tissue types and body fluids. It has bacteriolytic properties through the hydolysis of beta-1,4, glyocosidic linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan, as well as between N-acetyl-D-glucosamine residues in chitodextrins. This family also includes digestive stomach lysozyme, which allow ruminants to digest bacteria in the foregut. The mammalian enzyme is related to lysozyme found hen egg-whites and related species.


Pssm-ID: 340383  Cd Length: 126  Bit Score: 232.54  E-value: 2.79e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442  19 KVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQATNYNAgDQSTDYGIFQINSHWWCNDGKTPgAVNACHLP 98
Cdd:cd16897    1 KIFSRCELARILKRGGLDGYRGYSLANWVCLAYYESGFNTRATNENP-DGSTDYGIFQINSRYWCNDGKTP-SKNLCHIS 78
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 118151442  99 CGALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHCQNQDLTSYIQGC 146
Cdd:cd16897   79 CSDLLNDDITDDIKCAKKIVKDPQGMGAWVAWRLHCEGRDLSRWLDGC 126
LYZ1 smart00263
Alpha-lactalbumin / lysozyme C;
19-147 3.53e-80

Alpha-lactalbumin / lysozyme C;


Pssm-ID: 197612  Cd Length: 127  Bit Score: 232.18  E-value: 3.53e-80
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442    19 KVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQATNYNAGDqSTDYGIFQINSHWWCNDGKTPGAVNACHLP 98
Cdd:smart00263   1 KVFTRCELARELKRLGLDGYRGISLANWVCLAFHESGYNTQATNYNNGG-STDYGIFQINSKYWCNDGKTPGSVNACGIS 79
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
gi 118151442    99 CGALLQDDITQAVACAKRVVSDpQGIRAWVAWRSHCQNQDLTSYIQGCG 147
Cdd:smart00263  80 CSKLLDDDITDDVKCAKKIVSD-QGIDAWVAWKNHCQGEDLSQWIRGCG 127
Lys pfam00062
C-type lysozyme/alpha-lactalbumin family; Alpha-lactalbumin is the regulatory subunit of ...
19-146 1.61e-71

C-type lysozyme/alpha-lactalbumin family; Alpha-lactalbumin is the regulatory subunit of lactose synthase, changing the substrate specificity of galactosyltransferase from N-acetylglucosamine to glucose. C-type lysozymes are secreted bacteriolytic enzymes that cleave the peptidoglycan of bacterial cell walls. Structure is a multi-domain, mixed alpha and beta fold, containing four conserved disulfide bonds.


Pssm-ID: 395016  Cd Length: 123  Bit Score: 210.36  E-value: 1.61e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442   19 KVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQATNYNagDQSTDYGIFQINSHWWCNDGKTPGAVNACHLP 98
Cdd:pfam00062   1 KQFTRCELARELKKLGMDGYRGISLAEWVCLAFHESGYDTQAIVYN--NGSTDYGIFQINDKYWCKDGKTPQSVNICGIS 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 118151442   99 CGALLQDDITQAVACAKRVVsDPQGIRAWVAWRSHCQnQDLTSYIqGC 146
Cdd:pfam00062  79 CDKLLDDDITDDIMCAKKIL-DPQGIDAWLAWKPHCS-EDLEQWI-GC 123
LYZ cd00119
C-type lysozyme and alpha-lactalbumin; C-type lysozyme (chicken or conventional type, 1, ...
19-144 3.71e-57

C-type lysozyme and alpha-lactalbumin; C-type lysozyme (chicken or conventional type, 1,4-beta-N-acetylmuramidase) and alpha-lactalbumin (lactose synthase B protein, LA). They have a close evolutionary relationship and similar tertiary structure, however, functionally they are quite different. Lysozymes have primarily bacteriolytic function; hydrolysis of peptidoglycans of prokaryotic cell walls and transglycosylation. LA is a calcium-binding metalloprotein that is expressed exclusively in the mammary gland during lactation. LA is the regulatory subunit of the enzyme lactose synthase. The association of LA with the catalytic component of lactose synthase, galactosyltransferase, alters the acceptor substrate specificity of this glycosyltransferase, facilitating biosynthesis of lactose. Some lysozymes have evolved into digestive enzymes, both in mammals and invertebrates.


Pssm-ID: 340357  Cd Length: 122  Bit Score: 173.91  E-value: 3.71e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442  19 KVFERCELARSLKRFGmdNFRGISLANWMCLARWESNYNTQATNYNaGDQSTDYGIFQINSHWWCNDGKTPGAVNACHLP 98
Cdd:cd00119    1 KVFTRCELARLLKDIG--GYGGISLPNWVCLMKHESGYDTQATNEN-NNGSTDYGLFQINSRYWCKDGQTPGARNICDIS 77
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 118151442  99 CGALLQDDITQAVACAKRVVSDpQGIRAWVAWRSHCQNQdLTSYIQ 144
Cdd:cd00119   78 CSKLLTDDITDAIMCAKKIVDD-KGIDAWVAWKNHCQNK-LRQYVS 121
LYZ_C_invert cd16899
C-type invertebrate lysozyme; C-type lysozyme proteins of invertebrates, including digestive ...
19-144 3.68e-47

C-type invertebrate lysozyme; C-type lysozyme proteins of invertebrates, including digestive lysozymes 1 and 2 from Musca domestica, which aid in the use of bacteria as a food source. These lysozymes have high expression in the gut and optimal lytic activity at a lower pH. Other lysozymes in this subfamily have immunological roles. e.g. Anopheles gambiae has eight lysozymes, most of which seem to have immunological roles, those some may function as digestive enzymes in larvae. C-type lysozyme (chicken or conventional type; 1, 4-beta-N-acetylmuramidase) has bacteriolytic properties through the hydolysis of beta-1,4, glyocosidic linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan, as well as between N-acetyl-D-glucosamine residues in chitodextrins.


Pssm-ID: 381618  Cd Length: 121  Bit Score: 148.53  E-value: 3.68e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442  19 KVFERCELARSLKRFGmdnFRGISLANWMCLARWESNYNTQATNYNAGDQSTDYGIFQINSHWWCNDGKTPGavNACHLP 98
Cdd:cd16899    1 KIFTRCELARELRKLG---VPRSQLANWVCLAEHESSFNTTAVGGPNSDGSGDYGLFQINDKYWCSPGGGSG--NGCNVK 75
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 118151442  99 CGALLQDDITQAVACAKRVVsDPQGIRAWVAWRSHCQNQDLTSYIQ 144
Cdd:cd16899   76 CEDLLDDDISDDVKCAKKIY-KEQGFNAWVGWKNKCKGKNLPSYSD 120
LYZ_LA cd16898
alpha lactalbumin; alpha-lactalbumin (lactose synthase B protein, LA) is a calcium-binding ...
21-143 3.49e-43

alpha lactalbumin; alpha-lactalbumin (lactose synthase B protein, LA) is a calcium-binding metalloprotein that is expressed exclusively in the mammary gland during lactation. LA is the regulatory subunit of the enzyme lactose synthase. The association of LA with the catalytic component of lactose synthase, galactosyltransferase, alters the acceptor substrate specificity of this glycosyltransferase, facilitating biosynthesis of lactose.


Pssm-ID: 340384  Cd Length: 123  Bit Score: 138.72  E-value: 3.49e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118151442  21 FERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQATNYNAGdqSTDYGIFQINSHWWCNDGKTPGAVNACHLPCG 100
Cdd:cd16898    3 FTKCELSQILKEHGLDGFNGISLPEWICVTFHTSGYDTQALVYNNG--STEYGLFQISNKGWCDDSQEPVSRNICGISCS 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 118151442 101 ALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHCqNQDLTSYI 143
Cdd:cd16898   81 KLLDDDITDDIACAKKILAIPKGIDYWKAHKPFC-REDLDQWR 122
Lyz-like cd00442
lysozyme-like domains; This family contains several members, including soluble lytic ...
45-90 2.45e-05

lysozyme-like domains; This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.


Pssm-ID: 381596 [Multi-domain]  Cd Length: 59  Bit Score: 39.70  E-value: 2.45e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 118151442  45 NWMCLARWESNYNTqatNYNAGDQSTDYGIFQINSHWWCNDGKTPG 90
Cdd:cd00442    1 VLAAIIGQESGGNK---PANAGSGSGAAGLFQFMPGTWKAYGKNSS 43
LT_IagB-like cd13400
Escherichia coli invasion protein IagB and similar proteins; Lytic transglycosylase-like ...
53-82 2.40e-04

Escherichia coli invasion protein IagB and similar proteins; Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.


Pssm-ID: 381603 [Multi-domain]  Cd Length: 109  Bit Score: 38.28  E-value: 2.40e-04
                         10        20        30
                 ....*....|....*....|....*....|
gi 118151442  53 ESNYNTQATNYNAGDqSTDYGIFQINSHWW 82
Cdd:cd13400   15 ESGFNPNAINRNKNG-SYDIGLMQINSIWL 43
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH