NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|110625813|ref|NP_083379|]
View 

mesencephalic astrocyte-derived neurotrophic factor precursor [Mus musculus]

Protein Classification

Armet domain-containing protein (domain architecture ID 10562909)

Armet domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Armet pfam10208
Degradation arginine-rich protein for mis-folding; This is a family of small proteins of ...
26-170 2.04e-81

Degradation arginine-rich protein for mis-folding; This is a family of small proteins of approximately 170 residues which contain four di-sulfide bridges that are highly conserved from nematodes to humans. Armet is a soluble protein resident in the endoplasmic reticulum and induced by ER stress. It appears to be involved with dealing with mis-folded proteins in the ER, thus in quality control of ER stress.


:

Pssm-ID: 402006  Cd Length: 145  Bit Score: 237.55  E-value: 2.04e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625813   26 DCEVCISYLGRFYQDLKDRDVTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEK 105
Cdd:pfam10208   1 DCEVCVKFLFRFYLSLKYAELTFSPVEIEEELTKFCKEAKGKENRFCYYLGALEDSATKILSEVSKPLSWHVPVEKICEK 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 110625813  106 LKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGEMCKGCAEKSDYIRKINELMPKYAP 170
Cdd:pfam10208  81 LKKKDSQICELKYEKELDLKTVDLKKLRVKELKKILWDWGEECRGCLEKTDFIKRIEELKPKYVQ 145
 
Name Accession Description Interval E-value
Armet pfam10208
Degradation arginine-rich protein for mis-folding; This is a family of small proteins of ...
26-170 2.04e-81

Degradation arginine-rich protein for mis-folding; This is a family of small proteins of approximately 170 residues which contain four di-sulfide bridges that are highly conserved from nematodes to humans. Armet is a soluble protein resident in the endoplasmic reticulum and induced by ER stress. It appears to be involved with dealing with mis-folded proteins in the ER, thus in quality control of ER stress.


Pssm-ID: 402006  Cd Length: 145  Bit Score: 237.55  E-value: 2.04e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625813   26 DCEVCISYLGRFYQDLKDRDVTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEK 105
Cdd:pfam10208   1 DCEVCVKFLFRFYLSLKYAELTFSPVEIEEELTKFCKEAKGKENRFCYYLGALEDSATKILSEVSKPLSWHVPVEKICEK 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 110625813  106 LKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGEMCKGCAEKSDYIRKINELMPKYAP 170
Cdd:pfam10208  81 LKKKDSQICELKYEKELDLKTVDLKKLRVKELKKILWDWGEECRGCLEKTDFIKRIEELKPKYVQ 145
 
Name Accession Description Interval E-value
Armet pfam10208
Degradation arginine-rich protein for mis-folding; This is a family of small proteins of ...
26-170 2.04e-81

Degradation arginine-rich protein for mis-folding; This is a family of small proteins of approximately 170 residues which contain four di-sulfide bridges that are highly conserved from nematodes to humans. Armet is a soluble protein resident in the endoplasmic reticulum and induced by ER stress. It appears to be involved with dealing with mis-folded proteins in the ER, thus in quality control of ER stress.


Pssm-ID: 402006  Cd Length: 145  Bit Score: 237.55  E-value: 2.04e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110625813   26 DCEVCISYLGRFYQDLKDRDVTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEK 105
Cdd:pfam10208   1 DCEVCVKFLFRFYLSLKYAELTFSPVEIEEELTKFCKEAKGKENRFCYYLGALEDSATKILSEVSKPLSWHVPVEKICEK 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 110625813  106 LKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGEMCKGCAEKSDYIRKINELMPKYAP 170
Cdd:pfam10208  81 LKKKDSQICELKYEKELDLKTVDLKKLRVKELKKILWDWGEECRGCLEKTDFIKRIEELKPKYVQ 145
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH