NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|31542814|ref|NP_032039|]
View 

fibroleukin precursor [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Fibrinogen_C pfam00147
Fibrinogen beta and gamma chains, C-terminal globular domain;
202-428 9.02e-129

Fibrinogen beta and gamma chains, C-terminal globular domain;


:

Pssm-ID: 395095  Cd Length: 221  Bit Score: 370.70  E-value: 9.02e-129
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   202 IYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLER-EFWLGND 280
Cdd:pfam00147   1 FGRDCSDVYNKGAKTSGLYTIRPDGATKPFEVYCDMETDGGGWTVFQRRLDGSTNFKRNWKDYKAGFGNLSPgEFWLGND 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   281 KIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALR-FSR-HYNHDLRFFTTPDRDNDr 358
Cdd:pfam00147  81 KIHLLTKQGPYVLRIDLEDWNGETVFALYDSFKVTNENDKYRLHVENYIGDAGDALDtAGRsMTYHNGMQFSTWDRDND- 159
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   359 YPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGInqaqpggyKSSFKQAKMMIRPK 428
Cdd:pfam00147 160 SPDGNCALSYGGGWWYNNCHAANLNGVYYYGGTYSKQNGIIWATWKGR--------WYSMKKAEMKIRPL 221
PRK02224 super family cl32023
DNA double-strand break repair Rad50 ATPase;
66-199 1.89e-03

DNA double-strand break repair Rad50 ATPase;


The actual alignment was detected with superfamily member PRK02224:

Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 40.41  E-value: 1.89e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   66 LPRQLGSMEEVLKEVRT----LKEAVDSLKKSCQDCKLQADDHRDPGGNGGNGAETAED------SRVQELESQVNKLSS 135
Cdd:PRK02224 319 LEDRDEELRDRLEECRVaaqaHNEEAESLREDADDLEERAEELREEAAELESELEEAREavedrrEEIEELEEEIEELRE 398
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 31542814  136 ELKNAKDQIQGLQGRLETLhLVNMNNIENYVDNKVANLTVVVNSLD--------GKCSKCpsqehmqSQPVQ 199
Cdd:PRK02224 399 RFGDAPVDLGNAEDFLEEL-REERDELREREAELEATLRTARERVEeaealleaGKCPEC-------GQPVE 462
 
Name Accession Description Interval E-value
Fibrinogen_C pfam00147
Fibrinogen beta and gamma chains, C-terminal globular domain;
202-428 9.02e-129

Fibrinogen beta and gamma chains, C-terminal globular domain;


Pssm-ID: 395095  Cd Length: 221  Bit Score: 370.70  E-value: 9.02e-129
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   202 IYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLER-EFWLGND 280
Cdd:pfam00147   1 FGRDCSDVYNKGAKTSGLYTIRPDGATKPFEVYCDMETDGGGWTVFQRRLDGSTNFKRNWKDYKAGFGNLSPgEFWLGND 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   281 KIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALR-FSR-HYNHDLRFFTTPDRDNDr 358
Cdd:pfam00147  81 KIHLLTKQGPYVLRIDLEDWNGETVFALYDSFKVTNENDKYRLHVENYIGDAGDALDtAGRsMTYHNGMQFSTWDRDND- 159
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   359 YPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGInqaqpggyKSSFKQAKMMIRPK 428
Cdd:pfam00147 160 SPDGNCALSYGGGWWYNNCHAANLNGVYYYGGTYSKQNGIIWATWKGR--------WYSMKKAEMKIRPL 221
FReD cd00087
Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is ...
203-428 3.44e-112

Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular arrangement called the disulfide knot. The C termini of fibrinogen chains end in globular domains, which are not completely equivalent. C terminal globular domains of the gamma chains (C-gamma) dimerize and bind to the GPR motif of the N-terminal domain of the alpha chain, while the GHR motif of N-terminal domain of the beta chain binds to the C terminal globular domains of another beta chain (C-beta), which leads to lattice formation.


Pssm-ID: 238040  Cd Length: 215  Bit Score: 328.05  E-value: 3.44e-112
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814 203 YKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKI 282
Cdd:cd00087   3 PRDCSEVLQRGGRTSGVYTIQPPGSNEPFQVYCDMDTDGGGWTVIQRRGDGSVDFYRSWKEYKDGFGNLDGEFWLGLEKI 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814 283 HLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRfsrhyNHDLRFFTTPDRDNDRYpSG 362
Cdd:cd00087  83 HLLTSQGPYELRIDLEDWEGNTAYAEYDSFKVGSESEGYRLTLGGYSGTAGDALS-----YHNGMKFSTFDRDNDGA-SG 156
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 31542814 363 NCGLYYSSGWWFDSCLSANLNGKYYHQKYK-GVRNGIFWGTWPginqaqpgGYKSSFKQAKMMIRPK 428
Cdd:cd00087 157 NCAESYSGGWWYNSCHASNLNGRYYSGGHRnEYDNGINWATWK--------GSTYSLKFTEMKIRPK 215
FBG smart00186
Fibrinogen-related domains (FReDs); Domain present at the C-termini of fibrinogen beta and ...
203-428 4.57e-112

Fibrinogen-related domains (FReDs); Domain present at the C-termini of fibrinogen beta and gamma chains, and a variety of fibrinogen-related proteins, including tenascin and Drosophila scabrous.


Pssm-ID: 214548  Cd Length: 212  Bit Score: 327.70  E-value: 4.57e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814    203 YKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKI 282
Cdd:smart00186   2 PRDCSDVLQNGGKTSGLYTIYPDGSSRPLKVYCDMETDGGGWTVIQRRMDGSVDFYRDWKDYKEGFGNLAGEFWLGNENI 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814    283 HLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDAlrfsRHYNHDLRFFTTPDRDNDRYPsG 362
Cdd:smart00186  82 HLLTSQGKYELRIDLEDWEGNTAYALYDSFKVADEADGYRLHIGGYSGTAGDA----SLTYHNGMQFSTYDRDNDKYS-G 156
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 31542814    363 NCGLYYSSGWWFDSCLSANLNGKYYHqkYKGVRNGIFWGTWPGINQaqpggyksSFKQAKMMIRPK 428
Cdd:smart00186 157 NCAEEYGGGWWYNNCHAANLNGRYYP--NNNYDNGINWATWKGSWY--------SLKFTEMKIRPL 212
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
66-199 1.89e-03

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 40.41  E-value: 1.89e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   66 LPRQLGSMEEVLKEVRT----LKEAVDSLKKSCQDCKLQADDHRDPGGNGGNGAETAED------SRVQELESQVNKLSS 135
Cdd:PRK02224 319 LEDRDEELRDRLEECRVaaqaHNEEAESLREDADDLEERAEELREEAAELESELEEAREavedrrEEIEELEEEIEELRE 398
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 31542814  136 ELKNAKDQIQGLQGRLETLhLVNMNNIENYVDNKVANLTVVVNSLD--------GKCSKCpsqehmqSQPVQ 199
Cdd:PRK02224 399 RFGDAPVDLGNAEDFLEEL-REERDELREREAELEATLRTARERVEeaealleaGKCPEC-------GQPVE 462
 
Name Accession Description Interval E-value
Fibrinogen_C pfam00147
Fibrinogen beta and gamma chains, C-terminal globular domain;
202-428 9.02e-129

Fibrinogen beta and gamma chains, C-terminal globular domain;


Pssm-ID: 395095  Cd Length: 221  Bit Score: 370.70  E-value: 9.02e-129
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   202 IYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLER-EFWLGND 280
Cdd:pfam00147   1 FGRDCSDVYNKGAKTSGLYTIRPDGATKPFEVYCDMETDGGGWTVFQRRLDGSTNFKRNWKDYKAGFGNLSPgEFWLGND 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   281 KIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALR-FSR-HYNHDLRFFTTPDRDNDr 358
Cdd:pfam00147  81 KIHLLTKQGPYVLRIDLEDWNGETVFALYDSFKVTNENDKYRLHVENYIGDAGDALDtAGRsMTYHNGMQFSTWDRDND- 159
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   359 YPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGInqaqpggyKSSFKQAKMMIRPK 428
Cdd:pfam00147 160 SPDGNCALSYGGGWWYNNCHAANLNGVYYYGGTYSKQNGIIWATWKGR--------WYSMKKAEMKIRPL 221
FReD cd00087
Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is ...
203-428 3.44e-112

Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular arrangement called the disulfide knot. The C termini of fibrinogen chains end in globular domains, which are not completely equivalent. C terminal globular domains of the gamma chains (C-gamma) dimerize and bind to the GPR motif of the N-terminal domain of the alpha chain, while the GHR motif of N-terminal domain of the beta chain binds to the C terminal globular domains of another beta chain (C-beta), which leads to lattice formation.


Pssm-ID: 238040  Cd Length: 215  Bit Score: 328.05  E-value: 3.44e-112
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814 203 YKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKI 282
Cdd:cd00087   3 PRDCSEVLQRGGRTSGVYTIQPPGSNEPFQVYCDMDTDGGGWTVIQRRGDGSVDFYRSWKEYKDGFGNLDGEFWLGLEKI 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814 283 HLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRfsrhyNHDLRFFTTPDRDNDRYpSG 362
Cdd:cd00087  83 HLLTSQGPYELRIDLEDWEGNTAYAEYDSFKVGSESEGYRLTLGGYSGTAGDALS-----YHNGMKFSTFDRDNDGA-SG 156
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 31542814 363 NCGLYYSSGWWFDSCLSANLNGKYYHQKYK-GVRNGIFWGTWPginqaqpgGYKSSFKQAKMMIRPK 428
Cdd:cd00087 157 NCAESYSGGWWYNSCHASNLNGRYYSGGHRnEYDNGINWATWK--------GSTYSLKFTEMKIRPK 215
FBG smart00186
Fibrinogen-related domains (FReDs); Domain present at the C-termini of fibrinogen beta and ...
203-428 4.57e-112

Fibrinogen-related domains (FReDs); Domain present at the C-termini of fibrinogen beta and gamma chains, and a variety of fibrinogen-related proteins, including tenascin and Drosophila scabrous.


Pssm-ID: 214548  Cd Length: 212  Bit Score: 327.70  E-value: 4.57e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814    203 YKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKI 282
Cdd:smart00186   2 PRDCSDVLQNGGKTSGLYTIYPDGSSRPLKVYCDMETDGGGWTVIQRRMDGSVDFYRDWKDYKEGFGNLAGEFWLGNENI 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814    283 HLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDAlrfsRHYNHDLRFFTTPDRDNDRYPsG 362
Cdd:smart00186  82 HLLTSQGKYELRIDLEDWEGNTAYALYDSFKVADEADGYRLHIGGYSGTAGDA----SLTYHNGMQFSTYDRDNDKYS-G 156
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 31542814    363 NCGLYYSSGWWFDSCLSANLNGKYYHqkYKGVRNGIFWGTWPGINQaqpggyksSFKQAKMMIRPK 428
Cdd:smart00186 157 NCAEEYGGGWWYNNCHAANLNGRYYP--NNNYDNGINWATWKGSWY--------SLKFTEMKIRPL 212
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
66-199 1.89e-03

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 40.41  E-value: 1.89e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31542814   66 LPRQLGSMEEVLKEVRT----LKEAVDSLKKSCQDCKLQADDHRDPGGNGGNGAETAED------SRVQELESQVNKLSS 135
Cdd:PRK02224 319 LEDRDEELRDRLEECRVaaqaHNEEAESLREDADDLEERAEELREEAAELESELEEAREavedrrEEIEELEEEIEELRE 398
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 31542814  136 ELKNAKDQIQGLQGRLETLhLVNMNNIENYVDNKVANLTVVVNSLD--------GKCSKCpsqehmqSQPVQ 199
Cdd:PRK02224 399 RFGDAPVDLGNAEDFLEEL-REERDELREREAELEATLRTARERVEeaealleaGKCPEC-------GQPVE 462
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH