NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|487442792|ref|NP_001264977|]
View 

fructose-1,6-bisphosphatase 1 [Gallus gallus]

Protein Classification

fructose-1,6-bisphosphatase (domain architecture ID 10086071)

class 1 fructose-1,6-bisphosphatase I catalyzes the conversion of D-fructose 1,6-bisphosphate to D-fructose 6-phosphate in gluconeogenesis and the Calvin cycle, which are both anabolic pathways

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FBPase cd00354
Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1, ...
18-331 0e+00

Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway. The alignment model also includes chloroplastic FBPases and sedoheptulose-1,7-biphosphatases that play a role in pentose phosphate pathway (Calvin cycle).


:

Pssm-ID: 238214  Cd Length: 315  Bit Score: 536.37  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  18 VMEEGRRAKGTGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVS 97
Cdd:cd00354    1 LLEQLRKGAATGDLTDLLSSLALACKEISRAVRRAGLAGLLGLAGSVNVQGDEQKKLDVLANDIFIEALKSSGVVAVLAS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  98 EENKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDEPTGKDALQPGRNLVAAGYALYGSATMLVLA 177
Cdd:cd00354   81 EEEEEPVPVEESKDGKYLVAFDPLDGSSNIDANVSVGTIFSIYPGPSGADATEKDFLQPGRNQVAAGYALYGPSTMLVLT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 178 TSaGGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDAAVTEYLRKKKFPEDGSSPYGGRYIGSMVADVHRT 257
Cdd:cd00354  161 LG-QGVHGFTLDPSLGEFILTHPNVKIPKKGKIYSINEGNYRYWDEPVKKYIDDCKAGEDGGKPYNLRYIGSMVADVHRI 239
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 487442792 258 LVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPDDVKEYLE 331
Cdd:cd00354  240 LVRGGIFLYPADKKSPKGKLRLLYEANPMAFLVEQAGGKATDGKERILDIVPTSLHQRVPVILGSKEEVERVEE 313
 
Name Accession Description Interval E-value
FBPase cd00354
Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1, ...
18-331 0e+00

Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway. The alignment model also includes chloroplastic FBPases and sedoheptulose-1,7-biphosphatases that play a role in pentose phosphate pathway (Calvin cycle).


Pssm-ID: 238214  Cd Length: 315  Bit Score: 536.37  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  18 VMEEGRRAKGTGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVS 97
Cdd:cd00354    1 LLEQLRKGAATGDLTDLLSSLALACKEISRAVRRAGLAGLLGLAGSVNVQGDEQKKLDVLANDIFIEALKSSGVVAVLAS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  98 EENKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDEPTGKDALQPGRNLVAAGYALYGSATMLVLA 177
Cdd:cd00354   81 EEEEEPVPVEESKDGKYLVAFDPLDGSSNIDANVSVGTIFSIYPGPSGADATEKDFLQPGRNQVAAGYALYGPSTMLVLT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 178 TSaGGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDAAVTEYLRKKKFPEDGSSPYGGRYIGSMVADVHRT 257
Cdd:cd00354  161 LG-QGVHGFTLDPSLGEFILTHPNVKIPKKGKIYSINEGNYRYWDEPVKKYIDDCKAGEDGGKPYNLRYIGSMVADVHRI 239
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 487442792 258 LVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPDDVKEYLE 331
Cdd:cd00354  240 LVRGGIFLYPADKKSPKGKLRLLYEANPMAFLVEQAGGKATDGKERILDIVPTSLHQRVPVILGSKEEVERVEE 313
PLN02262 PLN02262
fructose-1,6-bisphosphatase
6-339 2.63e-161

fructose-1,6-bisphosphatase


Pssm-ID: 215147  Cd Length: 340  Bit Score: 453.88  E-value: 2.63e-161
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792   6 AFDTDVITMTRFVM-EEGRRAKGTGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVIN 84
Cdd:PLN02262   7 AHRTDLMTITRFVLnEQSKHPEARGDLTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNVQGEEQKKLDVLSNDVFIK 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  85 MLKSSFSTCVIVSEENKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDEPTGKDALQPGRNLVAAG 164
Cdd:PLN02262  87 ALVSSGRTNVLVSEEDEEAIFVEPSKRGRYCVVFDPLDGSSNIDCGVSIGTIFGIYMLKDGGEGTVEDVLQPGKEMVAAG 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 165 YALYGSATMLVLATsAGGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDAAVTEYLRKKKFPEDGSSPYGG 244
Cdd:PLN02262 167 YCMYGSSCTLVLST-GGGVNGFTLDPSLGEFILTHPDIKIPKKGKIYSVNEGNAKNWDGPTAKYVEKCKFPKDGSSPKSL 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 245 RYIGSMVADVHRTLVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPD 324
Cdd:PLN02262 246 RYIGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMSFLVEQAGGQAFTGKQRALDLVPTKIHERSPIFLGSYD 325
                        330
                 ....*....|....*
gi 487442792 325 DVKEYLEIVKKHAAK 339
Cdd:PLN02262 326 DVEEIKALYAAEAAK 340
Fbp COG0158
Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism];
12-336 3.00e-140

Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism];


Pssm-ID: 223236  Cd Length: 326  Bit Score: 400.15  E-value: 3.00e-140
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  12 ITMTRFVMEEGRRAKG-TGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSF 90
Cdd:COG0158    2 KTLGRFLVEKQKEFKAaTAELSAVLSSIALAGKEIAREINKAGLAGVLGYSGAENVQGDTQKKLDVFANEILIEALKARG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  91 STCVIVSEEnKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDePTGKDALQPGRNLVAAGYALYGS 170
Cdd:COG0158   82 NVAGIASEE-EDEPVTFPENNGSYAVAYDPLDGSSNIDVNVSVGTIFSIYRRPGSP-GTEEDFLQPGNKQVAAGYVVYGP 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 171 ATMLVLATSaGGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDAAVTEYLRKKKFPEDGSS-PYGGRYIGS 249
Cdd:COG0158  160 STMLVYTLG-EGVHGFTLDPSLGEFILTHENIRIPEKGKIYAINEGNQRHWEEGVKKYIKDCFAEDKGTRrPYNMRYIGS 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 250 MVADVHRTLVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPDDVKEY 329
Cdd:COG0158  239 MVADVHRILLKGGIFLYPSDKRAPNGKLRLLYEANPMAFLVEQAGGKATDGKQRILDIVPEKLHQRVPLFLGSKEEVEKL 318

                 ....*..
gi 487442792 330 LEIVKKH 336
Cdd:COG0158  319 ERFIKEF 325
FBPase pfam00316
Fructose-1-6-bisphosphatase, N-terminal domain; This family represents the N-terminus of this ...
12-199 2.55e-98

Fructose-1-6-bisphosphatase, N-terminal domain; This family represents the N-terminus of this protein family.


Pssm-ID: 395249  Cd Length: 189  Bit Score: 288.54  E-value: 2.55e-98
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792   12 ITMTRFVMEEGRRAK-GTGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSF 90
Cdd:pfam00316   1 MTLTRFIIEEQHEFPnATGELTGLLSALQLAAKFISRDIRKAGLANLLGLAGAENVQGDVQKKLDVLADEILKNALKASG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792   91 STCVIVSEENKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDEPTGKDALQPGRNLVAAGYALYGS 170
Cdd:pfam00316  81 IVAVLVSEEEEELIVFEGNKRGKYVVAFDPLDGSSNIDTNVSVGTIFSIYRRVSTDSPTTIDFLQPGNEQVAAGYVVYGS 160
                         170       180
                  ....*....|....*....|....*....
gi 487442792  171 ATMLVLATsAGGVNCFMLDPAIGEFILVD 199
Cdd:pfam00316 161 STMLVLTT-GCGVHGFTLDPSLGEFILTH 188
 
Name Accession Description Interval E-value
FBPase cd00354
Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1, ...
18-331 0e+00

Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway. The alignment model also includes chloroplastic FBPases and sedoheptulose-1,7-biphosphatases that play a role in pentose phosphate pathway (Calvin cycle).


Pssm-ID: 238214  Cd Length: 315  Bit Score: 536.37  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  18 VMEEGRRAKGTGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVS 97
Cdd:cd00354    1 LLEQLRKGAATGDLTDLLSSLALACKEISRAVRRAGLAGLLGLAGSVNVQGDEQKKLDVLANDIFIEALKSSGVVAVLAS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  98 EENKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDEPTGKDALQPGRNLVAAGYALYGSATMLVLA 177
Cdd:cd00354   81 EEEEEPVPVEESKDGKYLVAFDPLDGSSNIDANVSVGTIFSIYPGPSGADATEKDFLQPGRNQVAAGYALYGPSTMLVLT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 178 TSaGGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDAAVTEYLRKKKFPEDGSSPYGGRYIGSMVADVHRT 257
Cdd:cd00354  161 LG-QGVHGFTLDPSLGEFILTHPNVKIPKKGKIYSINEGNYRYWDEPVKKYIDDCKAGEDGGKPYNLRYIGSMVADVHRI 239
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 487442792 258 LVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPDDVKEYLE 331
Cdd:cd00354  240 LVRGGIFLYPADKKSPKGKLRLLYEANPMAFLVEQAGGKATDGKERILDIVPTSLHQRVPVILGSKEEVERVEE 313
PLN02262 PLN02262
fructose-1,6-bisphosphatase
6-339 2.63e-161

fructose-1,6-bisphosphatase


Pssm-ID: 215147  Cd Length: 340  Bit Score: 453.88  E-value: 2.63e-161
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792   6 AFDTDVITMTRFVM-EEGRRAKGTGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVIN 84
Cdd:PLN02262   7 AHRTDLMTITRFVLnEQSKHPEARGDLTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNVQGEEQKKLDVLSNDVFIK 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  85 MLKSSFSTCVIVSEENKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDEPTGKDALQPGRNLVAAG 164
Cdd:PLN02262  87 ALVSSGRTNVLVSEEDEEAIFVEPSKRGRYCVVFDPLDGSSNIDCGVSIGTIFGIYMLKDGGEGTVEDVLQPGKEMVAAG 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 165 YALYGSATMLVLATsAGGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDAAVTEYLRKKKFPEDGSSPYGG 244
Cdd:PLN02262 167 YCMYGSSCTLVLST-GGGVNGFTLDPSLGEFILTHPDIKIPKKGKIYSVNEGNAKNWDGPTAKYVEKCKFPKDGSSPKSL 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 245 RYIGSMVADVHRTLVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPD 324
Cdd:PLN02262 246 RYIGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMSFLVEQAGGQAFTGKQRALDLVPTKIHERSPIFLGSYD 325
                        330
                 ....*....|....*
gi 487442792 325 DVKEYLEIVKKHAAK 339
Cdd:PLN02262 326 DVEEIKALYAAEAAK 340
PRK09293 PRK09293
class 1 fructose-bisphosphatase;
12-337 1.50e-155

class 1 fructose-bisphosphatase;


Pssm-ID: 236458  Cd Length: 327  Bit Score: 438.90  E-value: 1.50e-155
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  12 ITMTRFVMEEGRRAKG-TGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSF 90
Cdd:PRK09293   3 KTLGEFLVEQQREFPHaTGELTALISAIALAAKIISRAINKGGLADILGAAGTENVQGETQKKLDVFANEILIEALKARG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  91 STCVIVSEENKDAVIVEADRrGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDePTGKDALQPGRNLVAAGYALYGS 170
Cdd:PRK09293  83 HVAGLASEEEDEIVPIPENE-GKYLVAYDPLDGSSNIDVNVSVGTIFSIYRAPVGT-PTEEDFLQPGNNQVAAGYVLYGP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 171 ATMLVLATSaGGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDAAVTEYLRKKKfPEDGSS--PYGGRYIG 248
Cdd:PRK09293 161 STMLVLTTG-DGVHGFTLDPSLGEFVLTHENIRIPEDGKEYAINEGNQRHWEPGVKKYIELLA-GKDGPRgrPYNMRYIG 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 249 SMVADVHRTLVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPDDVKE 328
Cdd:PRK09293 239 SMVADVHRILLKGGIFLYPADEPYPNGKLRLLYEANPMAFLVEQAGGAASDGKQRILDIEPESLHQRVPLFLGSKEEVER 318

                 ....*....
gi 487442792 329 YLEIVKKHA 337
Cdd:PRK09293 319 VEEYHAEAP 327
Fbp COG0158
Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism];
12-336 3.00e-140

Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism];


Pssm-ID: 223236  Cd Length: 326  Bit Score: 400.15  E-value: 3.00e-140
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  12 ITMTRFVMEEGRRAKG-TGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSF 90
Cdd:COG0158    2 KTLGRFLVEKQKEFKAaTAELSAVLSSIALAGKEIAREINKAGLAGVLGYSGAENVQGDTQKKLDVFANEILIEALKARG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  91 STCVIVSEEnKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDePTGKDALQPGRNLVAAGYALYGS 170
Cdd:COG0158   82 NVAGIASEE-EDEPVTFPENNGSYAVAYDPLDGSSNIDVNVSVGTIFSIYRRPGSP-GTEEDFLQPGNKQVAAGYVVYGP 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 171 ATMLVLATSaGGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDAAVTEYLRKKKFPEDGSS-PYGGRYIGS 249
Cdd:COG0158  160 STMLVYTLG-EGVHGFTLDPSLGEFILTHENIRIPEKGKIYAINEGNQRHWEEGVKKYIKDCFAEDKGTRrPYNMRYIGS 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 250 MVADVHRTLVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPDDVKEY 329
Cdd:COG0158  239 MVADVHRILLKGGIFLYPSDKRAPNGKLRLLYEANPMAFLVEQAGGKATDGKQRILDIVPEKLHQRVPLFLGSKEEVEKL 318

                 ....*..
gi 487442792 330 LEIVKKH 336
Cdd:COG0158  319 ERFIKEF 325
PLN02542 PLN02542
fructose-1,6-bisphosphatase
10-331 1.48e-103

fructose-1,6-bisphosphatase


Pssm-ID: 215298  Cd Length: 412  Bit Score: 309.88  E-value: 1.48e-103
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  10 DVITMTRFVMEEGRRAKGTGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSS 89
Cdd:PLN02542  75 EIQTLTTWLLKQEQAGVIDAELTIVLSSISMACKQIASLVQRAGISNLTGVQGAVNIQGEDQKKLDVISNEVFSNCLRSS 154
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  90 FSTCVIVSEENKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYrkvSP---------DEPTGKDA------- 153
Cdd:PLN02542 155 GRTGIIASEEEDVPVAVEESYSGNYIVVFDPLDGSSNIDAAVSTGSIFGIY---SPndecladigDDSTLDSVeqrcivn 231
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 154 -LQPGRNLVAAGYALYGSATMLVLaTSAGGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDAAVTEYLRKK 232
Cdd:PLN02542 232 vCQPGSNLLAAGYCMYSSSVIFVL-TIGTGVFSFTLDPMYGEFVLTQENIQIPKAGKIYSFNEGNYQLWDDKLKKYIDDL 310
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 233 KFPEDGSSPYGGRYIGSMVADVHRTLVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDI 312
Cdd:PLN02542 311 KDPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDKKSKNGKLRLLYECAPMSFIVEQAGGKGSDGHQRILDIQPTEI 390
                        330
                 ....*....|....*....
gi 487442792 313 HQRVPVVLGSPDDVkEYLE 331
Cdd:PLN02542 391 HQRVPLYIGSVEEV-EKLE 408
FBPase pfam00316
Fructose-1-6-bisphosphatase, N-terminal domain; This family represents the N-terminus of this ...
12-199 2.55e-98

Fructose-1-6-bisphosphatase, N-terminal domain; This family represents the N-terminus of this protein family.


Pssm-ID: 395249  Cd Length: 189  Bit Score: 288.54  E-value: 2.55e-98
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792   12 ITMTRFVMEEGRRAK-GTGEFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSF 90
Cdd:pfam00316   1 MTLTRFIIEEQHEFPnATGELTGLLSALQLAAKFISRDIRKAGLANLLGLAGAENVQGDVQKKLDVLADEILKNALKASG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792   91 STCVIVSEENKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSPDEPTGKDALQPGRNLVAAGYALYGS 170
Cdd:pfam00316  81 IVAVLVSEEEEELIVFEGNKRGKYVVAFDPLDGSSNIDTNVSVGTIFSIYRRVSTDSPTTIDFLQPGNEQVAAGYVVYGS 160
                         170       180
                  ....*....|....*....|....*....
gi 487442792  171 ATMLVLATsAGGVNCFMLDPAIGEFILVD 199
Cdd:pfam00316 161 STMLVLTT-GCGVHGFTLDPSLGEFILTH 188
PLN02628 PLN02628
fructose-1,6-bisphosphatase family protein
1-328 3.25e-82

fructose-1,6-bisphosphatase family protein


Pssm-ID: 215337  Cd Length: 351  Bit Score: 253.18  E-value: 3.25e-82
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792   1 MTDRSAFDTDVITMTRFVmeeGRRAKGTG-EFTQLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTG----DQVKKLD 75
Cdd:PLN02628   7 LYTAARGAEGVCTLMEFL---GTEGSNVGdDLVVLMAHIQAACKRIAALLASPFNSELGKTSSGASGASgsgrDAPKPLD 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  76 ILSNDLVINMLKSSFSTCVIVSEENKDAVIVEADrrGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVSP------DEPT 149
Cdd:PLN02628  84 IVSNEIILSSLRNSGKVAVMASEEDDAPIWIGDD--GPYVVVFDPLDGSRNIDASIPTGTIFGIYNRLVEadhlpvEEKA 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 150 GKDALQPGRNLVAAGYALYGSATMLvlATSAG-GVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEgyAKYFD--AAVT 226
Cdd:PLN02628 162 QLNVLQRGSRLVAAGYVLYSSATIL--CISFGsGTHGFTLDHSTGEFVLTHPDIKIPERGQIYSVND--ARYFDwpEGLR 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 227 EYL---RKKKfpedGSSP--YGGRYIGSMVADVHRTLVYGGIFLypanskSPKGKLRLLYECNPMAFVIEKAGGIATTGH 301
Cdd:PLN02628 238 KYIdtvRQGK----GQYPkkYSARYICSLVADLHRTILYGGIAM------NPRSHLRLVYEANPLSFLVEQAGGRGSDGK 307
                        330       340
                 ....*....|....*....|....*..
gi 487442792 302 QSILDIVPEDIHQRVPVVLGSPDDVKE 328
Cdd:PLN02628 308 RRILSIQPVKLHQRLPLFLGSSEDVLE 334
FBPase_C pfam18913
Fructose-1-6-bisphosphatase, C-terminal domain; This entry represents the C-terminal domain of ...
207-334 2.44e-63

Fructose-1-6-bisphosphatase, C-terminal domain; This entry represents the C-terminal domain of Fructose-1-6-bisphosphatase enzymes. According to ECOD this domain has a Rossmann-like fold.


Pssm-ID: 408683 [Multi-domain]  Cd Length: 125  Bit Score: 197.06  E-value: 2.44e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  207 KGNIYSLNEGYAKYFDAAVTEYLRKKKFpedGSSPYGGRYIGSMVADVHRTLVYGGIFLYPANSKSPKGKLRLLYECNPM 286
Cdd:pfam18913   1 EGKIYAINEGNARHWNAPYRAYIDDLKS---GGKGYTLRYVGSMVADVHRILLKGGIFLYPADKRAPNGKLRLLYECAPL 77
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 487442792  287 AFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPDDVKEYLEIVK 334
Cdd:pfam18913  78 AFLIEQAGGKASDGKQRILDIVPDSLHQRTPIFLGSREEVERVEAYLK 125
PLN02462 PLN02462
sedoheptulose-1,7-bisphosphatase
33-333 8.86e-45

sedoheptulose-1,7-bisphosphatase


Pssm-ID: 215256  Cd Length: 304  Bit Score: 155.27  E-value: 8.86e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  33 QLLNSLCTAVKAISTAVRKAgianLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVSEENKDAVIVEADRRG 112
Cdd:PLN02462  17 RLIMCMGEACRTIAFKVRTA----SCTGTACVNSFGDEQLAVDMLADKLLFEALKYSHVCKYACSEEVPEVQDMGGPVEG 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 113 KYIVCIDPLDGSSNIDCLVSIGTIFGIYrkvSPDEPTGKDalqpGRNLVAAGYALYGSATMLVLA-TSAGGVNCFMLDPA 191
Cdd:PLN02462  93 GFSVAFDPLDGSSIVDTNFAVGTIFGVW---PGDKLTGVT----GRDQVAAAMGIYGPRTTYVVAlKDGPGTHEFLLLDD 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 192 iGEFILVDRDVKIKKK-----GNIYSLNEGyAKYfDAAVTEYLRKKkfpedgsspYGGRYIGSMVADVHRTLVY-GGIFL 265
Cdd:PLN02462 166 -GKWQHVKETTEIGEGkifspGNLRATFDN-PGY-EKLINYYVSEK---------YTLRYTGGMVPDVYQIIVKeKGVFT 233
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 266 YPANSKSPkGKLRLLYECNPMAFVIEKAGGIATTGHQ--SILDIVPEDIHQRVPVVLGSPDDVKEYLEIV 333
Cdd:PLN02462 234 NVTSPKSK-AKLRLLFEVAPLGLLVEKAGGKSSDGVQggSVLDKQINNLDQRTQVAYGSKNEVIRFEETL 302
FIG cd01636
FIG, FBPase/IMPase/glpX-like domain. A superfamily of metal-dependent phosphatases with ...
35-300 2.03e-33

FIG, FBPase/IMPase/glpX-like domain. A superfamily of metal-dependent phosphatases with various substrates. Fructose-1,6-bisphospatase (both the major and the glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate to fructose-6-phosphate in gluconeogenesis. Inositol-monophosphatases and inositol polyphosphatases play vital roles in eukaryotic signalling, as they participate in metabolizing the messenger molecule Inositol-1,4,5-triphosphate. Many of these enzymes are inhibited by Li+.


Pssm-ID: 238814 [Multi-domain]  Cd Length: 184  Bit Score: 121.73  E-value: 2.03e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  35 LNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVSEENKDAVIVEAdRRGKY 114
Cdd:cd01636    1 LEELCRVAKEAGLAILKAFGRELSGKVKITKSDNDPVTTADVAAETLIRNMLKSSFPDVKIVGEESGVAEEVMG-RRDEY 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 115 IVCIDPLDGSSN-IDCLVSIGTIFGIYrkvspdeptgkdalqpgrnlvaagyalygsatmlvlatsaggvncfmldpaig 193
Cdd:cd01636   80 TWVIDPIDGTKNfINGLPFVAVVIAVY----------------------------------------------------- 106
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 194 efilvdrdvkikkkgNIYSLNEGYAKYFDaavteylrKKKFPEDGSSPYGGRYIGSMVADVHRTLV-YGGIFLYPANSks 272
Cdd:cd01636  107 ---------------VILILAEPSHKRVD--------EKKAELQLLAVYRIRIVGSAVAKMCLVALgLADIYYEPGGK-- 161
                        250       260
                 ....*....|....*....|....*...
gi 487442792 273 pkgklRLLYECNPMAFVIEKAGGIATTG 300
Cdd:cd01636  162 -----RRAWDVAASAAIVREAGGIMTDW 184
IMPase_like cd01637
Inositol-monophosphatase-like domains. This family of phosphatases is dependent on bivalent ...
35-299 1.36e-19

Inositol-monophosphatase-like domains. This family of phosphatases is dependent on bivalent metal ions such as Mg++, and many members are inhibited by Li+ (which is thought to displace a bivalent ion in the active site). Substrates include fructose-1,6-bisphosphate, inositol poly- and monophosphates, PAP and PAPS, sedoheptulose-1,7-bisphosphate and probably others.


Pssm-ID: 238815 [Multi-domain]  Cd Length: 238  Bit Score: 86.21  E-value: 1.36e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  35 LNSLCTAVKAISTAVRKAGIANLYgiAGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVSEENKDAvivEADRRGKY 114
Cdd:cd01637    1 LELALKAVREAGALILEAFGEELT--VETKKGDGDLVTEADLAAEELIVDVLKALFPDDGILGEEGGGS---GNVSDGGR 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 115 IVCIDPLDGSSN-IDCLVSIGTIFGIYRKvspdeptGKDalqpgrnlVAAGYALYGsATMLVLATSAGGVNCFMLDPAIG 193
Cdd:cd01637   76 VWVIDPIDGTTNfVAGLPNFAVSIALYED-------GKP--------VLGVIYDPM-LDELYYAGRGKGAFLNGKKLPLS 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792 194 EfilvdrdvKIKKKGNIYSLNEGYAKYFDAAVTEYLRKKkfpedgssPYGGRYIGSMVADVHRTLVY-GGIFLYPANSks 272
Cdd:cd01637  140 K--------DTPLNDALLSTNASMLRSNRAAVLASLVNR--------ALGIRIYGSAGLDLAYVAAGrLDAYLSSGLN-- 201
                        250       260
                 ....*....|....*....|....*..
gi 487442792 273 pkgklrlLYECNPMAFVIEKAGGIATT 299
Cdd:cd01637  202 -------PWDYAAGALIVEEAGGIVTD 221
PRK12676 PRK12676
bifunctional fructose-bisphosphatase/inositol-phosphate phosphatase;
45-126 5.70e-06

bifunctional fructose-bisphosphatase/inositol-phosphate phosphatase;


Pssm-ID: 183673  Cd Length: 263  Bit Score: 46.82  E-value: 5.70e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  45 ISTAVRKAgIANLYGI--AGST---NVTGDQVKKLDILSNDLVINMLKSSFSTCVIVSEENKDAVIVEadrrGKYIVCID 119
Cdd:PRK12676  13 MAKEVEKA-IMPLFGTpdAGETvgmGADGTPTKLIDKVAEDIILEVLKPLGRCVNIISEELGEIVGNG----PEYTVVLD 87

                 ....*..
gi 487442792 120 PLDGSSN 126
Cdd:PRK12676  88 PLDGTYN 94
Arch_FBPase_2 cd01642
Putative fructose-1,6-bisphosphatase or related enzymes of inositol monophosphatase family. ...
68-147 7.54e-06

Putative fructose-1,6-bisphosphatase or related enzymes of inositol monophosphatase family. These are Mg++ dependent phosphatases. Members in this family may have fructose-1,6-bisphosphatase and/or inositol-monophosphatase activity. Fructose-1,6-bisphosphatase catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway.


Pssm-ID: 238820  Cd Length: 244  Bit Score: 46.67  E-value: 7.54e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  68 GDQVKKLDILSNDLVINMLKSSFSTCVIVSEENkdAVIVEADrrGKYIVCIDPLDGSSN-IDCLVSIGTIFGIYRKVSPD 146
Cdd:cd01642   33 GDVTRVADLKAEEIILKLLREEGVFGQIISEES--GEIRKGS--GEYIAVLDPLDGSTNyLSGIPFYSVSVALADPRSKV 108

                 .
gi 487442792 147 E 147
Cdd:cd01642  109 K 109
SuhB COG0483
Archaeal fructose-1,6-bisphosphatase or related enzyme of inositol monophosphatase family ...
47-126 3.67e-05

Archaeal fructose-1,6-bisphosphatase or related enzyme of inositol monophosphatase family [Carbohydrate transport and metabolism];


Pssm-ID: 223559 [Multi-domain]  Cd Length: 260  Bit Score: 44.64  E-value: 3.67e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  47 TAVRKAG--IANLYG-----IAGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVSEENKDAVIveadRRGKYIVCID 119
Cdd:COG0483   10 RAARKAGalILPLFReldavEVEVKKSDGDPVTEADKAAERIIRARLRAAFPDHGILGEESGGALG----GGDEYVWVID 85

                 ....*..
gi 487442792 120 PLDGSSN 126
Cdd:COG0483   86 PIDGTTN 92
Arch_FBPase_1 cd01515
Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family ...
68-126 8.45e-05

Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV). These are Mg++ dependent phosphatases. Members in this family may have both fructose-1,6-bisphosphatase and inositol-monophosphatase activity. In hyperthermophilic archaea, inositol monophosphatase is thought to play a role in the biosynthesis of di-myo-inositol-1,1'-phosphate, an osmolyte unique to hyperthermophiles.


Pssm-ID: 238773  Cd Length: 257  Bit Score: 43.52  E-value: 8.45e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 487442792  68 GDQVKKLDILSNDLVINMLKSsFSTCVIVSEENkdAVIVEADRRGkYIVCIDPLDGSSN 126
Cdd:cd01515   35 GTPTKLIDKVAEDAAIEILKK-LGSVNIVSEEI--GVIDNGDEPE-YTVVLDPLDGTYN 89
pnk PRK14076
bifunctional NADP phosphatase/NAD kinase;
68-126 1.15e-04

bifunctional NADP phosphatase/NAD kinase;


Pssm-ID: 237601 [Multi-domain]  Cd Length: 569  Bit Score: 43.56  E-value: 1.15e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 487442792  68 GDQVKKLDILSNDLVINMLKSsFSTCVIVSEENKDAVIveADRRGKYIVCIDPLDGSSN 126
Cdd:PRK14076  39 GTPTKRIDLIAENIAINSLEK-FCSGILISEEIGFKKI--GKNKPEYIFVLDPIDGTYN 94
Inositol_P pfam00459
Inositol monophosphatase family;
33-134 2.87e-04

Inositol monophosphatase family;


Pssm-ID: 395369 [Multi-domain]  Cd Length: 270  Bit Score: 41.94  E-value: 2.87e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792   33 QLLNSLCTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVSEENKDAVIVEADRRG 112
Cdd:pfam00459   4 EVLKVAVELAAKAGEVLREAFSNKLTIEEKGKSGANDLVTAADKAAEELILEALAALFPSHKIIGEEGGAKGDQSELTDD 83
                          90       100
                  ....*....|....*....|....*..
gi 487442792  113 KYIVCIDPLDGSSN----IDCL-VSIG 134
Cdd:pfam00459  84 GPTWIIDPIDGTTNfvhgIPQFaVSIG 110
PLN02737 PLN02737
inositol monophosphatase family protein
22-138 1.89e-03

inositol monophosphatase family protein


Pssm-ID: 215392  Cd Length: 363  Bit Score: 39.78  E-value: 1.89e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  22 GRRAKGTGEFTQLLNSLCTAVKAISTAVRKAgianlygIAGSTNVT----GDQVKKLDILSNDLVINMLKSSFSTCVIVS 97
Cdd:PLN02737  67 GAASTGPIPAEELLAVAELAAKTGAEVVMEA-------VNKPRNISykglTDLVTDTDKASEAAILEVVRKNFPDHLILG 139
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 487442792  98 EENKdaviVEADRRGKYIVCIDPLDGSSNI-----DCLVSIGTIFG 138
Cdd:PLN02737 140 EEGG----VIGDSSSDYLWCIDPLDGTTNFahgypSFAVSVGVLFR 181
CysQ COG1218
3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and ...
33-123 8.75e-03

3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism];


Pssm-ID: 224139 [Multi-domain]  Cd Length: 276  Bit Score: 37.29  E-value: 8.75e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 487442792  33 QLLNSLCTAVKAISTAVRKAgIANLYGIAGSTNVTGDQ---VKKLDILSNDLVINMLKSSFSTCVIVSEENKDAVIVEaD 109
Cdd:COG1218    3 SELDDMLEAVEKAALEAGQA-ILEVYKEKGLAVWTKADnspVTAADLAAQQIILEGLRALFPDIPVVSEEEEAIDWEE-R 80
                         90
                 ....*....|....
gi 487442792 110 RRGKYIVCIDPLDG 123
Cdd:COG1218   81 LHWDRFWLVDPLDG 94
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH