NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|156121119|ref|NP_001095707|]
View 

transmembrane protein 132A precursor [Bos taurus]

Protein Classification

transmembrane protein 132 (domain architecture ID 12174329)

transmembrane protein 132 (TMEM132) such as Rattus norvegicus TMEM132D, also called mature oligodendrocytes transmembrane protein (MOLT), that may serve as a cell-surface marker for oligodendrocyte differentiation

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TMEM132 pfam16070
Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 ...
407-750 1.89e-149

Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development. TMEM132D may be a marker for oligodendrocyte differentiation.


:

Pssm-ID: 406471  Cd Length: 344  Bit Score: 447.88  E-value: 1.89e-149
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   407 ELVNTAPLTGVPRRIPVRLVTVDSGGALVEVTEHIGCESANTQVLQVSEACDAVFVSGKESRGALGVRVDFWWRRLRASL 486
Cdd:pfam16070    1 EILNTAILTGRTVAVPVKVVAVEADGTVTDVTESVSCSSTDEDVLKVSSSCDYVYVNGKESRGSSNASVNFTYGTLSAQL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   487 RMTVWAPLLPLRIEVTDTTLEQVRGWRVPGPAEGAREPEAAGVEEAERRARGCRLQYQRAGVRFLVPFAAHPLDGGRRLT 566
Cdd:pfam16070   81 ELTVWVPRLPLQIEVSDTELSQIKGWRVPILSNKRPARDSEDEEEDDRKGRGCRLQYQHATVRVLARFVAEDADGSGQLS 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   567 HLLGPDWLLDVSHLVAPHARVQDPRVASLEGGRVLVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVLELRVQPVMG 646
Cdd:pfam16070  161 YLLGSDWQVDVTDLVADFLRVEDPRVARLQDGRVLQGREPGTTTVQVLSPLSDSVLGEKTITVLDDKVSITELGVQLVSG 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   647 ISLALSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTLAPAELYDHHDLGLSVSAEEPGAVLPAEEQGAQLRV 726
Cdd:pfam16070  241 LSLSLQPSPGSNRAIVATTTAQETLTAPKQEALLSAWLQFSDGSVTPLDLYDPSDYSLTVTSLDEAVVSVSQDPSSKWPV 320
                          330       340
                   ....*....|....*....|....
gi 156121119   727 VVSGAGTEGLPLHVALHPPEPCRR 750
Cdd:pfam16070  321 VVAEGEGQGPLLRVELTISEACQK 344
TMEM132D_N pfam15705
Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal ...
52-171 1.14e-41

Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


:

Pssm-ID: 406196  Cd Length: 131  Bit Score: 148.93  E-value: 1.14e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119    52 LLDAPEHFRVQQVGRYPPANSSLGSRSETFLLLQPwpRAQPLLRASYPPFATQQVVPPRVTE-------PHQRPVPWDVR 124
Cdd:pfam15705    5 LLNADSAFFLQEANQDLMRNSSLQSRSESFFIYRA--REPPVLNASYGPFSVEQVVPLELLQtssplgsPNKFTFNWKVR 82
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
gi 156121119   125 AVSVEAAVTPAEPHARVLFHLRGQDW--PPGPGSLPCARLHATHPAGTA 171
Cdd:pfam15705   83 AHILDSRVYPSRPKVQVLFYIAGRDWddYSPGERLPCVRLFAFRETREV 131
TMEM132D_C pfam15706
Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal ...
838-903 5.89e-28

Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


:

Pssm-ID: 406197  Cd Length: 84  Bit Score: 107.76  E-value: 5.89e-28
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 156121119   838 MVPAPQRVTDLELGMYALLGIFCLAILIFLVNGVVFVLRYQRKEPPDGATDPAsPQPHNWVWLGTD 903
Cdd:pfam15706   20 LVQASRGLTDLEIGMYALLGVFCLAILVFLINCVVFALKYRRKKVPVEGPGPV-PHSHDWVWLGRE 84
 
Name Accession Description Interval E-value
TMEM132 pfam16070
Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 ...
407-750 1.89e-149

Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development. TMEM132D may be a marker for oligodendrocyte differentiation.


Pssm-ID: 406471  Cd Length: 344  Bit Score: 447.88  E-value: 1.89e-149
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   407 ELVNTAPLTGVPRRIPVRLVTVDSGGALVEVTEHIGCESANTQVLQVSEACDAVFVSGKESRGALGVRVDFWWRRLRASL 486
Cdd:pfam16070    1 EILNTAILTGRTVAVPVKVVAVEADGTVTDVTESVSCSSTDEDVLKVSSSCDYVYVNGKESRGSSNASVNFTYGTLSAQL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   487 RMTVWAPLLPLRIEVTDTTLEQVRGWRVPGPAEGAREPEAAGVEEAERRARGCRLQYQRAGVRFLVPFAAHPLDGGRRLT 566
Cdd:pfam16070   81 ELTVWVPRLPLQIEVSDTELSQIKGWRVPILSNKRPARDSEDEEEDDRKGRGCRLQYQHATVRVLARFVAEDADGSGQLS 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   567 HLLGPDWLLDVSHLVAPHARVQDPRVASLEGGRVLVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVLELRVQPVMG 646
Cdd:pfam16070  161 YLLGSDWQVDVTDLVADFLRVEDPRVARLQDGRVLQGREPGTTTVQVLSPLSDSVLGEKTITVLDDKVSITELGVQLVSG 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   647 ISLALSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTLAPAELYDHHDLGLSVSAEEPGAVLPAEEQGAQLRV 726
Cdd:pfam16070  241 LSLSLQPSPGSNRAIVATTTAQETLTAPKQEALLSAWLQFSDGSVTPLDLYDPSDYSLTVTSLDEAVVSVSQDPSSKWPV 320
                          330       340
                   ....*....|....*....|....
gi 156121119   727 VVSGAGTEGLPLHVALHPPEPCRR 750
Cdd:pfam16070  321 VVAEGEGQGPLLRVELTISEACQK 344
TMEM132D_N pfam15705
Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal ...
52-171 1.14e-41

Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 406196  Cd Length: 131  Bit Score: 148.93  E-value: 1.14e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119    52 LLDAPEHFRVQQVGRYPPANSSLGSRSETFLLLQPwpRAQPLLRASYPPFATQQVVPPRVTE-------PHQRPVPWDVR 124
Cdd:pfam15705    5 LLNADSAFFLQEANQDLMRNSSLQSRSESFFIYRA--REPPVLNASYGPFSVEQVVPLELLQtssplgsPNKFTFNWKVR 82
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
gi 156121119   125 AVSVEAAVTPAEPHARVLFHLRGQDW--PPGPGSLPCARLHATHPAGTA 171
Cdd:pfam15705   83 AHILDSRVYPSRPKVQVLFYIAGRDWddYSPGERLPCVRLFAFRETREV 131
TMEM132D_C pfam15706
Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal ...
838-903 5.89e-28

Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 406197  Cd Length: 84  Bit Score: 107.76  E-value: 5.89e-28
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 156121119   838 MVPAPQRVTDLELGMYALLGIFCLAILIFLVNGVVFVLRYQRKEPPDGATDPAsPQPHNWVWLGTD 903
Cdd:pfam15706   20 LVQASRGLTDLEIGMYALLGVFCLAILVFLINCVVFALKYRRKKVPVEGPGPV-PHSHDWVWLGRE 84
 
Name Accession Description Interval E-value
TMEM132 pfam16070
Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 ...
407-750 1.89e-149

Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development. TMEM132D may be a marker for oligodendrocyte differentiation.


Pssm-ID: 406471  Cd Length: 344  Bit Score: 447.88  E-value: 1.89e-149
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   407 ELVNTAPLTGVPRRIPVRLVTVDSGGALVEVTEHIGCESANTQVLQVSEACDAVFVSGKESRGALGVRVDFWWRRLRASL 486
Cdd:pfam16070    1 EILNTAILTGRTVAVPVKVVAVEADGTVTDVTESVSCSSTDEDVLKVSSSCDYVYVNGKESRGSSNASVNFTYGTLSAQL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   487 RMTVWAPLLPLRIEVTDTTLEQVRGWRVPGPAEGAREPEAAGVEEAERRARGCRLQYQRAGVRFLVPFAAHPLDGGRRLT 566
Cdd:pfam16070   81 ELTVWVPRLPLQIEVSDTELSQIKGWRVPILSNKRPARDSEDEEEDDRKGRGCRLQYQHATVRVLARFVAEDADGSGQLS 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   567 HLLGPDWLLDVSHLVAPHARVQDPRVASLEGGRVLVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVLELRVQPVMG 646
Cdd:pfam16070  161 YLLGSDWQVDVTDLVADFLRVEDPRVARLQDGRVLQGREPGTTTVQVLSPLSDSVLGEKTITVLDDKVSITELGVQLVSG 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119   647 ISLALSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTLAPAELYDHHDLGLSVSAEEPGAVLPAEEQGAQLRV 726
Cdd:pfam16070  241 LSLSLQPSPGSNRAIVATTTAQETLTAPKQEALLSAWLQFSDGSVTPLDLYDPSDYSLTVTSLDEAVVSVSQDPSSKWPV 320
                          330       340
                   ....*....|....*....|....
gi 156121119   727 VVSGAGTEGLPLHVALHPPEPCRR 750
Cdd:pfam16070  321 VVAEGEGQGPLLRVELTISEACQK 344
TMEM132D_N pfam15705
Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal ...
52-171 1.14e-41

Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 406196  Cd Length: 131  Bit Score: 148.93  E-value: 1.14e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156121119    52 LLDAPEHFRVQQVGRYPPANSSLGSRSETFLLLQPwpRAQPLLRASYPPFATQQVVPPRVTE-------PHQRPVPWDVR 124
Cdd:pfam15705    5 LLNADSAFFLQEANQDLMRNSSLQSRSESFFIYRA--REPPVLNASYGPFSVEQVVPLELLQtssplgsPNKFTFNWKVR 82
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
gi 156121119   125 AVSVEAAVTPAEPHARVLFHLRGQDW--PPGPGSLPCARLHATHPAGTA 171
Cdd:pfam15705   83 AHILDSRVYPSRPKVQVLFYIAGRDWddYSPGERLPCVRLFAFRETREV 131
TMEM132D_C pfam15706
Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal ...
838-903 5.89e-28

Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 406197  Cd Length: 84  Bit Score: 107.76  E-value: 5.89e-28
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 156121119   838 MVPAPQRVTDLELGMYALLGIFCLAILIFLVNGVVFVLRYQRKEPPDGATDPAsPQPHNWVWLGTD 903
Cdd:pfam15706   20 LVQASRGLTDLEIGMYALLGVFCLAILVFLINCVVFALKYRRKKVPVEGPGPV-PHSHDWVWLGRE 84
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH