NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|390979643|ref|NP_001254636|]
View 

solute carrier organic anion transporter family member 1A5 [Mus musculus]

Protein Classification

oat family protein (domain architecture ID 11489679)

oat family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
1-625 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


:

Pssm-ID: 273279 [Multi-domain]  Cd Length: 632  Bit Score: 989.62  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643    1 MGETEKRIATHGVRC------------FSKIKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIG 68
Cdd:TIGR00805   1 MGETEKDIATHESSAglkprprclqslFSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643   69 NLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSLPHFLMGRYEYETTISPTSNLSS-NSFLCMENRTQTLKPTQDPA 147
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGAGCAIMGLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSaNSFLCMENLTQTLRPTQDPS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  148 ECVKEMKSLMWIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSV 227
Cdd:TIGR00805 161 ECQKQHKSLMWLLFLVSNILRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  228 NTDDLTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKEGLQDNVDRTENDKEEKHREKAKEENRGITKDFLP 307
Cdd:TIGR00805 241 NTEDLIITPTDPRWIGAWWIGFLVCGFVALLTSIPLFFFPKTLPKEGKRVNVDVHEAEKLEKSRGEDRKKNSGITKDFPK 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  308 FMKSLSCNPIYMLLILTSVLQINAFINMFTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKA 387
Cdd:TIGR00805 321 FIKRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKA 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  388 AYMAFCLSLFEYLLSYFHFMISCDNFQVAGLTTsyEGVQHPLYVENKVlaDCNTRCSCLTNTWDPVCGDNGLSYMSACLA 467
Cdd:TIGR00805 401 AYFAICLSTLEYLLYSPKFLITCESAPVAGVNN--PSNDQPLYVENRT--DCNRQCSCDSSIWDPVCGDNGLAYLSPCHA 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  468 GCEKSVGMGTHMVFQNCSCIQSSGNSSAVLGLCkkGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRCIKSEEKSLG 547
Cdd:TIGR00805 477 GCRMSVGTGSNMVFTNCSCIQTPGNSSAKKGLC--DPPCATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLG 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 390979643  548 IGLHAFCTRIFAGIPAPIYFGALIDRTCLHWGTLKCGEPGACRMYNINNFRRIYLVLPAALRGSSYLPAFFILILMRK 625
Cdd:TIGR00805 555 LGLQWFCIRVFGTIPAPILFGALIDVTCLHWQTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILARK 632
 
Name Accession Description Interval E-value
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
1-625 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279 [Multi-domain]  Cd Length: 632  Bit Score: 989.62  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643    1 MGETEKRIATHGVRC------------FSKIKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIG 68
Cdd:TIGR00805   1 MGETEKDIATHESSAglkprprclqslFSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643   69 NLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSLPHFLMGRYEYETTISPTSNLSS-NSFLCMENRTQTLKPTQDPA 147
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGAGCAIMGLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSaNSFLCMENLTQTLRPTQDPS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  148 ECVKEMKSLMWIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSV 227
Cdd:TIGR00805 161 ECQKQHKSLMWLLFLVSNILRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  228 NTDDLTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKEGLQDNVDRTENDKEEKHREKAKEENRGITKDFLP 307
Cdd:TIGR00805 241 NTEDLIITPTDPRWIGAWWIGFLVCGFVALLTSIPLFFFPKTLPKEGKRVNVDVHEAEKLEKSRGEDRKKNSGITKDFPK 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  308 FMKSLSCNPIYMLLILTSVLQINAFINMFTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKA 387
Cdd:TIGR00805 321 FIKRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKA 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  388 AYMAFCLSLFEYLLSYFHFMISCDNFQVAGLTTsyEGVQHPLYVENKVlaDCNTRCSCLTNTWDPVCGDNGLSYMSACLA 467
Cdd:TIGR00805 401 AYFAICLSTLEYLLYSPKFLITCESAPVAGVNN--PSNDQPLYVENRT--DCNRQCSCDSSIWDPVCGDNGLAYLSPCHA 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  468 GCEKSVGMGTHMVFQNCSCIQSSGNSSAVLGLCkkGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRCIKSEEKSLG 547
Cdd:TIGR00805 477 GCRMSVGTGSNMVFTNCSCIQTPGNSSAKKGLC--DPPCATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLG 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 390979643  548 IGLHAFCTRIFAGIPAPIYFGALIDRTCLHWGTLKCGEPGACRMYNINNFRRIYLVLPAALRGSSYLPAFFILILMRK 625
Cdd:TIGR00805 555 LGLQWFCIRVFGTIPAPILFGALIDVTCLHWQTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILARK 632
MFS_SLCO1A_OATP1A cd17458
Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of ...
18-538 0e+00

Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1A (SLCO1A), also called Organic anion-transporting polypeptide 1A (OATP1A), subfamily is composed of one human member OATP1A2 (encoded by SLCO1A2) and several rodent proteins encoded by the Slco1a1, Slco1a3, Slco1a4, Slco1a5, and Slco1a6 genes. OATP1A2, also known as human OATP-A or OATP1, shows a broad spectrum of substrates including endogenous compounds (such as bile acids, steroid hormones and their conjugates, thyroid hormones) and various drugs (such as fexofenadine, ouabain and the cyanobacterial toxin microcystin). It is expressed in the brain, kidney, intestine, liver, lung, testes, and the eye (ciliary body). The SLCO1A/OATP1A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341016 [Multi-domain]  Cd Length: 527  Bit Score: 811.01  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  18 KIKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMG 97
Cdd:cd17458    1 KLKIFLLALSYAYVAKTLSGAYMNSMITQIERRFNIPSSLVGIINGSFEIGNLLVIAFVSYFGAKLHRPKVIGLGCLIMS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  98 LGCFLMSLPHFLMGRYEYETTISPTSNLSSNSFLCMENRTQTLKPTQDPAECVKEMKSLMWIYVLVGNIIRGIGETPIMP 177
Cdd:cd17458   81 LGCFLASLPHFLMGRYEYESTVSTTSNSSSRVPLCLANQSLSHNVTQLPSECEKESMSLMWIFVLVGNLLRGIGETPVMP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 178 LGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNI 257
Cdd:cd17458  161 LGISYIDDFSKKENSPFYIGCLHTATIVGPLLGLLLASFCAQLYVDLGSVNADDLTITPTDIRWVGAWWLGFLICAGVNF 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 258 LTSIPFFFFPKTLPKEGLQDNVDRTENDK---EEKHREKAKEENRGITKDFLPFMKSLSCNPIYMLLILTSVLQINAFIN 334
Cdd:cd17458  241 LAGLPFWFLPKSLPKEGEENETEPSKTLTvelEENKGQETKQEMYEIAKDFLPFLKSLFRNPIYMLFIIVTVLQFNAFSG 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 335 MFTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQ 414
Cdd:cd17458  321 MISFMPKYLEQQYGKSASDAIFLIGVYNLPIICLGYFFGGLYMKKFKINTYQAAHIGFWVSLLEYLLYFSAFWMGCDNSP 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 415 VAGLTTSYEGVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQSSGNSS 494
Cdd:cd17458  401 VAGLTVSYEGIDQDSYYENTLLADCNRDCDCPLKVWDPVCGNNGLTYVSACLAGCKASVGTGKNMVFQNCSCVAASGFPS 480
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*..
gi 390979643 495 AV---LGLCKKGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRC 538
Cdd:cd17458  481 QNssaVGQCDKGETCDKMLQYFLILSLVCSFIFSLAAMPGYMVLIRS 527
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
21-597 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 397311 [Multi-domain]  Cd Length: 529  Bit Score: 635.79  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643   21 MFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGC 100
Cdd:pfam03137   1 GFLVFLSLLGLAQALVSGYFNSSITTIEKRFGLPSSLSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGVGSLLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  101 FLMSLPHFLMGRyeyettisptsnlssnsflcmenrtqtlkptqdpaecvkemkslmwiyVLVGNIIRGIGETPIMPLGI 180
Cdd:pfam03137  81 LLFALPHFLSGP------------------------------------------------FFLGQLLLGIGGTPLYTLGI 112
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  181 SYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNtddLTITPTDTRWVGAWWIGFLVCAGVNILTS 260
Cdd:pfam03137 113 SYIDDNVKKKNSPLYIGILYAVRVLGPALGFLLGSLCLRIYVDIGSVS---LTLTPKDPRWVGAWWLGFLIAGLLLLLTA 189
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  261 IPFFFFPKTLPKEglQDNVDRTENDKEEKHREKAKEENRGIT-----KDFLPFMKSLSCNPIYMLLILTSVLQINAFINM 335
Cdd:pfam03137 190 IPFFFFPKSLPGT--AKRRAEKKKERESHHSIKDKEKTKSLKlgkslKDFPKALKRLLKNPVYMLLTLASVSEFLLIAGY 267
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  336 FTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQV 415
Cdd:pfam03137 268 ATFLPKYIETQFGLSASTANLLTGVVLIPGAALGILLGGLIIKKFKLSAKGLAKFNLITSLVSLLLSLLLFFLGCPNSPV 347
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  416 AGLTTSYEGVQHPLyveNKVLADCNTRCSCLTNTWDPVCGDNG--LSYMSACLAGCEKSVGMGTHMVFQNCSCI----QS 489
Cdd:pfam03137 348 AGITVPYGGTQQLS---GNLTASCNSNCSCSSSFYSPVCGSDGigYTSPCPCGAGCSSSSGAGKSTYNCSCCCScgssDS 424
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  490 SGNSSAVLGLCkkGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRCIKSEEKSLGIGLHAFCTRIFAGIPAPIYFGA 569
Cdd:pfam03137 425 GGNGSATPGKC--PSDCSNKLPLFLALLFLASFFSSLSSTPGTLVILRCVPPEDKSFALGIQFLILRLLGFIPGPIIFGA 502
                         570       580
                  ....*....|....*....|....*...
gi 390979643  570 LIDRTCLHWGTlKCGEPGACRMYNINNF 597
Cdd:pfam03137 503 LIDSTCLLWTK-TCGGRGNCWLYDNDKL 529
 
Name Accession Description Interval E-value
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
1-625 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279 [Multi-domain]  Cd Length: 632  Bit Score: 989.62  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643    1 MGETEKRIATHGVRC------------FSKIKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIG 68
Cdd:TIGR00805   1 MGETEKDIATHESSAglkprprclqslFSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643   69 NLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSLPHFLMGRYEYETTISPTSNLSS-NSFLCMENRTQTLKPTQDPA 147
Cdd:TIGR00805  81 NLLLIIFVSYFGTKLHRPIVIGAGCAIMGLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSaNSFLCMENLTQTLRPTQDPS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  148 ECVKEMKSLMWIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSV 227
Cdd:TIGR00805 161 ECQKQHKSLMWLLFLVSNILRGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  228 NTDDLTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKEGLQDNVDRTENDKEEKHREKAKEENRGITKDFLP 307
Cdd:TIGR00805 241 NTEDLIITPTDPRWIGAWWIGFLVCGFVALLTSIPLFFFPKTLPKEGKRVNVDVHEAEKLEKSRGEDRKKNSGITKDFPK 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  308 FMKSLSCNPIYMLLILTSVLQINAFINMFTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKA 387
Cdd:TIGR00805 321 FIKRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKA 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  388 AYMAFCLSLFEYLLSYFHFMISCDNFQVAGLTTsyEGVQHPLYVENKVlaDCNTRCSCLTNTWDPVCGDNGLSYMSACLA 467
Cdd:TIGR00805 401 AYFAICLSTLEYLLYSPKFLITCESAPVAGVNN--PSNDQPLYVENRT--DCNRQCSCDSSIWDPVCGDNGLAYLSPCHA 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  468 GCEKSVGMGTHMVFQNCSCIQSSGNSSAVLGLCkkGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRCIKSEEKSLG 547
Cdd:TIGR00805 477 GCRMSVGTGSNMVFTNCSCIQTPGNSSAKKGLC--DPPCATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLG 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 390979643  548 IGLHAFCTRIFAGIPAPIYFGALIDRTCLHWGTLKCGEPGACRMYNINNFRRIYLVLPAALRGSSYLPAFFILILMRK 625
Cdd:TIGR00805 555 LGLQWFCIRVFGTIPAPILFGALIDVTCLHWQTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILARK 632
MFS_SLCO1A_OATP1A cd17458
Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of ...
18-538 0e+00

Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1A (SLCO1A), also called Organic anion-transporting polypeptide 1A (OATP1A), subfamily is composed of one human member OATP1A2 (encoded by SLCO1A2) and several rodent proteins encoded by the Slco1a1, Slco1a3, Slco1a4, Slco1a5, and Slco1a6 genes. OATP1A2, also known as human OATP-A or OATP1, shows a broad spectrum of substrates including endogenous compounds (such as bile acids, steroid hormones and their conjugates, thyroid hormones) and various drugs (such as fexofenadine, ouabain and the cyanobacterial toxin microcystin). It is expressed in the brain, kidney, intestine, liver, lung, testes, and the eye (ciliary body). The SLCO1A/OATP1A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341016 [Multi-domain]  Cd Length: 527  Bit Score: 811.01  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  18 KIKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMG 97
Cdd:cd17458    1 KLKIFLLALSYAYVAKTLSGAYMNSMITQIERRFNIPSSLVGIINGSFEIGNLLVIAFVSYFGAKLHRPKVIGLGCLIMS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  98 LGCFLMSLPHFLMGRYEYETTISPTSNLSSNSFLCMENRTQTLKPTQDPAECVKEMKSLMWIYVLVGNIIRGIGETPIMP 177
Cdd:cd17458   81 LGCFLASLPHFLMGRYEYESTVSTTSNSSSRVPLCLANQSLSHNVTQLPSECEKESMSLMWIFVLVGNLLRGIGETPVMP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 178 LGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNI 257
Cdd:cd17458  161 LGISYIDDFSKKENSPFYIGCLHTATIVGPLLGLLLASFCAQLYVDLGSVNADDLTITPTDIRWVGAWWLGFLICAGVNF 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 258 LTSIPFFFFPKTLPKEGLQDNVDRTENDK---EEKHREKAKEENRGITKDFLPFMKSLSCNPIYMLLILTSVLQINAFIN 334
Cdd:cd17458  241 LAGLPFWFLPKSLPKEGEENETEPSKTLTvelEENKGQETKQEMYEIAKDFLPFLKSLFRNPIYMLFIIVTVLQFNAFSG 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 335 MFTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQ 414
Cdd:cd17458  321 MISFMPKYLEQQYGKSASDAIFLIGVYNLPIICLGYFFGGLYMKKFKINTYQAAHIGFWVSLLEYLLYFSAFWMGCDNSP 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 415 VAGLTTSYEGVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQSSGNSS 494
Cdd:cd17458  401 VAGLTVSYEGIDQDSYYENTLLADCNRDCDCPLKVWDPVCGNNGLTYVSACLAGCKASVGTGKNMVFQNCSCVAASGFPS 480
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*..
gi 390979643 495 AV---LGLCKKGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRC 538
Cdd:cd17458  481 QNssaVGQCDKGETCDKMLQYFLILSLVCSFIFSLAAMPGYMVLIRS 527
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
21-597 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 397311 [Multi-domain]  Cd Length: 529  Bit Score: 635.79  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643   21 MFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGC 100
Cdd:pfam03137   1 GFLVFLSLLGLAQALVSGYFNSSITTIEKRFGLPSSLSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGVGSLLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  101 FLMSLPHFLMGRyeyettisptsnlssnsflcmenrtqtlkptqdpaecvkemkslmwiyVLVGNIIRGIGETPIMPLGI 180
Cdd:pfam03137  81 LLFALPHFLSGP------------------------------------------------FFLGQLLLGIGGTPLYTLGI 112
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  181 SYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNtddLTITPTDTRWVGAWWIGFLVCAGVNILTS 260
Cdd:pfam03137 113 SYIDDNVKKKNSPLYIGILYAVRVLGPALGFLLGSLCLRIYVDIGSVS---LTLTPKDPRWVGAWWLGFLIAGLLLLLTA 189
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  261 IPFFFFPKTLPKEglQDNVDRTENDKEEKHREKAKEENRGIT-----KDFLPFMKSLSCNPIYMLLILTSVLQINAFINM 335
Cdd:pfam03137 190 IPFFFFPKSLPGT--AKRRAEKKKERESHHSIKDKEKTKSLKlgkslKDFPKALKRLLKNPVYMLLTLASVSEFLLIAGY 267
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  336 FTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQV 415
Cdd:pfam03137 268 ATFLPKYIETQFGLSASTANLLTGVVLIPGAALGILLGGLIIKKFKLSAKGLAKFNLITSLVSLLLSLLLFFLGCPNSPV 347
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  416 AGLTTSYEGVQHPLyveNKVLADCNTRCSCLTNTWDPVCGDNG--LSYMSACLAGCEKSVGMGTHMVFQNCSCI----QS 489
Cdd:pfam03137 348 AGITVPYGGTQQLS---GNLTASCNSNCSCSSSFYSPVCGSDGigYTSPCPCGAGCSSSSGAGKSTYNCSCCCScgssDS 424
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  490 SGNSSAVLGLCkkGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRCIKSEEKSLGIGLHAFCTRIFAGIPAPIYFGA 569
Cdd:pfam03137 425 GGNGSATPGKC--PSDCSNKLPLFLALLFLASFFSSLSSTPGTLVILRCVPPEDKSFALGIQFLILRLLGFIPGPIIFGA 502
                         570       580
                  ....*....|....*....|....*...
gi 390979643  570 LIDRTCLHWGTlKCGEPGACRMYNINNF 597
Cdd:pfam03137 503 LIDSTCLLWTK-TCGGRGNCWLYDNDKL 529
MFS_SLCO1C_OATP1C cd17459
Solute carrier organic anion transporter 1C subfamily of the Major Facilitator Superfamily of ...
19-538 0e+00

Solute carrier organic anion transporter 1C subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1C (SLCO1C), also called Organic anion-transporting polypeptide 1C (OATP1C), subfamily contains one mammalian member, OATP1C1 (encoded by SLCO1C1), which is also called thyroxine transporter. It mediates the high affinity transport of the thyroid hormones, T4 (3,5,3',5'tetraiodo-L-thyronine or thyroxine), rT3 (3,3'5'-triiodo-L-thyronine), and T3 (3,5,3'tri-iodo-L-thyronine or triiodothyronine), as well as organic anions such as 17-beta-glucuronosyl estradiol, estrone-3-sulfate, and sulfobromophthalein (BSP), which are transported with much lower efficiency. The SLCO1C/OATP1C subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341017 [Multi-domain]  Cd Length: 498  Bit Score: 627.57  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  19 IKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGL 98
Cdd:cd17459    1 LKIFLAALSFAYFAKALSGSYMKSTITQIERRFDIPSSLIGVIDGSFEMGNLLVIAFVSYFGAKLHRPRIIGAGCLLMAI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  99 GCFLMSLPHFLMGRYEYETTISPTSNLSSNSFLCMENRTQTLKP-----TQDPAECVKEMKSLMWIYVLVGNIIRGIGET 173
Cdd:cd17459   81 GTFLIALPHFFMGRYKYETAIQSSSNSTVSISPCSLEPSPQLHSiessdSKTGTGCEKEPGSSMWIYVFLGNLLRGIGET 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 174 PIMPLGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCA 253
Cdd:cd17459  161 PVQPLGISYIDDFAKEENAAFYIGCVQTIAIIGPVFGFLLGSLCAKLYVDIGFVNLDSITITPKDARWVGAWWLGYLIAG 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 254 GVNILTSIPFFFFPKTLPkeglqdnvdrtendkeekhrekakeenrgitKDFLPFMKSLSCNPIYMLLILTSVLQINAFI 333
Cdd:cd17459  241 VITLLSAVPFWFLPKSLP-------------------------------KDFLPSLKNLLGNPVYFLYLCTSILQFNSLI 289
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 334 NMFTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNF 413
Cdd:cd17459  290 GMVTYKPKYIEQQYGQSASKANFLIGLINIPAVAIGIFSGGLLMKKFKLSVIGAAKLSFGTSFFGYLLLLSFFAMGCENS 369
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 414 QVAGLTTSYEGVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCI----QS 489
Cdd:cd17459  370 DVAGLTVSYNGTKQVSYADRSLFSQCNADCKCSQKDWDPVCGENGITYVSPCLAGCKASNGSGKNTVFHNCSCIgipsSA 449
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*....
gi 390979643 490 SGNSSAVLGLCKKGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRC 538
Cdd:cd17459  450 SGSSSAILGQCPKGNACARMFLYFLAISVISSFTLSLGGTPGYILLIRC 498
MFS_SLCO1_OATP1 cd17400
Solute carrier organic anion transporter 1 family of the Major Facilitator Superfamily of ...
19-537 0e+00

Solute carrier organic anion transporter 1 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1 (SLCO1) or Organic anion transporting polypeptide 1 (OATP1) family contains three subfamilies: OATP1A, OATP1B, and OATP1C. OATP1A contains one human member, OATP1A2, which shows a broad spectrum of substrates including endogenous compounds (such as bile acids, steroid hormones and their conjugates, thyroid hormones) and various drugs (such as fexofenadine, ouabain and the cyanobacterial toxin microcystin). OATP1B contains two human proteins, OATP1B1 and OATP1B3, which can both accept a wide variety of structurally-unrelated compounds as substrates including clinically-important drugs such as hydroxymethylglutaryl (HMG)-CoA reductase inhibitors (statins), angiotensin II receptor blockers (sartans), angiotensin converting enzyme (ACE) inhibitors, and anti-diabetes drugs (glinides). OATP1C contains one mammalian member, OATP1C1, which is also called thyroxine transporter. It mediates the high affinity transport of the thyroid hormones, T4 (3,5,3',5'tetraiodo-L-thyronine or thyroxine), rT3 (3,3'5'-triiodo-L-thyronine), and T3 (3,5,3'tri-iodo-L-thyronine or triiodothyronine). The SLCO1/OATP1 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340958 [Multi-domain]  Cd Length: 436  Bit Score: 597.20  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  19 IKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGL 98
Cdd:cd17400    1 LKMFLLALSCAFVAKTLSGSYMKSMITQIERRFNIPSSLVGFIDGSFEIGNLLVIIFVSYFGTKLHRPKMIGIGCVIMGL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  99 GCFLMSLPHFLMGRYEYettisptsnlssnsflcmenrtqtlkptqdpaecvkemkSLMWIYVLVGNIIRGIGETPIMPL 178
Cdd:cd17400   81 GCFLKALPHFFMNQYEY---------------------------------------SLMWIYVFVGNILRGIGETPILPL 121
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 179 GISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNIL 258
Cdd:cd17400  122 GISYIDDFAKEENSPLYIGLVETGAIIGPIIGFLLGSLCAKVYVDIGFVNLDDIIITPTDTRWVGAWWLGFLICGGVSVL 201
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 259 TSIPFFFFPktlpkeglqdnvdrtendkeekhrekakeenrgitkdflpfmkslscnPIYMLLILTSVLQINAFINMFTF 338
Cdd:cd17400  202 TAIPFFFLP------------------------------------------------PIYMLFILVSVIQFNSFVGMITY 233
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 339 LPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGL 418
Cdd:cd17400  234 MPKYLEQQYGQSSSDANFLMGIINIPPIAIGYFIGGLIMKKFKITVKGAAKIGCWLSVLEYLLYLLSFLMTCENSSVAGL 313
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 419 TTSYEGVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQSSGNSSAVLG 498
Cdd:cd17400  314 TTSYEGIPPVLYHENDIFSDCNSDCNCPEKIWEPVCGNNGITYLSACLAGCETSIGTGKNIVFYNCSCIQTSGNSSANLS 393
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|...
gi 390979643 499 L----CKKGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLR 537
Cdd:cd17400  394 LcdggCPRDPDCSLMFQYFLIISVMSSFIYSLGGIPGYMLLLR 436
MFS_SLCO1B_OATP1B cd17457
Solute carrier organic anion transporter 1B subfamily of the Major Facilitator Superfamily of ...
19-537 1.24e-178

Solute carrier organic anion transporter 1B subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1B (SLCO1B), also called organic anion-transporting polypeptide 1B (OATP1B), subfamily is composed of two human proteins, OATP1B1 (encoded by SLCO1B1) and OATP1B3 (encoded by SLCO1B3), and one rodent member, OATP1B2 (encoded by Slco1b2). OATP1B1 and OATP1B3 are almost exclusively expressed on the basal side of hepatocytes in normal human organs. They both can accept a wide variety of structurally-unrelated compounds as substrates including clinically-important drugs such as hydroxymethylglutaryl (HMG)-CoA reductase inhibitors (statins), angiotensin II receptor blockers (sartans), angiotensin converting enzyme (ACE) inhibitors, and anti-diabetes drugs (glinides). Loss-of-function mutations in both SLCO1B1 and SLCO1B3 genes result in the Rotor syndrome, a hereditary hyperbilirubinemia. The SLCO1B/OATP1B subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341015 [Multi-domain]  Cd Length: 455  Bit Score: 515.55  E-value: 1.24e-178
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  19 IKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGL 98
Cdd:cd17457    1 LKMFLAALSFSYFAKALSGIIMKSSITQIERRFDISSSTVGFIDGSFEIGNLLVIAFVSYFGAKLHRPKLIAAGCFIMGL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  99 GCFLMSLPHFLMGRYEYEttisptsnlssnsflcmenrtqtlkptqdpaeCVKEMKSLMWIYVLVGNIIRGIGETPIMPL 178
Cdd:cd17457   81 GSVLTALPHFFMGYYKYG--------------------------------CLKESGSYMWVYVLMGNMLRGIGETPIVPL 128
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 179 GISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNIL 258
Cdd:cd17457  129 GISYLDDFAKEENSPLYLACLHTIAMIGPMIGFTLGSLFAKLYVDIGFVDLSTIRITPQDSRWVGAWWLGFLVSGLFSII 208
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 259 TSIPFFFFPktlpkeglqdnvdrtendkeekhrekakeenrgitkDFLPFMKSLSCNPIYMLLILTSVLQINAFINMFTF 338
Cdd:cd17457  209 SAIPFFFLP------------------------------------GFFQSLKSILTNRLYVMFVCLTLLQVSSFIGFFTY 252
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 339 LPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGL 418
Cdd:cd17457  253 KPKYMEQQYGQSSSKANFLLGVITLPIFASGMFLGGYIMKKYKLNTVGAAKFACFTSVMALSFYLLYFFIGCENKSVAGI 332
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 419 TTSYEGVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQSSG----NSS 494
Cdd:cd17457  333 TMTYDGNNPVTSHRDVILSYCNSDCNCDESQWDPVCGNNGITYISACLAGCKSSSGNGKPIVFHNCSCLEVTGsqnrNYS 412
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|...
gi 390979643 495 AVLGLCKKGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLR 537
Cdd:cd17457  413 AHLGECPRDDDCSRMFYFYVVIQVLNLFFSALGGTSAYMLIVK 455
MFS_SLCO_OATP cd17336
Solute carrier organic anion transporters of the Major Facilitator Superfamily of transporters; ...
19-537 1.77e-146

Solute carrier organic anion transporters of the Major Facilitator Superfamily of transporters; Solute carrier organic anion transporters (SLCOs) are also called organic anion transporting polypeptides (OATPs) or SLC21 (Solute carrier family 21) proteins. They are sodium-independent transporters that mediate the transport of a broad range of endo- as well as xenobiotics. Their substrates are mainly amphipathic organic anions with a molecular weight of more than 300Da, although there are a few known neutral or positively charged substrates. These include drugs including statins, angiotensin-converting enzyme inhibitors, angiotensin receptor blockers, antibiotics, antihistaminics, antihypertensives, and anticancer drugs. SLCOs/OATPs can be classified into 6 families (SLCO1-6 or OATP1-6) and each family may have subfamilies (e.g. OATP1A, OATP1B, OATP1C). Within the subfamilies, individual members are numbered according to the chronology of their identification and if there is already an ortholog known, they are given the same number. For example, the first SLCO identified, is rat OATP1A1 (encoded by the Slco1a1 gene). The second SLCO identified is the first human SLCO from the same subfamily and is called OATP1A2 (encoded by the SLCO1A2 gene). There are 11 human SLCOs/OATPs. SLCOs belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340894 [Multi-domain]  Cd Length: 411  Bit Score: 431.66  E-value: 1.77e-146
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  19 IKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGL 98
Cdd:cd17336    1 PKVFVVLLCLLGLLQGAVVSYFVSTITTIEKRFGLSSSQSGLILSANDIGQLLAVLLVSYFGGRGHRPRWIGIGSILMGL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  99 GCFLMSLPHFLmgryeyettisptsnlssnsflcmenrtqtlkptqdpaecvkemkslmwiyvLVGNIIRGIGETPIMPL 178
Cdd:cd17336   81 GCFLLALPHFL----------------------------------------------------FVGQFLLGIGSSPLYTL 108
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 179 GISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVntdDLTITPTDTRWVGAWWIGFLVCAGVNIL 258
Cdd:cd17336  109 GITYIDDNVSKKNSPLYIGILYAMRVLGPALGFLLGSFLLRIYVDFSRV---PLGITPDDPRWIGAWWLGFLILGILLLI 185
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 259 TSIPFFFFPktlpkeglqdnvdrtendkeekhrekakeenrgitkdflpfmkslscnPIYMLLILTSVLQINAFINMFTF 338
Cdd:cd17336  186 VSIPLFFFP------------------------------------------------PIFILLLLAIVFESFAISGFSTF 217
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 339 LPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGL 418
Cdd:cd17336  218 LPKYLETQFRLSASLASLLTGLILVPGAALGILLGGLIIKKFKLTARGLAKFVLILSLLSVILYISLFFLGCDNPPIAGV 297
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 419 TTSYEGVQHPlyvenkVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQS-SGNSSAVL 497
Cdd:cd17336  298 TTPYGSSSSP------ITSSCNSDCNCSDSSFSPVCGSDGITYFSPCHAGCTSSDAGNGTKTYSNCSCINSgTATSSGCP 371
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|
gi 390979643 498 GLCKKGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLR 537
Cdd:cd17336  372 PDCSVAPNCCSKLIPFLAVLFLSSFLLSLSIVPSTMITLR 411
MFS_SLCO2A_OATP2A cd17461
Solute carrier organic anion transporter 2A subfamily of the Major Facilitator Superfamily of ...
19-537 2.15e-110

Solute carrier organic anion transporter 2A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2A (SLCO2A), also called Organic anion-transporting polypeptide 2A (OATP2A), subfamily has one mammalian member, OATP2A1 (encoded by SLCO2A1), which is also called prostaglandin transporter. It is a lactate/prostaglandin anion exchanger that mediates the release of newly synthesized prostaglandins (PGD2, PGE1, PGE2, PGF2A and PGI2) from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. Mutations in SLCO2A1 can cause primary hypertrophic osteoarthropathy (PHO), a rare multi-organic disease characterized by digital clubbing, pachydermia and periosteal reaction. The SLCO2A/OATP2A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341019 [Multi-domain]  Cd Length: 474  Bit Score: 341.40  E-value: 2.15e-110
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  19 IKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGL 98
Cdd:cd17461    2 IKVFVLCHGLLQLSQLLYSAYFKSSLTTIEKRFGLSSLSSGLISSLHEIGNAVLIIFVSYFGSRVHRPRLIGIGGLLLAL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  99 GCFLMSLPHFLMGRYEYEttisptsnlssnsflcmenrtqtlkptqdpaecvkemkslMWIYVLVGNIIRGIGETPIMPL 178
Cdd:cd17461   82 GAFLLTLPHFLSEPYQYS----------------------------------------MWVLMVVAQLLAGIGTVPIQPF 121
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 179 GISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNIL 258
Cdd:cd17461  122 GISYVDDFAEPSNSPLYIAILFAISVFGPAFGYLLGSVVLRIFVDIGRVNTATVELTPADPRWIGAWWLGLLISSGLLVL 201
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 259 TSIPFFFFPKTLPKEGLQDnvdrTENDKEEKHREKAKEENR--GITKDFLPFMKSLSCNPIYMLLILTSVLQINAFINMF 336
Cdd:cd17461  202 TSLPYFFFPREMLVGKKPS----PEGDMLRKKEDEKKEEGSllDFIKRFPKMFVKLLLNPLFMLLVLAQCTFSSVIAGLS 277
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 337 TFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVA 416
Cdd:cd17461  278 TFLNKFLEKQYGASASYANFLIGAVNLPAAALGMLLGGIIMKRFGFSLRAIPRFSVVILSISIMLCVPLFFMGCSTQDVA 357
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 417 GLTTSYE-GVQHPlyvenkvLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVgMGTH----MVFQNCSCIQS-S 490
Cdd:cd17461  358 GVYPKTSnSSDGP-------HLSCSANCSCPESAFNPVCGENGIEYISPCHAGCTNSN-MDSStyrqQIYSNCSCIPDlS 429
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*..
gi 390979643 491 GNSSAVLGLCKKgpECANKLQYFLIMSVIGSFIYSITAIPGYMVLLR 537
Cdd:cd17461  430 GEKPAKTGSCPN--SCSHLLLPVMFLISFAGLIACLTHNPLYMMVLR 474
MFS_SLCO2B_OATP2B cd17460
Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of ...
19-537 1.20e-103

Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2B (SLCO2B), also called Organic anion-transporting polypeptide 2B (OATP2B), subfamily has one mammalian member, OATP2B1 (encoded by SLCO2B1). It mediates the Na(+)-independent transport of various organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost. It also mediates the transport of endogenous sex steroid conjugates such as dehydroepiandrosterone sulfate (DHEAS). SLCO2B1 variations result in differential expression and uptake of DHEAS, which impacts subsequent resistance to androgen-deprivation therapy (ADT), the primary treatment of metastatic prostate cancer. The SLCO2B/OATP2B subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341018 [Multi-domain]  Cd Length: 479  Bit Score: 324.03  E-value: 1.20e-103
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  19 IKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGL 98
Cdd:cd17460    1 IKFFVLCHGLLQLSQLLVSGYLKSSISTIEKRFGLSSQTSGLLASFNEVGNTVLIVFVSYFGSRVHRPRFIGCGAILVSL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  99 GCFLMSLPHFLMGRYEYettisptsnlssnsflcmenrtqtlkptqdpaecvkemkslmwIYVLVGNIIRGIGETPIMPL 178
Cdd:cd17460   81 AGFLMALPHFISEPYEY-------------------------------------------GILFLGQLLLGIGGVPIQPF 117
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 179 GISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNIL 258
Cdd:cd17460  118 GISYIDDFASESNSPLYLGILFAVTVLGPGFGFMLGSAMLRFYVDIDKMSEDEISLEIGDPRWVGAWWLGFLIAATLVAL 197
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 259 TSIPFFFFPKTLPKEGLQDNVDRTENDKEEKHREKAK-EENRGITkdFLPFMKSLSC-------NPIYMLLILTSVLQIN 330
Cdd:cd17460  198 SAVPYFFFPREMPKEVVELQPREKKLAKTMLKKLKSLsDILQNLS--LLQFIKKFPRillrtlrNPIYLLVVLAQVNLSA 275
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 331 AFINMFTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISC 410
Cdd:cd17460  276 MVAGLATFMGKFLERQFSITASFANLMIGGLNIPSAMVGIVVGGVILKRLQLTVRGCGAMCVLGMLLCLFFALPLLFIGC 355
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 411 DNFQVAGLTtsYEGVQHPlyvENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCeKSV----GMGTHMVFQNCSC 486
Cdd:cd17460  356 STQKIAGIT--HRTSSSP---GLELSSQCSEACSCPPEAFNPVCGSDGVEYISPCHAGC-KSVnvqaLDNSVVNYTDCSC 429
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|..
gi 390979643 487 IQSSGN-SSAVLGLCkkGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLR 537
Cdd:cd17460  430 VSEGGPvGAASPGTC--GSGCSHLLVPFMLLVSLGGFLASLSHTPSFMLILR 479
MFS_SLCO2_OATP2 cd17401
Solute carrier organic anion transporter 2 family of the Major Facilitator Superfamily of ...
19-537 2.95e-96

Solute carrier organic anion transporter 2 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2 (SLCO2) or Organic anion transporting polypeptide 2 (OATP2) family contains two subfamilies: OATP2A and OATP2B, each containing one mammalian member, OATP2A1 and OATP2B1, respectively. OATP2A1 (encoded by SLCO2A1) is a lactate/prostaglandin anion exchanger that mediates the release of newly synthesized prostaglandins (PGD2, PGE1, PGE2, PGF2A and PGI2) from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. OATP2B1 (encoded by SLCO2B1) mediates the Na(+)-independent transport of various organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost, as well as endogenous sex steroid conjugates such as dehydroepiandrosterone sulfate (DHEAS). The SLCO2/OATP2 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340959 [Multi-domain]  Cd Length: 440  Bit Score: 303.31  E-value: 2.95e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  19 IKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGL 98
Cdd:cd17401    1 IKVFVLCHGLLQLCQLLYSGYLKSSITTIEKRFGLSSSSSGLLASFNEVGNTILIVFVSYFGSRVHRPRLIGIGGLFLAA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  99 GCFLMSLPHFLMGRYEYettisptsnlssnsflcmenrtqtlkptqdpaecvkemkSLMwiyvLVGNIIRGIGETPIMPL 178
Cdd:cd17401   81 GAFLLTLPHFISEPYQY---------------------------------------GIM----VVAQLLLGIGGVPIQPF 117
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 179 GISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNIL 258
Cdd:cd17401  118 GISYIDDFAEPSNSPLYLGILFAVTVFGPAFGYLLGSVMLRLYVDIGRMNTAAVNLVPGDPRWIGAWWLGFLIAAALLVL 197
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 259 TSIPFFFFPKTLpkeglqdnvdrtendkeekhrekakeenrgitKDFLPFMKSLSCNPIYMLLILTSVLQINAFINMFTF 338
Cdd:cd17401  198 TSFPYFFFPRFI--------------------------------KRFPCIFLRTLRNPIFLLVVLAQVTLSSMIAGLATF 245
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 339 LPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGL 418
Cdd:cd17401  246 LNKFLEKQFGTTASYANFLIGAVNLPSAALGILFGGVLMKRLVLSLQAIPAICTTIITISMIFCVPLFFIGCSTPTIAGV 325
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 419 TtsYEGVQHPLYVENkvlADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCE----KSVGMGTHMVFQNCSCIqSSGNSS 494
Cdd:cd17401  326 Y--PPSSSSSIHPQS---PACRRDCSCPDSIFNPVCGDNGVEYLSPCHAGCSninmSTSATSKQVIYTNCSCV-TGGSAS 399
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|...
gi 390979643 495 AVLGLCKKGpeCANKLQYFLIMSVIGSFIYSITAIPGYMVLLR 537
Cdd:cd17401  400 AKTGSCPSP--CSHLLLPFIFLISLVSLIACLSHTPSFMMILR 440
MFS_SLCO5_OATP5 cd17404
Solute carrier organic anion transporter 5 family of the Major Facilitator Superfamily of ...
20-537 6.44e-95

Solute carrier organic anion transporter 5 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 5 (SLCO5) or Organic anion transporting polypeptide 5 (OATP5) family contains only one subfamily, OATP5A, which contains only one mammalian member OATP5A1 (encoded by SLCO5A1). Deletion of the SLCO5A1 gene has been implicated in the pathogenesis of Mesomelia-synostoses syndrome (MSS), a rare autosomal-dominant disorder characterized by mesomelic limb shortening, acral synostoses, and multiple congenital malformations. OATP5A1 may be a non-classical OATP which is involved in biological processes that require the reorganization of the cell shape, such as differentiation and migration. It seems to affect intracellular transport of drugs and may participate in chemoresistance of small cell lung cancer (SCLC by sequestration), rather than mediating cellular uptake. The SLCO5/OATP5 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340962 [Multi-domain]  Cd Length: 425  Bit Score: 299.27  E-value: 6.44e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  20 KMFLLALTC-AYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGL 98
Cdd:cd17404    1 KAFLVCMCLlIFIQSALSSGYLNSVITTIEKRYSLKSSESGLIVSSYEIGSLLTVVFVSYFGGRGHRPRWIAVGGVLIAL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  99 GCFLMSLPHFLMgryeyettisptsnlssnsflcmenrtqtlkptqdpaecvkemkslmwiyvlVGNIIRGIGETPIMPL 178
Cdd:cd17404   81 GSFLFSLPHFFI----------------------------------------------------LAQILIGMGGTPIFTL 108
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 179 GISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVntdDLTITPTDTRWVGAWWIGFLVCAGVNIL 258
Cdd:cd17404  109 GTTYLDDHVKKESSSLYLAIMYVMGALGPAAGFLLGGLLINFYVDPLST---PPDISPGDPRWIGAWWGGFLLCGIALLL 185
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 259 TSIPFFFFPKtlpkeglqdnvdrtendkeekhrekakeenrgitkdflpfmkslscnPIYMLLILTSVLQINAFINMFTF 338
Cdd:cd17404  186 VAFPFFTFPK-----------------------------------------------MTFLVVSLGYCMELAIVSGFITF 218
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 339 LPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGL 418
Cdd:cd17404  219 LPKYLETQFGIPASNANIFTGVIAVPGAGIGIVLGGYILKRFKLGPKGAAKLALICNFLSLLLFLTLFFLGCESIKLAGI 298
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 419 TTSY-EGVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMV-FQNCSCIQSSGNSS-- 494
Cdd:cd17404  299 TIPYtTGPSLSSTHGRNLTSECNVNCGCSINEYEPVCGSDGITYFSPCLAGCTSVGNTSTGIRnYTNCACLQSRSSISpp 378
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*..
gi 390979643 495 --AVLGLCKKGP--ECANKLQYFLIMSVIGSFIYSITAIPGYMVLLR 537
Cdd:cd17404  379 tvGQGSQLQAGPcsRTCNTLIPFLILLFIVTLITACAQMPALMITLR 425
MFS_SLCO4_OATP4 cd17403
Solute carrier organic anion transporter 4 family of the Major Facilitator Superfamily of ...
19-537 1.33e-93

Solute carrier organic anion transporter 4 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4 (SLCO4) or Organic anion transporting polypeptide 4 (OATP4) family contains two families: OATP4A and OATP4C, each containing one mammalian member, OATP4A1 and OATP4C1, respectively. OATP4A1 (encoded by SLCO4A1), is ubiquitously expressed and mediates the Na(+)-independent transport of the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and other organic anions such as estrone sulfate and taurocholate. OATP4C1 (encoded by SLCO4C1) is capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate, cAMP, and uremic toxins, which accumulate in patients with chronic kidney diseases (CKDs). The SLCO4/OATP4 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340961 [Multi-domain]  Cd Length: 420  Bit Score: 295.70  E-value: 1.33e-93
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  19 IKMFLLALtCAYV---SKSLSGIYmNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVI 95
Cdd:cd17403    1 PKGFLFFL-CIFAflqGMVVNGFV-NVSITTIEKRFGLTSTQTGLIASSYDIASVLLLLFVSYFGGRGHKPRWLGIGAFI 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  96 MGLGCFLMSLPHFLMgryeyettisptsnlssnsflcmenrtqtlkptqdpaecvkemkslmwiyVLVGNIIRGIGETPI 175
Cdd:cd17403   79 MGIGSLVFALPHFTV--------------------------------------------------FILAQLLHGAGATPL 108
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 176 MPLGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVnTDDLTITPTDTRWVGAWWIGFLVCAGV 255
Cdd:cd17403  109 YTLGVTYLDENVSTKMSPLYIGIFYAMAILGPAIGYVLGGFLLNLYTDIDQV-DSELGLTPDDPRWVGAWWLGFLISGAL 187
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 256 NILTSIPFFFFPKTlpkeglqdnvdrtendkeekhrekakeenrgitkdflpfmkslscnpiYMLLILTSVLQINAFINM 335
Cdd:cd17403  188 ALIIAFPLLGFPPT------------------------------------------------FMFLNLAGASEGMLLAGF 219
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 336 FTFLPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFhFMISCDNFQV 415
Cdd:cd17403  220 ATFLPKLIESQFSLSASLAALLVGVVVVPGGILGTFLGGLIVKKLKLKCKGILKFCIVCSIVAFLFSFI-LLIYCPNAPF 298
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 416 AGLTTSYEGvqHPLYVENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQS---SGN 492
Cdd:cd17403  299 AGVTVPYGN--SPLEGTSNLTSTCNADCHCSEDFYDPVCGSDGVTYYSPCHAGCTTSHGDDGQKVYSNCSCIQSnssKTS 376
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*
gi 390979643 493 SSAVLGLCKKGPECANKLQYFLIMSVIGSFIYSITaIPGYMVLLR 537
Cdd:cd17403  377 TAATGKACPCETCCQKLYLFLAVFFLLIVFTFMSS-TPALSATLR 420
MFS_SLCO3_OATP3 cd17402
Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of ...
19-537 7.79e-93

Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 3 (SLCO3) or Organic anion transporting polypeptide 3 (OATP3) family contains only one subfamily, OATP3A, which contains only one mammalian member OATP3A1 (encoded by SLCO3A1). It mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate, prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123, and vasopressin. SLCO3A1 has been identified as a Crohn's disease (CD)-associated gene, which mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation, resulting in a higher incidence of bowel perforation in CD patients. The SLCO3/OATP3 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340960 [Multi-domain]  Cd Length: 444  Bit Score: 294.53  E-value: 7.79e-93
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  19 IKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGL 98
Cdd:cd17402    1 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  99 GCFLMSLPHFLMGRYEyettisptsnlssnsflcmenrtqtlkptqdpaecvkemKSLMWIYVLVGNIIRGIGETPIMPL 178
Cdd:cd17402   81 GALLSALPEFLTHQYK---------------------------------------TNMMYLLLIGAQVLLGIGATPVQPL 121
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 179 GISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNIL 258
Cdd:cd17402  122 GVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSKLDITPDDPRWIGAWWGGFLLCGALLFF 201
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 259 TSIPFFFFPKTLpkeglqdnvdrtendkeekhrekakEENRGITKdflpFMKSLSCNPIYMLLILTSVLQINAFINMFTF 338
Cdd:cd17402  202 SALLMFGFPQSL-------------------------QQLRVIPK----VTKHLLSNPVFTCIVLAACMEIAVVAGFAAF 252
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 339 LPKYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGL 418
Cdd:cd17402  253 LGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGCDTGPVAGV 332
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 419 TTSYEGVQHPLYVENKvLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCeksvgmgTHMVFQNCSCIQS--SGNSSAV 496
Cdd:cd17402  333 TVPYGNDTAPGSSLDP-YAPCNSNCECQTDSFSPVCGADGITYLSACFAGC-------SSTNLSGCACLSSvpAENATVV 404
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|.
gi 390979643 497 LGLCKKgPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLR 537
Cdd:cd17402  405 PGKCPS-PGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIR 444
MFS_SLCO4A_OATP4A cd17462
Solute carrier organic anion transporter 4A subfamily of the Major Facilitator Superfamily of ...
39-529 2.85e-73

Solute carrier organic anion transporter 4A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4A (SLCO4A), also called Organic anion-transporting polypeptide 4A (OATP4A), subfamily has one mammalian member, OATP4A1 (encoded by SLCO4A1). It is ubiquitously expressed and it mediates the Na(+)-independent transport of the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and other organic anions such as estrone sulfate and taurocholate. OATP4A1 is the most abundantly expressed transporter colorectal cancer (CRC) and its role in the transport of estrone sulfate, which is used in hormone replacement therapy (HRT), affects the outcome of the treatment. The SLCO4A/OATP4A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341020 [Multi-domain]  Cd Length: 427  Bit Score: 242.82  E-value: 2.85e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  39 YMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSLPHFLMgryeyett 118
Cdd:cd17462   22 FINTVITSIERRFDLRSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLIMGLGSLVFALPHFTV-------- 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 119 isptsnlssnsflcmenrtqtlkptqdpaecvkemkslmwiyVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGI 198
Cdd:cd17462   94 ------------------------------------------FMLGQFLHGIGATPLYTLGVTYLDENVKSNYSPVYIGI 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 199 LESGKMIGPIVGLLLGSFCARIYVDTGSvNTDdltITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPkeglqdn 278
Cdd:cd17462  132 FYTAAIVGPAAGYLLGGFFLNIYTEIGR-QTE---LTPENPLWVGAWWIGFLGAGAAALLIALPILGYPRQLP------- 200
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 279 vdrtendkeekhrekakeenrGITKdflpfmkslscNPIYMLLILTSVLQINAFINMFTFLPKYLEQQYGKSTSEVVLLI 358
Cdd:cd17462  201 ---------------------GLLK-----------NPTFIFLCLAGATEATLIAGMSTFGPKFLESQFSLSASEAATLF 248
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 359 GVCNLPPICIGYLLIGFIMKKFRItvKKAAYMAFCL-SLFEYLLSYFHFMISCDNFQVAGLTTSYEGVQHPLYVENkVLA 437
Cdd:cd17462  249 GYLVVPAGGGGTFLGGFIVNKLKL--RCSGIIKFCLiCTVVSLLAIFIFSLHCPNVPMAGVTASYRGSVLPEGSLN-LTA 325
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 438 DCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEK--SVGMGTHMVFQNCSCI-QSSGNSSAVLGLCKKGPECANK--LQY 512
Cdd:cd17462  326 LCNADCRCLEEIYSPVCGADGLMYYSPCHAGCSEaySDIRNGQKVYQDCSCVaGNLSVGFGEASAGKCTSNCNHMplLLA 405
                        490
                 ....*....|....*..
gi 390979643 513 FLIMSVIGSFIYSITAI 529
Cdd:cd17462  406 FVFLVILFTFLCSIPAL 422
MFS_SLCO4C_OATP4C cd17463
Solute carrier organic anion transporter 4C subfamily of the Major Facilitator Superfamily of ...
23-537 2.27e-67

Solute carrier organic anion transporter 4C subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4C (SLCO4C), also called Organic anion-transporting polypeptide 4C (OATP4C), subfamily has one mammalian member, OATP4C1 (encoded by SLCO4C1). It is capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate and cAMP. It is the only OATP expressed at the basolateral side of proximal tubular cells in human kidney and it mediates the excretion of uremic toxins, which accumulate in patients with chronic kidney diseases (CKDs) and cause further progression of renal damage and cardiovascular diseases. Overexpression of human SLCO4C1 in rat kidney promotes the renal excretion of uremic toxins and reduces hypertension, cardiomegaly, and renal inflammation in renal failure. The SLCO4C/OATP4C subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341021 [Multi-domain]  Cd Length: 429  Bit Score: 226.93  E-value: 2.27e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  23 LLALTCAYVSKSLsgiyMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFL 102
Cdd:cd17463   10 LLAVVQGIVVNGL----VNISISTIEKRYELSSSLTGLISSSYDISFCLLSLFVSFYGERGHKPRWLAFSAFMIGLGSLV 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 103 MSLPHFLmgryeyettisptsnlssnsflcmenrtqtlkptqdpaecvkemkslmwIYVLvGNIIRGIGETPIMPLGISY 182
Cdd:cd17463   86 FSLPHFF-------------------------------------------------VFIL-GQLLLGVGGTPLYTLGTAY 115
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 183 IEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTitPTDTRWVGAWWIGFLVCAGVNILTSIP 262
Cdd:cd17463  116 IDDSVPTHKSSLYIGIGYGMSVLGPAIGYLLGGQLLNIYIDVNKGQSVDLT--EEDPRWLGAWWIGFLMCWLIAWCLIAP 193
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 263 FFFFPKTLPkeglqdnvdrtendkeekhrekakeenrGITKdflpfmkslscNPIYMLLILTSVLQINAFINMFTFLPKY 342
Cdd:cd17463  194 FSCFPKHLP----------------------------GLLK-----------NPVFMCLTISSCSEALITTGFATFLPKF 234
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 343 LEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGLTTSY 422
Cdd:cd17463  235 IENQFGQTSSFAAILGGLVLIPGAAIGQILGGIIVSKFKLKCKNMIKFAIITTTVSLLLLSVFIFAKCGNDPFAGVSETY 314
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 423 EGVQHplyvENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQS-SGNSSAVLGLCK 501
Cdd:cd17463  315 NGTGK----IGNLTAPCNANCSCLSSFYYPVCGADGVQYFSPCFAGCTNENLHDKKKVYYNCSCIGNfTEEFSANTTKCE 390
                        490       500       510
                 ....*....|....*....|....*....|....*....
gi 390979643 502 KGPECA---NKLQYFLIMSVIGSFIYSITAIPGYMVLLR 537
Cdd:cd17463  391 EGKKCEttcKNLPIFLCFFFFVVIFTFMTSTPITVAILR 429
MFS_SLCO6_OATP6 cd17405
Solute carrier organic anion transporter 6 family of the Major Facilitator Superfamily of ...
48-488 1.46e-37

Solute carrier organic anion transporter 6 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 6 (SLCO6) or Organic anion transporting polypeptide 6 (OATP6) family contains only one subfamily, OATP6A, which contains only one human member OATP6A1 (encoded by SLCO6A1). The OATP6 family is the most diverged of the OATPs. OATP6A1 is also called cancer/testis antigen 48 (CT48) or gonad-specific transporter. It is strongly expressed only in normal testis, and weakly in spleen, brain, fetal brain, and placenta. It is found in tumor samples (lung, bladder, and esophageal) and cancer cell lines (lung), and may be of potential use as a target for therapy for a variety of tumor types. The SLCO6/OATP6 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340963 [Multi-domain]  Cd Length: 428  Bit Score: 144.99  E-value: 1.46e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  48 ERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSLPHFlmgryeyettisptsnlss 127
Cdd:cd17405   30 QVQFSLTRTEKYLLDFSYDISSFLVAIIIAHYGSRGNRTRWIAASCFLMGLGSMLFAFPFF------------------- 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 128 nsflcmenrtqtlkptqdpaecvkemkslmwIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILESGKMIGP 207
Cdd:cd17405   91 -------------------------------TFHIAGQCIQGIAGMPIYILGITFIFDNIPTSSAGIYLGIAHSAYLIGY 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 208 IVGLLLGSFCARIYVDTGSVNTddlTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPkeglqdnvdrtendke 287
Cdd:cd17405  140 LLGYVGGLPNFQPPPNEKSVEI---EVNKVYQLWQSGWWKTFLIAAAIAWCTSFPLVCFPTSLP---------------- 200
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 288 ekhrekakeenrGITKdflpfmkslscNPIYMLLILTSVLQINAFINMFTFLPKYLEQQYGKSTSEVVLLIGVCNLPPIC 367
Cdd:cd17405  201 ------------GLLK-----------NPLLLCQAICKATEYLTFIGALEFLPHYLENQFLLTPGIASLLTGAFLIPGGA 257
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 368 IGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGLTTSYEGVQHplyvENKVLADCNTRCSCLT 447
Cdd:cd17405  258 IGHFLGGLIVSRLEMSCKNKMRFILVTSVISLGLFVLIFFVECQTVTFAGINEDYDGYGQ----LGNLTAPCNEYCDCTS 333
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|.
gi 390979643 448 NTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQ 488
Cdd:cd17405  334 SLYTSICGRDEIEYFSPCFAGCKASKVSNTEKTYYNCSCIK 374
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
26-404 1.16e-29

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 120.99  E-value: 1.16e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  26 LTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSL 105
Cdd:cd06174    1 LLLGFFLTGLARGLISPLLPALLQSFGLSASQLGLLFALFSLGYALLQPLAGLLADRFGRRPVLLLGLLLFALGALLFAF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 106 PHflmgryeyettisptsnlssnsflcmenrtqtlkptqdpaecvkemkslMWIYVLVGNIIRGIGETPIMPLGISYIED 185
Cdd:cd06174   81 AP-------------------------------------------------SFWLLLLGRFLLGLGSGLIDPAVLALIAD 111
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 186 FAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYvdtgsvntddltitptdtrwVGAWWIGFLVCAGVNILTSIPFFF 265
Cdd:cd06174  112 LFPERERGRALGLLQAFGSVGGILGPLLGGILASSL--------------------GFGWRAVFLIAAALALLAAILLLL 171
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 266 FPKTLPKEGLQDNVDRTendkeekhrekakeenrgiTKDFLPFMKSLSCNPIYMLLILTSVLQINAFINMFTFLPKYLEQ 345
Cdd:cd06174  172 VVPDPPESARAKNEEAS-------------------SKSVLKLLKRVLKNPGLWLLLLAIFLVNLAYYSFSTLLPLFLLD 232
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 390979643 346 QYGKSTsEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYF 404
Cdd:cd06174  233 LGGLSV-AVAGLLLSLFGLAGALGSLLLGLLSDRLIGRKPLLLIGLLLMALGLALLLLA 290
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
436-488 4.48e-20

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650 [Multi-domain]  Cd Length: 54  Bit Score: 83.89  E-value: 4.48e-20
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
gi 390979643 436 LADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQ 488
Cdd:cd01330    2 TSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCTNSTGSGGSKIYTNCSCVG 54
MFS_1 pfam07690
Major Facilitator Superfamily;
22-406 1.37e-14

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 75.54  E-value: 1.37e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643   22 FLLALTCAYVSKSLSGIYMNSMLTQierQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCF 101
Cdd:pfam07690   1 LFLAAFLAALGRSLLGPALPLLLAE---DLGISPTEIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  102 LMSLphflmgryeyettisptsnlSSNSFLcmenrtqtlkptqdpaecvkemkslmwiyVLVGNIIRGIGETPIMPLGIS 181
Cdd:pfam07690  78 LLLF--------------------ASSLWL-----------------------------LLVLRVLQGLGAGALFPAAAA 108
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  182 YIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYvdtgsvntddltitptDTRWVgawwigFLVCAGVNILTSI 261
Cdd:pfam07690 109 LIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLF----------------GWRAA------FLILAILSLLAAV 166
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  262 PFFFFpktlpkeglqdnvdrtenDKEEKHREKAKEENRGITKDFLPFMKSLSCNPIyMLLILTSVLQINAFINMFTFLPK 341
Cdd:pfam07690 167 LAALL------------------LPRPPPESKRPKPAEEAPAPLLPAWKLLLRDPV-LWLLLALLLFGFAFFGLLTYLPL 227
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 390979643  342 YLEqQYGKSTSEVVLLIGVCNLpPICIGYLLIGFIMKKFRitvKKAAYMAFCLSLFEYLLSYFHF 406
Cdd:pfam07690 228 YQE-VLGLSALLAGLLLGLAGL-LGAIGRLLLGRLSDRLG---RRRRLLLALLLLILAALGLLLL 287
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
440-486 3.96e-11

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 400135  Cd Length: 50  Bit Score: 58.27  E-value: 3.96e-11
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 390979643  440 NTRCSCLTNTWDPVCGDNGLSYMSAC---LAGCEKSVGMGTHMVFQNCSC 486
Cdd:pfam07648   1 NCNCQCPKTEYEPVCGSDGVTYPSPCalcAAGCKLGKEVKEEKVKYDGSC 50
MFS_NepI_like cd17324
Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator ...
23-397 4.27e-08

Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily; This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340882 [Multi-domain]  Cd Length: 370  Bit Score: 55.63  E-value: 4.27e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  23 LLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFL 102
Cdd:cd17324    1 LLALALAAFAIGTTEYVIQGLLPDIARDFGVSVAQAGLLVSAYALGYALGALLLGPLSDRIERRRLLLVLLLLFILGNLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 103 MSLphflmgryeyettisptsnlsSNSFlcmenrtqtlkptqdpaecvkemkslmwIYVLVGNIIRGIGETPIMPLGISY 182
Cdd:cd17324   81 AAL---------------------APSF----------------------------ALLLLARALAGLAHGGFWAIAAAY 111
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 183 IEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYvdtgsvntddltitptdtrwvgAWWIGFLVCAGVNILTSIP 262
Cdd:cd17324  112 AADLVPPEKRGRAIGLVFSGLTLGLVLGRPLGGLLGQLL----------------------GWRAAFLAIAVLALLAALL 169
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 263 FFFFpktLPKeglqdnvdrtendkeekhrekAKEENRGITKDFLPFMKSLScNPIYMLLILTSVLQINAFINMFTFLPKY 342
Cdd:cd17324  170 LWRL---LPS---------------------LPPKKPGSLGLLSSLLLLLR-NPRLRLAYLITFLLFGGFFALYTYLAPF 224
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 390979643 343 LEQQYGKSTSEVVLLIGVCNLPPIcIGYLLIGFIMKKFRITVKKAAYMAFCLSLF 397
Cdd:cd17324  225 LTDVPGFSSSAIIGLLLLFGVAGV-VGSPLAGRLADRGGRRALLIALLLLAAALL 278
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
158-360 2.26e-07

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 53.35  E-value: 2.26e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 158 WIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCAriyvdtgsvntddltitpt 237
Cdd:cd17325   84 YWQLLLARFLQGLASAAVWPAAMALIADIAPPEERGRAMGIFSSAIGLGFLIGPLLGGLLA------------------- 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 238 dtrWVGAWWIGFLVCAGVNILTSIPFFFFPKTlpkeglqdnvdrtendkeekhREKAKEENRGITKDFLPFMKSLSCNPI 317
Cdd:cd17325  145 ---DALGYRAPFLVCAALALLALVLALLLLPE---------------------PRPPPNKRAVSAARLRSGLRLLLRDRR 200
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 390979643 318 YMLLILTSVLQINAFINMFTFLPKYLEQQYGKSTSEVVLLIGV 360
Cdd:cd17325  201 LLALFLAIFVLAFAFGALEPFLPLYAAELGGLSPAQIGLLFGA 243
KAZAL_FS cd00104
Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit ...
447-486 1.52e-05

Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the cognate enzyme as substrate. The reactive site peptide bond is a combining loop which has an identical conformation in all Kazal inhibitors and in all enzyme/inhibitor complexes. These Kazal domains (small hydrophobic core of alpha/beta structure with 3 to 4 disulfide bonds) often occur in tandem arrays. Similar domains are also present in follistatin (FS) and follistatin-like family members, which play an important role in tissue specific regulation. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a Kazal-like domain and has five disulfide bonds. Although the Kazal-like FS substructure is similar to Kazal proteinase inhibitors, no FS domain has yet been shown to be a proteinase inhibitor. Follistatin-like family members include SPARC, also known as, BM-40 or osteonectin, the Gallus gallus Flik protein, as well as, agrin which has a long array of FS domains. The kazal-type inhibitor domain has also been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The distant homolog, Ascidian trypsin inhibitor, is included in this CD.


Pssm-ID: 238052  Cd Length: 41  Bit Score: 42.26  E-value: 1.52e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|
gi 390979643 447 TNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSC 486
Cdd:cd00104    2 PKEYDPVCGSDGKTYSNECHLGCAACRSGRSITVAHNGPC 41
MFS_YfmO_like cd17474
Bacillus subtilis multidrug efflux protein YfmO and similar transporters of the Major ...
43-397 1.14e-03

Bacillus subtilis multidrug efflux protein YfmO and similar transporters of the Major Facilitator Superfamily; This family is composed of Bacillus subtilis multidrug efflux protein YfmO, bacillibactin exporter YmfD/YmfE, uncharacterized MFS-type transporter YvmA, and similar proteins. YfmO acts to efflux copper or a copper complex, and could contribute to copper resistance. YmfD/YmfE is involved in secretion of bacillibactin. The YfmO-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341027 [Multi-domain]  Cd Length: 374  Bit Score: 41.79  E-value: 1.14e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643  43 MLTQIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSLphflmgryeyettispt 122
Cdd:cd17474   21 ILPAIAEALGASPAQVGLLITAFTLPAAVLMPVAGVLADRFGRKKVLLPGLLLFGIGGLLCGL----------------- 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 123 snlsSNSFlcmenrtqtlkptqdpaecvkemkslmwIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILES- 201
Cdd:cd17474   84 ----SDSF----------------------------ALLLAGRALQGIGAAGLGPLALTLIGDLFEGGERAKAMGLYEAa 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 202 ---GKMIGPIVGLLLGSFcariyvdtgsvntddltitptdtrwvgAW-WIGFLVCAGVNILTSIPFFFFPKTLPKEGLQD 277
Cdd:cd17474  132 lglGIAVGPLLGGLLAAI---------------------------SWrYPFFLLAALIPVAFLAILFLLPEPKEKAKSSS 184
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 278 NVDRTendkeekhREKAKEENRGITkdflpfmkslscnpiymLLILTSVLQINAFINMFTFLPKYLEQQYGKSTSEVVLL 357
Cdd:cd17474  185 ATKLR--------DLKKALRGRGLL-----------------TFLVSAFLYFFLYFAFLTYLPFLLELLYGISPIIIGLL 239
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|..
gi 390979643 358 IGVCNLpPICIGYLLIGFIMKKF--RITVKKAAYMAFCLSLF 397
Cdd:cd17474  240 FAGWSV-LLALGSLFVGRLLKKRfgARRILVIGLLLYALSLL 280
MFS_TetA cd17388
Tetracycline resistance protein TetA and related proteins of the Major Facilitator Superfamily ...
155-284 1.96e-03

Tetracycline resistance protein TetA and related proteins of the Major Facilitator Superfamily of transporters; This subfamily is composed of tetracycline resistance proteins similar to Escherichia coli TetA(A), TetA(B), and TetA(E), which are metal-tetracycline/H(+) antiporters that confer resistance to tetracycline by an active tetracycline efflux, which is an energy-dependent process that decreases the accumulation of the antibiotic in cells. TetA-like tetracycline resistance proteins belongs to the Eukaryotic Solute carrier 46 (SLC46)/Bacterial Tetracycline resistance (TetA) -like (SLC46/TetA-like) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340946 [Multi-domain]  Cd Length: 385  Bit Score: 41.08  E-value: 1.96e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 390979643 155 SLMWIYVlvGNIIRGI-GETpiMPLGISYIEDFAKSENSPLYIGILES----GKMIGPIVGLLLGSFCARIyvdtgsvnt 229
Cdd:cd17388   90 TLWWLYL--GRIIAGItGAT--GAVAAAYIADVTPPEQRARNFGLLGAafglGFIAGPALGGLLGEISPRA--------- 156
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 390979643 230 ddltitPtdtrwvgawwigFLVCAGVNILTSI-PFFFFPKTLPKEGLQDNVDRTEN 284
Cdd:cd17388  157 ------P------------FLVAAGLNGLNFLlGLFVLPESLPPERRRAFRWRRAN 194
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH