NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|30984464|ref|NP_851896|]
View 

large tegument protein [Macacine alphaherpesvirus 1]

Protein Classification

PHA03247 family protein (domain architecture ID 11476190)

PHA03247 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
1-3288 0e+00

large tegument protein UL36; Provisional


:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 4248.23  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464     1 MAQRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSDPPRMCSA 80
Cdd:PHA03247    1 MARRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSGPPRMCSI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    81 VELPTFLEYPSGRGLRCVFSRLYGEVAFFGKPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDEAYLF 160
Cdd:PHA03247   81 VELPTFLEYPSGRGLRCVFSRVYGEVAFFGEPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDTAYLF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   161 DPHGLREGSPAFVAKIRAGEVYTYLTYYTQEHPEARWAGAMVFFVPAGPGPPATAALTAAVLQLYGASETYLQDEPFVER 240
Cdd:PHA03247  161 DPHGLREGSPAFVAKVRAGEVYTYLTYYTQDHPEARWAGAMVFFVPSGPGPAAPADLTAAALHLYGASETYLQDEPFVER 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   241 RVVVSHPLRGDDVAPAGAVAVGEEAGRAPAAARKAPPQTPPPKAAAPEPAGAADAGVWGAA---LAGAPLALPAPAPSDS 317
Cdd:PHA03247  241 RVVISHPLRGDIAAPAPPPVVGEGADRAPETARGATGPPPPPEAAAPNGAAAPPDGVWGAAlagAPLALPAPPDPPPPAP 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   318 AGGDDAEDDEDGAMEVVSPLPRPNQHYPLGFSKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFSRGSG 397
Cdd:PHA03247  321 AGDAEEEDDEDGAMEVVSPLPRPRQHYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRKRRSARHAATPFARGPG 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   398 GDEQTRPaagpRPPTPASrpptpgapptpgapptpgapptpgapptpagpttassepptpagpttassepptpagpttas 477
Cdd:PHA03247  401 GDDQTRP----AAPVPAS-------------------------------------------------------------- 414
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   478 sePPTPaGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPtassepptpnpegapapssneqpPAAASTDE 557
Cdd:PHA03247  415 --VPTP-APTPVPASAPPPPATPLPSAEPGSDDGPAPPPERQPPAPATE-----------------------PAPDDPDD 468
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   558 ATQKALDALRDRQPPEPPCGSLTELLGRHPDTDGGVSRLAAHEAGIAREVTECSRLTINALRSPFPGSPGLLQHCIVFLF 637
Cdd:PHA03247  469 ATRKALDALRERRPPEPPGADLAELLGRHPDTAGTVVRLAAREAAIAREVAECSRLTINALRSPFPASPGLLQHCVIFLF 548
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   638 ERVLAFLIENGARTHAGAGAEGPASGLLDLTVSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSIVGRLALAKL 717
Cdd:PHA03247  549 ERVLAFLIENGARTHAGAGAEGPAAALLDLTLSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSGVGRLALAKL 628
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   718 VLVARDVIRTTDDFHGELAELERRLRATPPTEVYARLSEWLLERSKAGPDTLFAPATPTHPEPLLQRIQALAGFARREEV 797
Cdd:PHA03247  629 VLVARDVIRETDAFHGELAELERQLRATPPAEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEI 708
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   798 RAAAEDREVRGALDALARGVDAVARRSGPLTVAAVSPEEPGEGGGRPHPLSPEAIRVRLEQLRADGQKAVEGATREYFHR 877
Cdd:PHA03247  709 RAAAEDREVRGALDALARGVDAVARRAGPLTVAPAPAAPGGQGAPRPPPLSPEAIRVRLEQVRAQGQRAIEGAVKEYFHR 788
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   878 GAVYSAKALLAGDARDRRYHVASAPVVPVVQLLESLPAFDAHVQEVARRARVPAPPPLATSPPAELLRELVQRGRDLEAP 957
Cdd:PHA03247  789 GAVYSAKALLAGDARDRRFHVASAPVVPVVQLLESLPAFDAHVREVAQRARVPAPPPLATSPQAILLRELLQRGQDLEAP 868
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   958 ADLAAWLASLGDAAGQGLVVRKELDELAQAIYKINERTVRRSSGLAELERFEALDAALRGELESEAAFEPGGGDGAAAGG 1037
Cdd:PHA03247  869 ADLAAWLASLGDAAGQGLVERKELDELARAIHKINERQVRRSSGLAELERFEALDAALRQELESEAAFVPAPGAAPYADA 948
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1038 --LPAETRRLAEDALHQAKAMAAAKLTDELSPEARERLAARVRAIEAMLEEARARAEAAKAALARFFQKLQGVLRPLPDF 1115
Cdd:PHA03247  949 ggLSPETRRLAEDALRQAKAMAAAKLTDELSPEARERLRARARAIEAMLEEARERAEAARAARERFFQKLQGVLRPLPDF 1028
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1116 GGLRVAPAVLATLRADIPGGWTCLPDAAQAAPPEVRAALRADLWGLLGQYRGALEHPTADTAAALSGLHPNFAEVLRDLF 1195
Cdd:PHA03247 1029 GGLRAAPAVLATLRADLPGGWTDLPDAAQAAPPEVRAALRADLWGLLGQYREALEHPTPDTATALSGLHPNFVEVLRDLF 1108
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1196 PAAPETPLLVSFFSDHAPRVAQAVSEAIAAGSAAVATASPESTVEAAVRAQGVLADTVAALSPAVRDPACPLAFLVALAD 1275
Cdd:PHA03247 1109 PAAPETPLLVQFFSDHAPRIARAVSEAINAGSAAVATASPESTVDAAVRAHGVLADAVAALSPAVRDPACPLAFLVALAD 1188
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1276 SAAGYVKATRLALGARRAIARLGALGAAAADLAVAVRRENPQADGDRAALLEAAARAVEAARAGLAACEGEFGGLLHAEG 1355
Cdd:PHA03247 1189 SAAGYVKATRLALDARRAIARLGALGAAAADLAVAVRRENPQAEGDRAALLEAAARAVTAAREGLAACEGEFGGLLHAEG 1268
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1356 SAGDPSPSGRALQELGKVVAATRRRADELEAAAADLAEKLADRDARAGRERWAADVEAALDRVENRAEFDAVELRRLQAL 1435
Cdd:PHA03247 1269 SAGDPSPSGRALQELGKVVGATRRRADELEAAAADLAEKMAARRARASRERWAADVEAALDRVENRAEFDAVELRRLQAL 1348
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1436 AAQNKYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQHHPALPPLAAARRIDWGPAFGAAAETYAEMFRVDTE 1515
Cdd:PHA03247 1349 AATHGYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQRHPMLPPLAAIHRIDWGPAFGAAAETYAEMFRVDTE 1428
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1516 PLARLLRITGGLLDLAQAGGGFIDYHEAVSRLAEDLNGVPSLRHYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLD 1595
Cdd:PHA03247 1429 PLARLLRLAGGLLELAQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLD 1508
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1596 LAAAAEQTVRLRGDPAAAAELVRTGVTLACPSEDALAACVGALERVDQAPVKDTAYAEHVAFVARRDLGEAKDALVRAKQ 1675
Cdd:PHA03247 1509 LAAAAEQTSRLRNDPAAAAELVRTGVTLACPSEDALAACVGALERVDQSPVKDTAYAEYVAFVARRDLAEAKDALVRAKQ 1588
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1676 QRAEATDRVTAALREALAAHERQARSEAESLANLKTLLRVAAIPAAAAKTLEQARSVAEIVDQIELLLEQTEKAAELDQA 1755
Cdd:PHA03247 1589 QRAEATDRVTAALREALAAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVAEIVDQIELLLEQTEKAAELDVA 1668
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1756 AVDWLEHARRVFEAHPLTAARDGSPDPLARLHARLDALGETRRRTAALRRSLEAAEAEWDEVWARFGRARGGAWKSPEAL 1835
Cdd:PHA03247 1669 AVDWLEHARRVFEAHPLTAARGGGPDPLARLHARLDALGETRRRTEALRRSLEAAEAEWDEVWGRFGRVRGGAWKSPEAL 1748
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1836 GAAREQLRALQTATNTVLGLVADAHYPRLPAKYQGAIGAKSAERAGAVEELGVAVERHDGLLARLREDVVARVPWEMNAD 1915
Cdd:PHA03247 1749 RAAREQLRALQTATNTVLGLRADAHYERLPAKYQGALGAKSAERAGAVEELGAAVARHDGLLARLREEVVARVPWEMNAD 1828
                        1930      1940      1950      1960      1970      1980      1990      2000
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1916 ALGRLLAEFDALAEDLTPWAVDEFRGARALVQHRLGLYSAYAKARAQtgAGGTPPPAPAPLLVDVRALEARARSPGERHE 1995
Cdd:PHA03247 1829 ALGRLLAEFDALAGDLAPWAVDEFRGARALVQHRLGLYSAYAKARAQ--TGAGGAAPPAPLLVDLRALEARARSPPERHE 1906
                        2010      2020      2030      2040      2050      2060      2070      2080
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1996 PDPRTVRGRGEAYLRARGDPGPLELREATSDLDLPFATSYLTPDGTPLQYVVCFPAVTDKLGALLMRAEAARARPPLPPE 2075
Cdd:PHA03247 1907 PDPRMVRRRGEAYLRASGDPGPLELREATSELDLPFATSYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPPLPTE 1986
                        2090      2100      2110      2120      2130      2140      2150      2160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2076 GLDSTQTLAAMCTVPLITQLQLALSDAQGDGFRLFGRFVRHRQPGWRDSAAAAAELYAALTATTLTREFGCRWDELGWER 2155
Cdd:PHA03247 1987 GLESTQTLAAMCTVPLITRLQLALSDAQGAGFRLFGRFVRHRQPAWRDSMAAAAELYAALVATTLTREFGCRWDELGWAR 2066
                        2170      2180      2190      2200      2210      2220      2230      2240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2156 GAPAPAPLAEPAGTRRPRVTFNMNDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGAILFVQRLTPHPSP 2235
Cdd:PHA03247 2067 GAAAPAPLAEPAGSRRPRVTFNENDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGSILFVQRLTPHPDP 2146
                        2250      2260      2270      2280      2290      2300      2310      2320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2236 EVRVLPAVAAGPPPATGLLFGTRLADWRHGKLSSSDPLAPWRAAPELAAGGAAAALGGLGGPRALVAVSVLGRMCLPSAA 2315
Cdd:PHA03247 2147 EVRVLPAVPAGPPPATGLLFGTRLADWRHGKLSESDPLAPWRAAPELAAGGAAAALGGLSGPRALVAVSVLGRMCLPSAA 2226
                        2330      2340      2350      2360      2370      2380      2390      2400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2316 LAALWSCMFPEGYSEYDSLDALLAARLGAGRPPDPQGGREDVPAPPAHALYRPSGQRVLVRGGAPDPAARVTVMDLVLAA 2395
Cdd:PHA03247 2227 LAALWSCMFPDGYSEYDSLDALLAARLGSGRTPDPQGGREDSPAPPAHALYRPSGQRVLVRGGAPDPAARVTVMDLVLAA 2306
                        2410      2420      2430      2440      2450      2460      2470      2480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2396 TLLGAPVVVALRSDPAFSKGSELELCVTLFDSRERGADAALREVVSSDVETWATDLLHADLNAIENACLAAQLPALSALI 2475
Cdd:PHA03247 2307 TLLGAPVVVALRSDPAFSRGSELELCVTLFDSRARGADAALREVVSSDVETWAVDLLHADLNPIENACLAAQLPALSALI 2386
                        2490      2500      2510      2520      2530      2540      2550      2560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2476 AARPLAGSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSDEIEELPFVSPGADVLAGLAAEGDPFFARTILGAPFSL 2555
Cdd:PHA03247 2387 AARPLARSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSEEIEELPFVSPGGDVLAGLAADGDPFFARTILGAPFSL 2466
                        2570      2580      2590      2600      2610      2620      2630      2640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2556 SRLLHETFPGAPVHRRPPEARFPFAAGAGPDPGGGAPPDPEAPPPPSHQTPAILPDEPVGETVHPRMLTWIRGLEELASD 2635
Cdd:PHA03247 2467 SLLLGELFPGAPVYRRPAEARFPFAAGAAPDPGGGGPPDPDAPPAPSRLAPAILPDEPVGEPVHPRMLTWIRGLEELASD 2546
                        2650      2660      2670      2680      2690      2700      2710      2720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2636 DAGDPPPPLPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAPPQSARPRTPRDDPGPPAApsTLPPSPPPPAPHPP 2715
Cdd:PHA03247 2547 DAGDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRG--PAPPSPLPPDTHAP 2624
                        2730      2740      2750      2760      2770      2780      2790      2800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2716 DPPPPDPSPRPNELGGGETaaapsapdppppqtVPAPERPRDDRAPAPGRVSLPRRASRQGRPA-PSSPLQRPRRRAARP 2794
Cdd:PHA03247 2625 DPPPPSPSPAANEPDPHPP--------------PTVPPPERPRDDPAPGRVSRPRRARRLGRAAqASSPPQRPRRRAARP 2690
                        2810      2820      2830      2840      2850      2860      2870      2880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2795 AVGSLTNLADPHPPGPETPTptsptanphattasatpapppvaatgPTRPTSPATPTPTVAAAGRASappapaapAAPAA 2874
Cdd:PHA03247 2691 TVGSLTSLADPPPPPPTPEP--------------------------APHALVSATPLPPGPAAARQA--------SPALP 2736
                        2890      2900      2910      2920      2930      2940      2950      2960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2875 PAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVVVPAPTATLTATTTT 2954
Cdd:PHA03247 2737 AAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVLAPAA 2816
                        2970      2980      2990      3000      3010      3020      3030      3040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2955 SPAPAATPASPVPTPTSSLPTPPSKPPAFFQPSLATGGSVAPGGDFRRRAPSRPTAAVPAAPSRPPARRLARPAVSRSTE 3034
Cdd:PHA03247 2817 ALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTE 2896
                        3050      3060      3070      3080      3090      3100      3110      3120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3035 SFALPPDELARPRTPEAPAPPTETEEAPVAERPAPPEPPQGRPPSPAAPDAGPAAASGPSGGVPAPRLGALVPGRVAVPR 3114
Cdd:PHA03247 2897 SFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPGRVAVPR 2976
                        3130      3140      3150      3160      3170      3180      3190      3200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3115 RQIPPPA-PPREIPAPSPPPPRSHAPRVSSWASSLALHEEPDAGPVSLKQTLWPPDELDDASDDSSLDSDPERLDLGSLD 3193
Cdd:PHA03247 2977 FRVPQPApSREAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPPDDTEDSDADSLFDSDSERSDLEALD 3056
                        3210      3220      3230      3240      3250      3260      3270      3280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3194 PETDPETDPFAHPPDPRAPEAGDRASPSSYFGPPPLSANAALSRRYVRSTGRSALAVLIEACWRIRRQLRMTRHALLNRS 3273
Cdd:PHA03247 3057 PLPPEPHDPFAHEPDPATPEAGARESPSSQFGPPPLSANAALSRRYVRSTGRSALAVLIEACRRIRRQLRRTRHALLDRS 3136
                        3290
                  ....*....|....*
gi 30984464  3274 GAVLTGLYHVRMLLG 3288
Cdd:PHA03247 3137 GAVLTGLYHVRMLLG 3151
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
1-3288 0e+00

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 4248.23  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464     1 MAQRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSDPPRMCSA 80
Cdd:PHA03247    1 MARRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSGPPRMCSI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    81 VELPTFLEYPSGRGLRCVFSRLYGEVAFFGKPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDEAYLF 160
Cdd:PHA03247   81 VELPTFLEYPSGRGLRCVFSRVYGEVAFFGEPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDTAYLF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   161 DPHGLREGSPAFVAKIRAGEVYTYLTYYTQEHPEARWAGAMVFFVPAGPGPPATAALTAAVLQLYGASETYLQDEPFVER 240
Cdd:PHA03247  161 DPHGLREGSPAFVAKVRAGEVYTYLTYYTQDHPEARWAGAMVFFVPSGPGPAAPADLTAAALHLYGASETYLQDEPFVER 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   241 RVVVSHPLRGDDVAPAGAVAVGEEAGRAPAAARKAPPQTPPPKAAAPEPAGAADAGVWGAA---LAGAPLALPAPAPSDS 317
Cdd:PHA03247  241 RVVISHPLRGDIAAPAPPPVVGEGADRAPETARGATGPPPPPEAAAPNGAAAPPDGVWGAAlagAPLALPAPPDPPPPAP 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   318 AGGDDAEDDEDGAMEVVSPLPRPNQHYPLGFSKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFSRGSG 397
Cdd:PHA03247  321 AGDAEEEDDEDGAMEVVSPLPRPRQHYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRKRRSARHAATPFARGPG 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   398 GDEQTRPaagpRPPTPASrpptpgapptpgapptpgapptpgapptpagpttassepptpagpttassepptpagpttas 477
Cdd:PHA03247  401 GDDQTRP----AAPVPAS-------------------------------------------------------------- 414
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   478 sePPTPaGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPtassepptpnpegapapssneqpPAAASTDE 557
Cdd:PHA03247  415 --VPTP-APTPVPASAPPPPATPLPSAEPGSDDGPAPPPERQPPAPATE-----------------------PAPDDPDD 468
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   558 ATQKALDALRDRQPPEPPCGSLTELLGRHPDTDGGVSRLAAHEAGIAREVTECSRLTINALRSPFPGSPGLLQHCIVFLF 637
Cdd:PHA03247  469 ATRKALDALRERRPPEPPGADLAELLGRHPDTAGTVVRLAAREAAIAREVAECSRLTINALRSPFPASPGLLQHCVIFLF 548
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   638 ERVLAFLIENGARTHAGAGAEGPASGLLDLTVSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSIVGRLALAKL 717
Cdd:PHA03247  549 ERVLAFLIENGARTHAGAGAEGPAAALLDLTLSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSGVGRLALAKL 628
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   718 VLVARDVIRTTDDFHGELAELERRLRATPPTEVYARLSEWLLERSKAGPDTLFAPATPTHPEPLLQRIQALAGFARREEV 797
Cdd:PHA03247  629 VLVARDVIRETDAFHGELAELERQLRATPPAEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEI 708
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   798 RAAAEDREVRGALDALARGVDAVARRSGPLTVAAVSPEEPGEGGGRPHPLSPEAIRVRLEQLRADGQKAVEGATREYFHR 877
Cdd:PHA03247  709 RAAAEDREVRGALDALARGVDAVARRAGPLTVAPAPAAPGGQGAPRPPPLSPEAIRVRLEQVRAQGQRAIEGAVKEYFHR 788
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   878 GAVYSAKALLAGDARDRRYHVASAPVVPVVQLLESLPAFDAHVQEVARRARVPAPPPLATSPPAELLRELVQRGRDLEAP 957
Cdd:PHA03247  789 GAVYSAKALLAGDARDRRFHVASAPVVPVVQLLESLPAFDAHVREVAQRARVPAPPPLATSPQAILLRELLQRGQDLEAP 868
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   958 ADLAAWLASLGDAAGQGLVVRKELDELAQAIYKINERTVRRSSGLAELERFEALDAALRGELESEAAFEPGGGDGAAAGG 1037
Cdd:PHA03247  869 ADLAAWLASLGDAAGQGLVERKELDELARAIHKINERQVRRSSGLAELERFEALDAALRQELESEAAFVPAPGAAPYADA 948
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1038 --LPAETRRLAEDALHQAKAMAAAKLTDELSPEARERLAARVRAIEAMLEEARARAEAAKAALARFFQKLQGVLRPLPDF 1115
Cdd:PHA03247  949 ggLSPETRRLAEDALRQAKAMAAAKLTDELSPEARERLRARARAIEAMLEEARERAEAARAARERFFQKLQGVLRPLPDF 1028
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1116 GGLRVAPAVLATLRADIPGGWTCLPDAAQAAPPEVRAALRADLWGLLGQYRGALEHPTADTAAALSGLHPNFAEVLRDLF 1195
Cdd:PHA03247 1029 GGLRAAPAVLATLRADLPGGWTDLPDAAQAAPPEVRAALRADLWGLLGQYREALEHPTPDTATALSGLHPNFVEVLRDLF 1108
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1196 PAAPETPLLVSFFSDHAPRVAQAVSEAIAAGSAAVATASPESTVEAAVRAQGVLADTVAALSPAVRDPACPLAFLVALAD 1275
Cdd:PHA03247 1109 PAAPETPLLVQFFSDHAPRIARAVSEAINAGSAAVATASPESTVDAAVRAHGVLADAVAALSPAVRDPACPLAFLVALAD 1188
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1276 SAAGYVKATRLALGARRAIARLGALGAAAADLAVAVRRENPQADGDRAALLEAAARAVEAARAGLAACEGEFGGLLHAEG 1355
Cdd:PHA03247 1189 SAAGYVKATRLALDARRAIARLGALGAAAADLAVAVRRENPQAEGDRAALLEAAARAVTAAREGLAACEGEFGGLLHAEG 1268
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1356 SAGDPSPSGRALQELGKVVAATRRRADELEAAAADLAEKLADRDARAGRERWAADVEAALDRVENRAEFDAVELRRLQAL 1435
Cdd:PHA03247 1269 SAGDPSPSGRALQELGKVVGATRRRADELEAAAADLAEKMAARRARASRERWAADVEAALDRVENRAEFDAVELRRLQAL 1348
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1436 AAQNKYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQHHPALPPLAAARRIDWGPAFGAAAETYAEMFRVDTE 1515
Cdd:PHA03247 1349 AATHGYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQRHPMLPPLAAIHRIDWGPAFGAAAETYAEMFRVDTE 1428
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1516 PLARLLRITGGLLDLAQAGGGFIDYHEAVSRLAEDLNGVPSLRHYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLD 1595
Cdd:PHA03247 1429 PLARLLRLAGGLLELAQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLD 1508
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1596 LAAAAEQTVRLRGDPAAAAELVRTGVTLACPSEDALAACVGALERVDQAPVKDTAYAEHVAFVARRDLGEAKDALVRAKQ 1675
Cdd:PHA03247 1509 LAAAAEQTSRLRNDPAAAAELVRTGVTLACPSEDALAACVGALERVDQSPVKDTAYAEYVAFVARRDLAEAKDALVRAKQ 1588
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1676 QRAEATDRVTAALREALAAHERQARSEAESLANLKTLLRVAAIPAAAAKTLEQARSVAEIVDQIELLLEQTEKAAELDQA 1755
Cdd:PHA03247 1589 QRAEATDRVTAALREALAAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVAEIVDQIELLLEQTEKAAELDVA 1668
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1756 AVDWLEHARRVFEAHPLTAARDGSPDPLARLHARLDALGETRRRTAALRRSLEAAEAEWDEVWARFGRARGGAWKSPEAL 1835
Cdd:PHA03247 1669 AVDWLEHARRVFEAHPLTAARGGGPDPLARLHARLDALGETRRRTEALRRSLEAAEAEWDEVWGRFGRVRGGAWKSPEAL 1748
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1836 GAAREQLRALQTATNTVLGLVADAHYPRLPAKYQGAIGAKSAERAGAVEELGVAVERHDGLLARLREDVVARVPWEMNAD 1915
Cdd:PHA03247 1749 RAAREQLRALQTATNTVLGLRADAHYERLPAKYQGALGAKSAERAGAVEELGAAVARHDGLLARLREEVVARVPWEMNAD 1828
                        1930      1940      1950      1960      1970      1980      1990      2000
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1916 ALGRLLAEFDALAEDLTPWAVDEFRGARALVQHRLGLYSAYAKARAQtgAGGTPPPAPAPLLVDVRALEARARSPGERHE 1995
Cdd:PHA03247 1829 ALGRLLAEFDALAGDLAPWAVDEFRGARALVQHRLGLYSAYAKARAQ--TGAGGAAPPAPLLVDLRALEARARSPPERHE 1906
                        2010      2020      2030      2040      2050      2060      2070      2080
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1996 PDPRTVRGRGEAYLRARGDPGPLELREATSDLDLPFATSYLTPDGTPLQYVVCFPAVTDKLGALLMRAEAARARPPLPPE 2075
Cdd:PHA03247 1907 PDPRMVRRRGEAYLRASGDPGPLELREATSELDLPFATSYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPPLPTE 1986
                        2090      2100      2110      2120      2130      2140      2150      2160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2076 GLDSTQTLAAMCTVPLITQLQLALSDAQGDGFRLFGRFVRHRQPGWRDSAAAAAELYAALTATTLTREFGCRWDELGWER 2155
Cdd:PHA03247 1987 GLESTQTLAAMCTVPLITRLQLALSDAQGAGFRLFGRFVRHRQPAWRDSMAAAAELYAALVATTLTREFGCRWDELGWAR 2066
                        2170      2180      2190      2200      2210      2220      2230      2240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2156 GAPAPAPLAEPAGTRRPRVTFNMNDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGAILFVQRLTPHPSP 2235
Cdd:PHA03247 2067 GAAAPAPLAEPAGSRRPRVTFNENDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGSILFVQRLTPHPDP 2146
                        2250      2260      2270      2280      2290      2300      2310      2320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2236 EVRVLPAVAAGPPPATGLLFGTRLADWRHGKLSSSDPLAPWRAAPELAAGGAAAALGGLGGPRALVAVSVLGRMCLPSAA 2315
Cdd:PHA03247 2147 EVRVLPAVPAGPPPATGLLFGTRLADWRHGKLSESDPLAPWRAAPELAAGGAAAALGGLSGPRALVAVSVLGRMCLPSAA 2226
                        2330      2340      2350      2360      2370      2380      2390      2400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2316 LAALWSCMFPEGYSEYDSLDALLAARLGAGRPPDPQGGREDVPAPPAHALYRPSGQRVLVRGGAPDPAARVTVMDLVLAA 2395
Cdd:PHA03247 2227 LAALWSCMFPDGYSEYDSLDALLAARLGSGRTPDPQGGREDSPAPPAHALYRPSGQRVLVRGGAPDPAARVTVMDLVLAA 2306
                        2410      2420      2430      2440      2450      2460      2470      2480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2396 TLLGAPVVVALRSDPAFSKGSELELCVTLFDSRERGADAALREVVSSDVETWATDLLHADLNAIENACLAAQLPALSALI 2475
Cdd:PHA03247 2307 TLLGAPVVVALRSDPAFSRGSELELCVTLFDSRARGADAALREVVSSDVETWAVDLLHADLNPIENACLAAQLPALSALI 2386
                        2490      2500      2510      2520      2530      2540      2550      2560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2476 AARPLAGSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSDEIEELPFVSPGADVLAGLAAEGDPFFARTILGAPFSL 2555
Cdd:PHA03247 2387 AARPLARSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSEEIEELPFVSPGGDVLAGLAADGDPFFARTILGAPFSL 2466
                        2570      2580      2590      2600      2610      2620      2630      2640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2556 SRLLHETFPGAPVHRRPPEARFPFAAGAGPDPGGGAPPDPEAPPPPSHQTPAILPDEPVGETVHPRMLTWIRGLEELASD 2635
Cdd:PHA03247 2467 SLLLGELFPGAPVYRRPAEARFPFAAGAAPDPGGGGPPDPDAPPAPSRLAPAILPDEPVGEPVHPRMLTWIRGLEELASD 2546
                        2650      2660      2670      2680      2690      2700      2710      2720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2636 DAGDPPPPLPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAPPQSARPRTPRDDPGPPAApsTLPPSPPPPAPHPP 2715
Cdd:PHA03247 2547 DAGDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRG--PAPPSPLPPDTHAP 2624
                        2730      2740      2750      2760      2770      2780      2790      2800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2716 DPPPPDPSPRPNELGGGETaaapsapdppppqtVPAPERPRDDRAPAPGRVSLPRRASRQGRPA-PSSPLQRPRRRAARP 2794
Cdd:PHA03247 2625 DPPPPSPSPAANEPDPHPP--------------PTVPPPERPRDDPAPGRVSRPRRARRLGRAAqASSPPQRPRRRAARP 2690
                        2810      2820      2830      2840      2850      2860      2870      2880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2795 AVGSLTNLADPHPPGPETPTptsptanphattasatpapppvaatgPTRPTSPATPTPTVAAAGRASappapaapAAPAA 2874
Cdd:PHA03247 2691 TVGSLTSLADPPPPPPTPEP--------------------------APHALVSATPLPPGPAAARQA--------SPALP 2736
                        2890      2900      2910      2920      2930      2940      2950      2960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2875 PAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVVVPAPTATLTATTTT 2954
Cdd:PHA03247 2737 AAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVLAPAA 2816
                        2970      2980      2990      3000      3010      3020      3030      3040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2955 SPAPAATPASPVPTPTSSLPTPPSKPPAFFQPSLATGGSVAPGGDFRRRAPSRPTAAVPAAPSRPPARRLARPAVSRSTE 3034
Cdd:PHA03247 2817 ALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTE 2896
                        3050      3060      3070      3080      3090      3100      3110      3120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3035 SFALPPDELARPRTPEAPAPPTETEEAPVAERPAPPEPPQGRPPSPAAPDAGPAAASGPSGGVPAPRLGALVPGRVAVPR 3114
Cdd:PHA03247 2897 SFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPGRVAVPR 2976
                        3130      3140      3150      3160      3170      3180      3190      3200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3115 RQIPPPA-PPREIPAPSPPPPRSHAPRVSSWASSLALHEEPDAGPVSLKQTLWPPDELDDASDDSSLDSDPERLDLGSLD 3193
Cdd:PHA03247 2977 FRVPQPApSREAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPPDDTEDSDADSLFDSDSERSDLEALD 3056
                        3210      3220      3230      3240      3250      3260      3270      3280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3194 PETDPETDPFAHPPDPRAPEAGDRASPSSYFGPPPLSANAALSRRYVRSTGRSALAVLIEACWRIRRQLRMTRHALLNRS 3273
Cdd:PHA03247 3057 PLPPEPHDPFAHEPDPATPEAGARESPSSQFGPPPLSANAALSRRYVRSTGRSALAVLIEACRRIRRQLRRTRHALLDRS 3136
                        3290
                  ....*....|....*
gi 30984464  3274 GAVLTGLYHVRMLLG 3288
Cdd:PHA03247 3137 GAVLTGLYHVRMLLG 3151
Herpes_UL36 pfam03586
Herpesvirus UL36 tegument protein; The UL36 open reading frame (ORF) encodes the largest ...
1405-1654 5.36e-97

Herpesvirus UL36 tegument protein; The UL36 open reading frame (ORF) encodes the largest herpes simplex virus type 1 (HSV-1) protein, a 270-kDa polypeptide designated VP1/2, which is also a component of the virion tegument. A null mutation in the UL36 gene of herpes simplex virus type 1 results in accumulation of unenveloped DNA-filled capsids in the cytoplasm of infected cells. This family only covers a small central part of this large protein.


Pssm-ID: 397577 [Multi-domain]  Cd Length: 252  Bit Score: 313.72  E-value: 5.36e-97
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   1405 ERWAADVEAALDRVENRAEFDAVELRRLQALAAQNKYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQHHPAL 1484
Cdd:pfam03586    3 ERWASDIEALLERVESGAEFDVVELRRLRDLAGTGGYDPRDFRKRAEQVVGANAKAVTLALETVLAFNPYTPENQRHPML 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   1485 PPLAAARRIDWGPAFGAAAETYAEMFRVDTEPLARLLRITGGLLDLAQAGGGFIDYHEAVSRLAEDLNGVPSLRHYVPFF 1564
Cdd:pfam03586   83 PPLAALHSITWSDAFGAAADTYTDMFGVSTEPLARLLRIAGGILERADANDGNIDYHEAVLHLSGDLGQVPALRQYVDFY 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   1565 RRGHAEYLELCDRLDALRADVHRALGGVPLDLAAAAEQTVRLRGDPAAAAELVRTGVTLACPSEDALAACVGALERVDQA 1644
Cdd:pfam03586  163 QRGYAEFVDIRARLDELRADARRAIGRVALELAAALEEIAAVRNDPEAAKEALEAGVTIPCPSEDALVACVEALKRVDQK 242
                          250
                   ....*....|
gi 30984464   1645 PVKDTAYAEH 1654
Cdd:pfam03586  243 PFEGTAYAEY 252
fibronec_FbpA NF033913
LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described ...
460-555 8.01e-08

LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.


Pssm-ID: 411474 [Multi-domain]  Cd Length: 386  Bit Score: 57.38  E-value: 8.01e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   460 PTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRP---------PTPANPTAss 530
Cdd:NF033913  168 PSSETPAPSIPALPEAPAQSAESEEPSVAASSEETPSPETPAAPETPEEPAAPAPSPESEPsvaasseetPSPSTPAA-- 245
                          90       100
                  ....*....|....*....|....*.
gi 30984464   531 ePPTPNPEGAPA-PSSNEQPPAAAST 555
Cdd:NF033913  246 -PETPAESEAPAqPAESEESSVAATT 270
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
453-555 1.27e-07

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 57.61  E-value: 1.27e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTPAgpttasSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPtpanptasSEPPTPAGRPPTPAGRPPTPANPTASSEP 532
Cdd:NF033930  355 GPDGDE------EETPAPAPQPEQPAPAPAPAPKPEQPAPAPK--------PEKPADQQAEEDYARRSEEEYNRLTQQQP 420
                          90       100
                  ....*....|....*....|....
gi 30984464   533 PTP-NPEGAPAPSSnEQPPAAAST 555
Cdd:NF033930  421 PKAeKPAPAPAPKP-EQPAPAPKT 443
gliding_GltJ NF033761
adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also ...
403-574 3.00e-07

adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.


Pssm-ID: 411345 [Multi-domain]  Cd Length: 671  Bit Score: 56.38  E-value: 3.00e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   403 RPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGapptpagpttassePPTPAGPTTASSEPPTPAGPTTASSEPPT 482
Cdd:NF033761  395 RSQPPPTPAPVVAPAPPPAPAPPPPPPPAAAQPPPPP--------------AATPPAAATAAATPAAPPAAAPAAAAPAA 460
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   483 PaGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPAN---PTASSEPPTPNPEGAPAPSSNEQPPAAASTDEAT 559
Cdd:NF033761  461 A-GTPPAAPAAAPTPPPAPKAAEPPAAAPAAPARVARPERRTTrrrTSSSRRVPAPTAPVDAEPAPAPKPAPSSSSFGSG 539
                         170
                  ....*....|....*
gi 30984464   560 QKALDALRDRQPPEP 574
Cdd:NF033761  540 DDDFDELFGTKKPKP 554
fibronec_FbpA NF033913
LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described ...
431-551 4.06e-07

LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.


Pssm-ID: 411474 [Multi-domain]  Cd Length: 386  Bit Score: 55.07  E-value: 4.06e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   431 TPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGPTTassePPTPAGRPPTPAGRPPTPANPTASSEPPTPA 510
Cdd:NF033913  169 SSETPAPSIPALPEAPAQSAESEEPSVAASSEETPSPETPAAPET----PEEPAAPAPSPESEPSVAASSEETPSPSTPA 244
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 30984464   511 GrPPTPAgRPPTPANPTASSEPP-----TPNPEgAPAPSSNEQPPA 551
Cdd:NF033913  245 A-PETPA-ESEAPAQPAESEESSvaattSPSPS-TPAESETQTPPA 287
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
453-552 2.72e-06

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 53.40  E-value: 2.72e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAgRPPTPANPTASSEP---PTPAG-------RPPTPAGRPPT 522
Cdd:NF033804  876 EPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPDQP-EPSKPEEPTYETEKplePAPVApsyenepTPPVKTPDQPE 954
                          90       100       110
                  ....*....|....*....|....*....|
gi 30984464   523 PANPTASSEPPTPNPEGAPAPSSNEQPPAA 552
Cdd:NF033804  955 PSKPVEPTYDPLPTPPVAPTPKQLPTPPAV 984
fibronec_FbpA NF033913
LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described ...
455-573 4.34e-06

LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.


Pssm-ID: 411474 [Multi-domain]  Cd Length: 386  Bit Score: 51.99  E-value: 4.34e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPP---TPAGPT-----------TASSEPPTPAGRPPTPA--GRPPTPANPTASSEPPTPAGRPPTPAg 518
Cdd:NF033913  126 PASTEPTTQPVEASvqeTQASASdsmvtddstsvTTDSPEETPSSETPAPSipALPEAPAQSAESEEPSVAASSEETPS- 204
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 30984464   519 rPPTPANPTASSEP--PTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPE 573
Cdd:NF033913  205 -PETPAAPETPEEPaaPAPSPESEPSVAASSEETPSPSTPAAPETPAESEAPAQPAE 260
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
455-549 4.67e-06

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 52.63  E-value: 4.67e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPagRPPTPAGRPPTPANPTASSE--- 531
Cdd:NF033804  865 PTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKP--EEPTYETEKPLEPAPVAPSYene 942
                          90       100
                  ....*....|....*....|
gi 30984464   532 --PPTPNPEgAPAPSSNEQP 549
Cdd:NF033804  943 ptPPVKTPD-QPEPSKPVEP 961
gliding_GltJ NF033761
adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also ...
315-575 9.25e-05

adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.


Pssm-ID: 411345 [Multi-domain]  Cd Length: 671  Bit Score: 48.30  E-value: 9.25e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   315 SDSA-----GGDDAEDDEDGAMEVVS-----PLPRPNQHYPLGFSKRRRPTWTP-PSSLEDLSAGRHHPKRASLPTRTRR 383
Cdd:NF033761  251 EEDVgwkpsAASVLASLVKEENEALSkpppaPAPVPEREPPSASRLLDLPPPPPePVSSPSPGAPATGAAPAPMPAAPQP 330
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   384 SARHA-ATPFSRGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTT 462
Cdd:NF033761  331 APAYAqPAPQPYQPAPYPPPGYPGAYPPAAVAPGAGGKRGLIVGIVAGVLLLVGGAGAGFWAGGRSQPPPTPAPVVAPAP 410
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   463 ASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTAS---SEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEG 539
Cdd:NF033761  411 PPAPAPPPPPPPAAAQPPPPPAATPPAAATAAATPAAPPAAapaAAAPAAAGTPPAAPAAAPTPPPAPKAAEPPAAAPAA 490
                         250       260       270
                  ....*....|....*....|....*....|....*.
gi 30984464   540 APAPSSNEQPPAAASTDEATQKALDALRDRQPPEPP 575
Cdd:NF033761  491 PARVARPERRTTRRRTSSSRRVPAPTAPVDAEPAPA 526
Vip_LPXTG_Lm NF033201
cell invasion LPXTG protein Vip; Vip (Virulence protein), like the LPXTG-type internalins, is ...
453-555 1.47e-04

cell invasion LPXTG protein Vip; Vip (Virulence protein), like the LPXTG-type internalins, is an LPXTG-anchored surface protein of the mammalian cell-invading pathogen Listeria monocytogenes, but absent from the related species Listeria innocua. For certain cell types, Vip is required for Listeria's ability to invade. It appears to bind the endoplasmic reticulum (ER) resident chaperone Gp96 as its receptor.


Pssm-ID: 380203 [Multi-domain]  Cd Length: 414  Bit Score: 47.19  E-value: 1.47e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTPAGPTTASSEPPTPAGPTTassePPTPAgrpptpagrPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSeP 532
Cdd:NF033201  264 ERSKPVTPPKNDPETDNPEEPVT----PVDPA---------TPTPDEPSTPTDPATPTPDEPSTPTDPATPEKPEITT-P 329
                          90       100
                  ....*....|....*....|...
gi 30984464   533 PTPNPEGAPAPSSNEQPPAAAST 555
Cdd:NF033201  330 ENPESTVVESDSSENEPEKSADS 352
fibronec_FbpA NF033913
LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described ...
2974-3063 2.30e-04

LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.


Pssm-ID: 411474 [Multi-domain]  Cd Length: 386  Bit Score: 46.59  E-value: 2.30e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2974 PTPPSKPPAFFQPSLATGGSVAPGGDfRRRAPSRPtaAVPAAPSRPPArrlARPAVSRSTESFALP--PDELARPRTPEA 3051
Cdd:NF033913  181 PEAPAQSAESEEPSVAASSEETPSPE-TPAAPETP--EEPAAPAPSPE---SEPSVAASSEETPSPstPAAPETPAESEA 254
                          90
                  ....*....|..
gi 30984464  3052 PAPPTETEEAPV 3063
Cdd:NF033913  255 PAQPAESEESSV 266
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
453-527 2.64e-04

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 46.86  E-value: 2.64e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 30984464   453 EPPTPAGPTTASSEP--PTPAGPTTaSSEPPTPAGRPPTPagRPPTPANPTASSEPPTPAGrpPTPAGRPPTPANPT 527
Cdd:NF033804  915 EPSKPEEPTYETEKPlePAPVAPSY-ENEPTPPVKTPDQP--EPSKPVEPTYDPLPTPPVA--PTPKQLPTPPAVPT 986
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
505-575 3.96e-04

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 46.06  E-value: 3.96e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 30984464   505 EPPTPAGRPPTPAGRPPTPANPTAssepPTPNPEG-APAPSSNEQPPAAASTDEA--TQKALDALRDRQPPEPP 575
Cdd:NF033930  355 GPDGDEEETPAPAPQPEQPAPAPA----PAPKPEQpAPAPKPEKPADQQAEEDYArrSEEEYNRLTQQQPPKAE 424
DedD COG3147
Cell division protein DedD (periplasmic protein involved in septation) [Cell cycle control, ...
455-548 5.52e-04

Cell division protein DedD (periplasmic protein involved in septation) [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225689 [Multi-domain]  Cd Length: 226  Bit Score: 44.11  E-value: 5.52e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPP---TPANPTASSEPPTPAGRPPTpagrPPTPANPTASSE 531
Cdd:COG3147   58 PAVVQVVALPTQPPEGVAQEIQDAGDAAAASVDPQPVAQPPvesTPAGVPVAAQTPKPVKPPKQ----PPAGAVPAKPTP 133
                         90
                 ....*....|....*..
gi 30984464  532 PPTPNPEGAPAPSSNEQ 548
Cdd:COG3147  134 KPEPKPVAEPAAAPTGQ 150
opacity_OapA NF033909
opacity-associated protein OapA; This family consists of full-length homologs to OapA, ...
455-562 7.80e-04

opacity-associated protein OapA; This family consists of full-length homologs to OapA, opacity-associated protein A as described in Haemophilus influenzae. OapA shares a C-terminal homology domain, called the OapA domain, with the Escherichia coli protein YtfB, which is now known to bind peptidoglycan through its OapA domain and to act as a cell division protein.


Pssm-ID: 411470 [Multi-domain]  Cd Length: 421  Bit Score: 44.85  E-value: 7.80e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPP-TPANPTASSEPPTPAGRPPTPAG--RPPTPANPTASSE 531
Cdd:NF033909  192 PPAQNDNAAAQTNQAENAPKAAEPNNATAVEPQAENAGSTQqATEQTTTTAAENKPEPVKPAQTEpvKAVEVSKVQETVK 271
                          90       100       110
                  ....*....|....*....|....*....|....
gi 30984464   532 PP-TPNPEGAPAPSSNEQP--PAAASTDEATQKA 562
Cdd:NF033909  272 PKvAQEDVKKEEPKVAEKAkpPTKKTEQTVAKTA 305
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
466-575 1.27e-03

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 44.55  E-value: 1.27e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   466 EPPTPAGPTTASSEPPTPAGRPPTPAgrpptPANPTASSEPPTPAGRPPTPagRPPTPANPTASSEPP------TPNPEG 539
Cdd:NF033804  830 EKPTPPVAPTAPQAPTYEVEKPLEPA-----PVAPTYENEPTPPVKTPDQP--EPSKPEEPTYETEKPlepapvAPTYEN 902
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 30984464   540 APAPSSNEQPPAAASTDEATQKALDALRDRQPPEPP 575
Cdd:NF033804  903 EPTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPS 938
PspC_subgroup_2 NF033839
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ...
390-595 1.41e-03

pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.


Pssm-ID: 411408 [Multi-domain]  Cd Length: 557  Bit Score: 44.37  E-value: 1.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   390 TPFSRGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAgpTTASSEPPT 469
Cdd:NF033839  283 TPKEPGNKKPSAPKPGMQPSPQPEKKEVKPEPETPKPEVKPQLEKPKPEVKPQPEKPKPEVKPQLETPK--PEVKPQPEK 360
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   470 PAGPTTASSEPPTPAGRP----PTPAGRP-PTPANPTASSEP--PTPAGRP----PTPAGRP-PTPANPTASSEPPTPNP 537
Cdd:NF033839  361 PKPEVKPQPEKPKPEVKPqpetPKPEVKPqPEKPKPEVKPQPekPKPEVKPqpekPKPEVKPqPEKPKPEVKPQPEKPKP 440
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 30984464   538 EGAPAPSSN--EQPPAAASTDEATQKALDALRDRQPPEP----PCGSLTELLGRHPDTDGGVSR 595
Cdd:NF033839  441 EVKPQPEKPkpEVKPQPETPKPEVKPQPEKPKPEVKPQPekpkPDNSKPQADDKKPSTPNNLSK 504
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
455-541 1.48e-03

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 44.55  E-value: 1.48e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAgrPPTPAGRP-PTPANPTASSEPPTpagRPPTPAGRP-PTPanPTASSEP 532
Cdd:NF033804  904 PTPPVKTPDQPEPSKPEEPTYETEKPLEPA--PVAPSYENePTPPVKTPDQPEPS---KPVEPTYDPlPTP--PVAPTPK 976

                  ....*....
gi 30984464   533 PTPNPEGAP 541
Cdd:NF033804  977 QLPTPPAVP 985
gliding_GltG NF033760
adventurous gliding motility protein GltG; GltG proteins, including the founding member ...
451-554 1.63e-03

adventurous gliding motility protein GltG; GltG proteins, including the founding member MXAN_4867 from Myxococcus xanthus, occur in certain delta-proteobacteria and are involved in adventurous gliding (A-)motility. GltG has an N-terminal forkhead-associated (FHA) domain domain, often associated with signal transduction.


Pssm-ID: 411344 [Multi-domain]  Cd Length: 647  Bit Score: 43.94  E-value: 1.63e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   451 SSEPPTPAGPTTASSEPPtPAGPTTASSEPPTPAGRPPTPAgrpptpanPTASSEPPTPAGRPPTPAGRPPTPANPTAss 530
Cdd:NF033760  113 SAAVAAAPAPVVAAPEAP-AAGLAQAAAAPAPAPAARAAPA--------PQAADASPAPAQAAPVAAPVAAAPAPVHA-- 181
                          90       100
                  ....*....|....*....|....
gi 30984464   531 EPPTPNPEGAPAPSSNEQPPAAAS 554
Cdd:NF033760  182 APAEPAPRARPVRRSKGSGPLGLS 205
opacity_OapA NF033909
opacity-associated protein OapA; This family consists of full-length homologs to OapA, ...
456-565 2.10e-03

opacity-associated protein OapA; This family consists of full-length homologs to OapA, opacity-associated protein A as described in Haemophilus influenzae. OapA shares a C-terminal homology domain, called the OapA domain, with the Escherichia coli protein YtfB, which is now known to bind peptidoglycan through its OapA domain and to act as a cell division protein.


Pssm-ID: 411470 [Multi-domain]  Cd Length: 421  Bit Score: 43.30  E-value: 2.10e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   456 TPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPtpagrPPTPAGRPPTPANPTASSEP--- 532
Cdd:NF033909  213 AEPNNATAVEPQAENAGSTQQATEQTTTTAAENKPEPVKPAQTEPVKAVEVS-----KVQETVKPKVAQEDVKKEEPkva 287
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 30984464   533 -----PTPNPEGAPAPS----SNEQPPAAASTDEATQKALDA 565
Cdd:NF033909  288 ekakpPTKKTEQTVAKTakkaPQEAKPVQAKTEKKVQDIVDA 329
rad23 TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
474-546 2.60e-03

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273167 [Multi-domain]  Cd Length: 378  Bit Score: 42.96  E-value: 2.60e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 30984464    474 TTASSEPPTPAGRPPTPAgrPPTPANPTASSEPPTPAGRPPtpaGRPPTPANPTASSEPPTPN-PEGAPAPSSN 546
Cdd:TIGR00601   81 TGKVAPPAATPTSAPTPT--PSPPASPASGMSAAPASAVEE---KSPSEESATATAPESPSTSvPSSGSDAAST 149
PspC_subgroup_2 NF033839
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ...
400-603 4.40e-03

pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.


Pssm-ID: 411408 [Multi-domain]  Cd Length: 557  Bit Score: 42.45  E-value: 4.40e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   400 EQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPTPagptTASSE 479
Cdd:NF033839  359 EKPKPEVKPQPEKPKPEVKPQPETPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKP----EVKPQ 434
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   480 PPTPAgrpPTPAGRPPTPaNPTASSEPPTPAgrpPTPAGRPPTPaNPTASSEPPTPNPEGAPAPSSNEQPPAAASTDEAT 559
Cdd:NF033839  435 PEKPK---PEVKPQPEKP-KPEVKPQPETPK---PEVKPQPEKP-KPEVKPQPEKPKPDNSKPQADDKKPSTPNNLSKDK 506
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 30984464   560 QKALDALRDRQPPEPPCGSLtellgrhPDTdGGVSRLAAHEAGI 603
Cdd:NF033839  507 QPSNQASTNEKATNKPKKSL-------PST-GSISNLALEIAGL 542
gliding_GltG NF033760
adventurous gliding motility protein GltG; GltG proteins, including the founding member ...
461-563 4.41e-03

adventurous gliding motility protein GltG; GltG proteins, including the founding member MXAN_4867 from Myxococcus xanthus, occur in certain delta-proteobacteria and are involved in adventurous gliding (A-)motility. GltG has an N-terminal forkhead-associated (FHA) domain domain, often associated with signal transduction.


Pssm-ID: 411344 [Multi-domain]  Cd Length: 647  Bit Score: 42.78  E-value: 4.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   461 TTASSEPPTPAGPTTASsePPTPAGRPPTPAGRPPtpANPTASSEPPtpagrpPTPAGRPPTPANPTASSEPPTPNPEGA 540
Cdd:NF033760  110 AVASAAVAAAPAPVVAA--PEAPAAGLAQAAAAPA--PAPAARAAPA------PQAADASPAPAQAAPVAAPVAAAPAPV 179
                          90       100
                  ....*....|....*....|...
gi 30984464   541 PAPSSNEQPPAAASTDEATQKAL 563
Cdd:NF033760  180 HAAPAEPAPRARPVRRSKGSGPL 202
PspC_subgroup_2 NF033839
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ...
402-574 8.70e-03

pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.


Pssm-ID: 411408 [Multi-domain]  Cd Length: 557  Bit Score: 41.68  E-value: 8.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   402 TRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGPTTASSEPP 481
Cdd:NF033839  273 TKFKKGLTQDTPKEPGNKKPSAPKPGMQPSPQPEKKEVKPEPETPKPEVKPQLEKPKPEVKPQPEKPKPEVKPQLETPKP 352
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   482 TPAGRPPTPA-GRPPTPANPTASSEP----PTPAGRP----PTPAGRP-PTPANPTASSEPPTPNPEGAPAPSS--NEQP 549
Cdd:NF033839  353 EVKPQPEKPKpEVKPQPEKPKPEVKPqpetPKPEVKPqpekPKPEVKPqPEKPKPEVKPQPEKPKPEVKPQPEKpkPEVK 432
                         170       180
                  ....*....|....*....|....*
gi 30984464   550 PAAASTDEATQKALDALRDRQPPEP 574
Cdd:NF033839  433 PQPEKPKPEVKPQPEKPKPEVKPQP 457
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
1-3288 0e+00

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 4248.23  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464     1 MAQRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSDPPRMCSA 80
Cdd:PHA03247    1 MARRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSGPPRMCSI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    81 VELPTFLEYPSGRGLRCVFSRLYGEVAFFGKPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDEAYLF 160
Cdd:PHA03247   81 VELPTFLEYPSGRGLRCVFSRVYGEVAFFGEPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDTAYLF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   161 DPHGLREGSPAFVAKIRAGEVYTYLTYYTQEHPEARWAGAMVFFVPAGPGPPATAALTAAVLQLYGASETYLQDEPFVER 240
Cdd:PHA03247  161 DPHGLREGSPAFVAKVRAGEVYTYLTYYTQDHPEARWAGAMVFFVPSGPGPAAPADLTAAALHLYGASETYLQDEPFVER 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   241 RVVVSHPLRGDDVAPAGAVAVGEEAGRAPAAARKAPPQTPPPKAAAPEPAGAADAGVWGAA---LAGAPLALPAPAPSDS 317
Cdd:PHA03247  241 RVVISHPLRGDIAAPAPPPVVGEGADRAPETARGATGPPPPPEAAAPNGAAAPPDGVWGAAlagAPLALPAPPDPPPPAP 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   318 AGGDDAEDDEDGAMEVVSPLPRPNQHYPLGFSKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFSRGSG 397
Cdd:PHA03247  321 AGDAEEEDDEDGAMEVVSPLPRPRQHYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRKRRSARHAATPFARGPG 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   398 GDEQTRPaagpRPPTPASrpptpgapptpgapptpgapptpgapptpagpttassepptpagpttassepptpagpttas 477
Cdd:PHA03247  401 GDDQTRP----AAPVPAS-------------------------------------------------------------- 414
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   478 sePPTPaGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPtassepptpnpegapapssneqpPAAASTDE 557
Cdd:PHA03247  415 --VPTP-APTPVPASAPPPPATPLPSAEPGSDDGPAPPPERQPPAPATE-----------------------PAPDDPDD 468
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   558 ATQKALDALRDRQPPEPPCGSLTELLGRHPDTDGGVSRLAAHEAGIAREVTECSRLTINALRSPFPGSPGLLQHCIVFLF 637
Cdd:PHA03247  469 ATRKALDALRERRPPEPPGADLAELLGRHPDTAGTVVRLAAREAAIAREVAECSRLTINALRSPFPASPGLLQHCVIFLF 548
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   638 ERVLAFLIENGARTHAGAGAEGPASGLLDLTVSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSIVGRLALAKL 717
Cdd:PHA03247  549 ERVLAFLIENGARTHAGAGAEGPAAALLDLTLSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSGVGRLALAKL 628
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   718 VLVARDVIRTTDDFHGELAELERRLRATPPTEVYARLSEWLLERSKAGPDTLFAPATPTHPEPLLQRIQALAGFARREEV 797
Cdd:PHA03247  629 VLVARDVIRETDAFHGELAELERQLRATPPAEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEI 708
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   798 RAAAEDREVRGALDALARGVDAVARRSGPLTVAAVSPEEPGEGGGRPHPLSPEAIRVRLEQLRADGQKAVEGATREYFHR 877
Cdd:PHA03247  709 RAAAEDREVRGALDALARGVDAVARRAGPLTVAPAPAAPGGQGAPRPPPLSPEAIRVRLEQVRAQGQRAIEGAVKEYFHR 788
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   878 GAVYSAKALLAGDARDRRYHVASAPVVPVVQLLESLPAFDAHVQEVARRARVPAPPPLATSPPAELLRELVQRGRDLEAP 957
Cdd:PHA03247  789 GAVYSAKALLAGDARDRRFHVASAPVVPVVQLLESLPAFDAHVREVAQRARVPAPPPLATSPQAILLRELLQRGQDLEAP 868
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   958 ADLAAWLASLGDAAGQGLVVRKELDELAQAIYKINERTVRRSSGLAELERFEALDAALRGELESEAAFEPGGGDGAAAGG 1037
Cdd:PHA03247  869 ADLAAWLASLGDAAGQGLVERKELDELARAIHKINERQVRRSSGLAELERFEALDAALRQELESEAAFVPAPGAAPYADA 948
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1038 --LPAETRRLAEDALHQAKAMAAAKLTDELSPEARERLAARVRAIEAMLEEARARAEAAKAALARFFQKLQGVLRPLPDF 1115
Cdd:PHA03247  949 ggLSPETRRLAEDALRQAKAMAAAKLTDELSPEARERLRARARAIEAMLEEARERAEAARAARERFFQKLQGVLRPLPDF 1028
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1116 GGLRVAPAVLATLRADIPGGWTCLPDAAQAAPPEVRAALRADLWGLLGQYRGALEHPTADTAAALSGLHPNFAEVLRDLF 1195
Cdd:PHA03247 1029 GGLRAAPAVLATLRADLPGGWTDLPDAAQAAPPEVRAALRADLWGLLGQYREALEHPTPDTATALSGLHPNFVEVLRDLF 1108
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1196 PAAPETPLLVSFFSDHAPRVAQAVSEAIAAGSAAVATASPESTVEAAVRAQGVLADTVAALSPAVRDPACPLAFLVALAD 1275
Cdd:PHA03247 1109 PAAPETPLLVQFFSDHAPRIARAVSEAINAGSAAVATASPESTVDAAVRAHGVLADAVAALSPAVRDPACPLAFLVALAD 1188
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1276 SAAGYVKATRLALGARRAIARLGALGAAAADLAVAVRRENPQADGDRAALLEAAARAVEAARAGLAACEGEFGGLLHAEG 1355
Cdd:PHA03247 1189 SAAGYVKATRLALDARRAIARLGALGAAAADLAVAVRRENPQAEGDRAALLEAAARAVTAAREGLAACEGEFGGLLHAEG 1268
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1356 SAGDPSPSGRALQELGKVVAATRRRADELEAAAADLAEKLADRDARAGRERWAADVEAALDRVENRAEFDAVELRRLQAL 1435
Cdd:PHA03247 1269 SAGDPSPSGRALQELGKVVGATRRRADELEAAAADLAEKMAARRARASRERWAADVEAALDRVENRAEFDAVELRRLQAL 1348
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1436 AAQNKYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQHHPALPPLAAARRIDWGPAFGAAAETYAEMFRVDTE 1515
Cdd:PHA03247 1349 AATHGYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQRHPMLPPLAAIHRIDWGPAFGAAAETYAEMFRVDTE 1428
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1516 PLARLLRITGGLLDLAQAGGGFIDYHEAVSRLAEDLNGVPSLRHYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLD 1595
Cdd:PHA03247 1429 PLARLLRLAGGLLELAQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLD 1508
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1596 LAAAAEQTVRLRGDPAAAAELVRTGVTLACPSEDALAACVGALERVDQAPVKDTAYAEHVAFVARRDLGEAKDALVRAKQ 1675
Cdd:PHA03247 1509 LAAAAEQTSRLRNDPAAAAELVRTGVTLACPSEDALAACVGALERVDQSPVKDTAYAEYVAFVARRDLAEAKDALVRAKQ 1588
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1676 QRAEATDRVTAALREALAAHERQARSEAESLANLKTLLRVAAIPAAAAKTLEQARSVAEIVDQIELLLEQTEKAAELDQA 1755
Cdd:PHA03247 1589 QRAEATDRVTAALREALAAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVAEIVDQIELLLEQTEKAAELDVA 1668
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1756 AVDWLEHARRVFEAHPLTAARDGSPDPLARLHARLDALGETRRRTAALRRSLEAAEAEWDEVWARFGRARGGAWKSPEAL 1835
Cdd:PHA03247 1669 AVDWLEHARRVFEAHPLTAARGGGPDPLARLHARLDALGETRRRTEALRRSLEAAEAEWDEVWGRFGRVRGGAWKSPEAL 1748
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1836 GAAREQLRALQTATNTVLGLVADAHYPRLPAKYQGAIGAKSAERAGAVEELGVAVERHDGLLARLREDVVARVPWEMNAD 1915
Cdd:PHA03247 1749 RAAREQLRALQTATNTVLGLRADAHYERLPAKYQGALGAKSAERAGAVEELGAAVARHDGLLARLREEVVARVPWEMNAD 1828
                        1930      1940      1950      1960      1970      1980      1990      2000
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1916 ALGRLLAEFDALAEDLTPWAVDEFRGARALVQHRLGLYSAYAKARAQtgAGGTPPPAPAPLLVDVRALEARARSPGERHE 1995
Cdd:PHA03247 1829 ALGRLLAEFDALAGDLAPWAVDEFRGARALVQHRLGLYSAYAKARAQ--TGAGGAAPPAPLLVDLRALEARARSPPERHE 1906
                        2010      2020      2030      2040      2050      2060      2070      2080
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1996 PDPRTVRGRGEAYLRARGDPGPLELREATSDLDLPFATSYLTPDGTPLQYVVCFPAVTDKLGALLMRAEAARARPPLPPE 2075
Cdd:PHA03247 1907 PDPRMVRRRGEAYLRASGDPGPLELREATSELDLPFATSYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPPLPTE 1986
                        2090      2100      2110      2120      2130      2140      2150      2160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2076 GLDSTQTLAAMCTVPLITQLQLALSDAQGDGFRLFGRFVRHRQPGWRDSAAAAAELYAALTATTLTREFGCRWDELGWER 2155
Cdd:PHA03247 1987 GLESTQTLAAMCTVPLITRLQLALSDAQGAGFRLFGRFVRHRQPAWRDSMAAAAELYAALVATTLTREFGCRWDELGWAR 2066
                        2170      2180      2190      2200      2210      2220      2230      2240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2156 GAPAPAPLAEPAGTRRPRVTFNMNDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGAILFVQRLTPHPSP 2235
Cdd:PHA03247 2067 GAAAPAPLAEPAGSRRPRVTFNENDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGSILFVQRLTPHPDP 2146
                        2250      2260      2270      2280      2290      2300      2310      2320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2236 EVRVLPAVAAGPPPATGLLFGTRLADWRHGKLSSSDPLAPWRAAPELAAGGAAAALGGLGGPRALVAVSVLGRMCLPSAA 2315
Cdd:PHA03247 2147 EVRVLPAVPAGPPPATGLLFGTRLADWRHGKLSESDPLAPWRAAPELAAGGAAAALGGLSGPRALVAVSVLGRMCLPSAA 2226
                        2330      2340      2350      2360      2370      2380      2390      2400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2316 LAALWSCMFPEGYSEYDSLDALLAARLGAGRPPDPQGGREDVPAPPAHALYRPSGQRVLVRGGAPDPAARVTVMDLVLAA 2395
Cdd:PHA03247 2227 LAALWSCMFPDGYSEYDSLDALLAARLGSGRTPDPQGGREDSPAPPAHALYRPSGQRVLVRGGAPDPAARVTVMDLVLAA 2306
                        2410      2420      2430      2440      2450      2460      2470      2480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2396 TLLGAPVVVALRSDPAFSKGSELELCVTLFDSRERGADAALREVVSSDVETWATDLLHADLNAIENACLAAQLPALSALI 2475
Cdd:PHA03247 2307 TLLGAPVVVALRSDPAFSRGSELELCVTLFDSRARGADAALREVVSSDVETWAVDLLHADLNPIENACLAAQLPALSALI 2386
                        2490      2500      2510      2520      2530      2540      2550      2560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2476 AARPLAGSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSDEIEELPFVSPGADVLAGLAAEGDPFFARTILGAPFSL 2555
Cdd:PHA03247 2387 AARPLARSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSEEIEELPFVSPGGDVLAGLAADGDPFFARTILGAPFSL 2466
                        2570      2580      2590      2600      2610      2620      2630      2640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2556 SRLLHETFPGAPVHRRPPEARFPFAAGAGPDPGGGAPPDPEAPPPPSHQTPAILPDEPVGETVHPRMLTWIRGLEELASD 2635
Cdd:PHA03247 2467 SLLLGELFPGAPVYRRPAEARFPFAAGAAPDPGGGGPPDPDAPPAPSRLAPAILPDEPVGEPVHPRMLTWIRGLEELASD 2546
                        2650      2660      2670      2680      2690      2700      2710      2720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2636 DAGDPPPPLPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAPPQSARPRTPRDDPGPPAApsTLPPSPPPPAPHPP 2715
Cdd:PHA03247 2547 DAGDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRG--PAPPSPLPPDTHAP 2624
                        2730      2740      2750      2760      2770      2780      2790      2800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2716 DPPPPDPSPRPNELGGGETaaapsapdppppqtVPAPERPRDDRAPAPGRVSLPRRASRQGRPA-PSSPLQRPRRRAARP 2794
Cdd:PHA03247 2625 DPPPPSPSPAANEPDPHPP--------------PTVPPPERPRDDPAPGRVSRPRRARRLGRAAqASSPPQRPRRRAARP 2690
                        2810      2820      2830      2840      2850      2860      2870      2880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2795 AVGSLTNLADPHPPGPETPTptsptanphattasatpapppvaatgPTRPTSPATPTPTVAAAGRASappapaapAAPAA 2874
Cdd:PHA03247 2691 TVGSLTSLADPPPPPPTPEP--------------------------APHALVSATPLPPGPAAARQA--------SPALP 2736
                        2890      2900      2910      2920      2930      2940      2950      2960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2875 PAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVVVPAPTATLTATTTT 2954
Cdd:PHA03247 2737 AAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVLAPAA 2816
                        2970      2980      2990      3000      3010      3020      3030      3040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2955 SPAPAATPASPVPTPTSSLPTPPSKPPAFFQPSLATGGSVAPGGDFRRRAPSRPTAAVPAAPSRPPARRLARPAVSRSTE 3034
Cdd:PHA03247 2817 ALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTE 2896
                        3050      3060      3070      3080      3090      3100      3110      3120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3035 SFALPPDELARPRTPEAPAPPTETEEAPVAERPAPPEPPQGRPPSPAAPDAGPAAASGPSGGVPAPRLGALVPGRVAVPR 3114
Cdd:PHA03247 2897 SFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPGRVAVPR 2976
                        3130      3140      3150      3160      3170      3180      3190      3200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3115 RQIPPPA-PPREIPAPSPPPPRSHAPRVSSWASSLALHEEPDAGPVSLKQTLWPPDELDDASDDSSLDSDPERLDLGSLD 3193
Cdd:PHA03247 2977 FRVPQPApSREAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPPDDTEDSDADSLFDSDSERSDLEALD 3056
                        3210      3220      3230      3240      3250      3260      3270      3280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3194 PETDPETDPFAHPPDPRAPEAGDRASPSSYFGPPPLSANAALSRRYVRSTGRSALAVLIEACWRIRRQLRMTRHALLNRS 3273
Cdd:PHA03247 3057 PLPPEPHDPFAHEPDPATPEAGARESPSSQFGPPPLSANAALSRRYVRSTGRSALAVLIEACRRIRRQLRRTRHALLDRS 3136
                        3290
                  ....*....|....*
gi 30984464  3274 GAVLTGLYHVRMLLG 3288
Cdd:PHA03247 3137 GAVLTGLYHVRMLLG 3151
PHA03246 PHA03246
large tegument protein UL36; Provisional
6-2539 0e+00

large tegument protein UL36; Provisional


Pssm-ID: 223020  Cd Length: 3095  Bit Score: 922.84  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464     6 DRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSDPPRMCSAVELPT 85
Cdd:PHA03246   73 DFTIVAVGIRNQFAPDLSPGSSVSCLRSSLAFLRIVFAYGLDTVLSADAIDRLLLQGKDWTIHTSDDGVYTTCVPHDLPN 152
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    86 FLEYPSGRGLRCV-FSRLYGEVAFF-GKPAPGLLETQCPAHDFFAGPWA-RRPLSYTLVTIGALGMGLYRDGDEAYLFDP 162
Cdd:PHA03246  153 RILSKDPGGNLCVaFSSSYGESEFYlDENTPTILDTQISARTFIERVWKqKRGDIYCLIVIGVLGIGVYRSEDGIYIFDP 232
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   163 HGLREGSPAFVAKIRAGEVYTYLTYYTQEHPEARWAGAMVFFVPAGPGPPATAALTAAVLQLYGASETYLQ----DEPfv 238
Cdd:PHA03246  233 HGHGHIGQACIVRVSEGYFYQYLTSYADPSGMPDWSATFVYFVSTASSAPPKEEIISAVSRLYGTADIVLDlgraDEE-- 310
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   239 ERRVVVSHplrgdDVAPagavavgeeagrapaaarkappqtpppkaaapepagaadagvwgaalagaplalpapapsdsa 318
Cdd:PHA03246  311 DNLKVVSA-----DFDP--------------------------------------------------------------- 322
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   319 ggddaeddedgamevvSPLPRPNQ-HYPLGFSKRR-RPTWTPPSSLEDLSAgrhhpkraslptrtrrsarHAATPF--SR 394
Cdd:PHA03246  323 ----------------PSRPQPWQtKIVIGTADSYaDSSPKLHSESTDLTP-------------------HEHGEYdpST 367
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   395 GSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAG--PTTASSEPPTPAG 472
Cdd:PHA03246  368 LVGGASTNINISDPPARTDCRRYSEGSVIHESVDSHIEDVTEATSVVAAWSDAFSDISEDYSHLTrpDLPATAHDVSKNG 447
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   473 PTTASSEPPTPAG---RPPTPAGRPPTpANPTASSEPPT--PAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSS-- 545
Cdd:PHA03246  448 HDTKSDRRSRGSNsrhKRRRPSWTPPS-SSENVSSDGPTfsQSRKPSRKSKRALDLDYGHLSNEPSDVDGENSDSPAGai 526
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   546 ---------NEQPPAAASTDEATQKALdaLRDRQP--PEPPCGSLTELL--GRHPDTDGGVSRLAAHEAGIarEVTECS- 611
Cdd:PHA03246  527 snipdnvsfNEFISSQARAEDSIEHLS--LRNRPVfnPHTVTGNLDNTLrdSLWNDEYSGSYPLSDISDMI--DDITESi 602
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   612 ----RLTINaLRSPFPGSPGLLQHCIVFLFERVLAFLIENGARTHAGAGAEGPASgLLDLTVSLlPRRTAVGDFLASTRM 687
Cdd:PHA03246  603 adgmRLVVH-TSHRGDYDGGLLDVCIMDVFTRLFNYIIENGARTTTDRASVVEPE-MAALTKAF-TTPSHFSTFISSTGM 679
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   688 TLADVAAHLPLIQPVLDEGSIVGRLALAKLVLVARDVIRTTDDFHGELAELERRLRATPPTEVYARLSEWLLERSKAGPD 767
Cdd:PHA03246  680 SLSEASESADLIESVLTENSKIGKLALSKLTLVALEVEEATDTLHKSLDAIEREASTADPDRIYERMATVLVDTFYRNSG 759
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   768 TLFAPATPTHPE-PLLQRIQALAGFARREEVRAAAEDREVRGALDALARGVDAVARRSGPLTVAAVSPEEPGEGGGRPHP 846
Cdd:PHA03246  760 KLYSETTSYNSDqTLTDRVVSLCEFIRDRENVATRKAELILAEIEALDAGVRWMNTKFDAFIMGGSGGMSPAKGLSAIAK 839
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   847 LSPEAIRVRLEQLRADGQKAVEGATREYFHRGAVYSAKALLAGDARDRRYH-VASAPVVPVVQLLESLPAFDAHVQEVAR 925
Cdd:PHA03246  840 TSTDVVTQRLESIGKAAIDIVGNALREYYLKCALYSAKALRADMKETSRFKiVVTEQLEKMTRLLSSLSVIDDVILLIAS 919
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   926 RARVPAPPPLATSPPAELLRELVQRGRDLEAPADLAAWLASLGDAAGQGLVVRKELDELAQAIYKINERTVRRSSGLAEL 1005
Cdd:PHA03246  920 RSDARVPVPVSKALESQLLGDLLEIGSHLDVPENLVTWKGLMVSVQTGGWISRRELDLLLKEVDAVNDNAARRETALTEL 999
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1006 ERFEALDAALRGELESEAAFEPGGGDgaaagglpaETRRLAEDALHQAKAMAAAKLTDELSPEARERLAARVRAIEAMLE 1085
Cdd:PHA03246 1000 ERLHELESRIASYTDLETTVDLQKLD---------EALKLANSIVKLTKGLDGAKLASSLSSDIREKIRQKRSETETLIA 1070
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1086 EARARAEAAKAALARFFQKLQGVLRPLPDFGGLRVAPAVLATLRADIPGGWTCLPDAAQAAPPEVRAALRADLWGLLGQY 1165
Cdd:PHA03246 1071 RLSARYAEVKAAVDGLYSSIRKLLRPLQNFAGLRALDSTVKTITDSIPPGMGSFESFLASAPPDVIGALRSDLWVLFTQY 1150
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1166 RGALEHPTADTAAALSGLHPNFAEVLRDLFPAAPETPLLVSFFSDHAPRVAQAVSEAIAAGSAAVATASPESTVEAAV-- 1243
Cdd:PHA03246 1151 KTILSRPSTGTAAELSGLGGPFALAIRVILGPEGEYPAASVFFGKHADVLSAALAAAASEPMSVEKTSAAVSVLKEAIsd 1230
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1244 --RAQGVLADT-VAALSPAVRDPAcpLAFLVAL---ADSAAGYVKATRLALGARRAIARLGALGAAAADLAVAVRRENPQ 1317
Cdd:PHA03246 1231 inRADATIPQQgIMADLSTERADA--FSFLHALlsdAEGAADVASRGAYLSTLIRTVRDSLEAVIDSITKIKSLDPKTYT 1308
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1318 ADGDRAAlleaaaraveaaragLAACEGEFGgllHAEGSAGDPSPSGRALQ---------------ELGKVVAATRRRAD 1382
Cdd:PHA03246 1309 YNTDASV---------------IVSAKAEVS---AATQQAGDCKDALTALEnepltynphiqrkiaELNKLIESVNQRVG 1370
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1383 ELEAAAADLAEKLADRDARAGRERWAADVEAALDRVENRAEFDAVELRRLQALAAQNKYNPRDFRKRAEQALAANAKTAT 1462
Cdd:PHA03246 1371 ELDIALQTYERNRISAERSRSEDLWTSSITSLLVNAEIKSEFDAMEINSLEETARNAGYDTIRFKSRAEKIVSAHARVVE 1450
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1463 LALEAAFAFNPYTPENQHHPALPPLAAARRIDWGPAFGAAAETYAEMFRVDTEPLARLLRITGGLLDLAQAGGGFIDYHE 1542
Cdd:PHA03246 1451 NAIETVLKFNPYSTTNIIHGLKPPIAALKNITWGDAFFAAAPYYTKLFGVNCDVLISLLKILFAILRHASAHPGNLDYYF 1530
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1543 AVSRLAEDLNGVPSLRHYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLDLAAAAEQTVRLRgDPAAAAELVRTGVT 1622
Cdd:PHA03246 1531 LVGEIESDLRAIPSLAKYVDFYRRGHDSFEGFLARLEQMRVEALHASGRVSIEISDALETLARTH-SPEGARRALEYGVS 1609
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1623 LACPSEDALAACVGALERVDQAPVKDTAYAEHVAFVARRDLGEAKDALVRAKQQRAEATDRVTAALREALAAHERQARSE 1702
Cdd:PHA03246 1610 IVIPSANTIMSIADALQKEKITELDGTAYAEYSAHILRRDNDAIKSITQRVTTAIEAAKSRGESILKDLAEASYAADRET 1689
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1703 AESLANLKTLLRVAAIPAAAAKTLEQARSVAEIVDQIELLLEQTEKAAELDQAAVDWLEHARRVFEAHPLTAARDGSpDP 1782
Cdd:PHA03246 1690 AEQLANLKNLLRLVAMPAHIAKAIDKAETANDIVTQAALLLTKVEETKELDTQTVEWLKHAESVIDSHDLTVRIDES-GP 1768
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1783 LARLHARLDALGETRRRTAALRRSLEAAEAEWDEVWARFGRARGGAWKSPEALGAAREQLRALQTATNTVLGLVADAHYP 1862
Cdd:PHA03246 1769 MTIYAERIDALVRLENRLAELKSELALAEVAWDDTWSTFIHDKDRIDKSSEGFSAARESAARAKVSTNAINALRNNAEYN 1848
                        1930      1940      1950      1960      1970      1980      1990      2000
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1863 RLPAKYQGAIGAKSAERAGAVEELGVAVERHDGLLARLrEDVVARVPWEMNADALGRLLAEFDALAEDLTPWAVDEFRGA 1942
Cdd:PHA03246 1849 RLPAKIIGLIDSKYRDRTVVLDAFLDSMKEIEDTQKQM-EILCSKIPLTFSLNDLRAISSQFDDIAKRLPKWYVKQVGRY 1927
                        2010      2020      2030      2040      2050      2060      2070      2080
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  1943 RALVQHRLGLYSAYAKAraqtgaGGTPPPAPAPLLVDVRALEArarspGERHEPDPRTV----RGRGEAYLRARgdpGPL 2018
Cdd:PHA03246 1928 SRLIKLRLALYAAYSNA------STGPIGDPPLLPFDTGRANI-----AANMAPSVGLVdrylKHRVAAWIRPK---VVA 1993
                        2090      2100      2110      2120      2130      2140      2150      2160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2019 ELREATSDLDLPFATSYLTPDGTPLQYVVCFPAVTDKLGALLMRAEAARARPPLPPEGLDSTQTLAAMCTVPLITQLQLA 2098
Cdd:PHA03246 1994 TLQEAFSEIDMPGLTTYLDSTDTPLRYSICYRTVGEKLAACLCEPSAVNIKPRIPTNLISTVEMESAAGMLNDIMILRLG 2073
                        2170      2180      2190      2200      2210      2220      2230      2240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2099 LSDAQGDGFRLFGRFVRHRQPGW--RDSAAAAAELYAALTATTLTREFGCRWDELGWERGAPAPAPLA------EPAGTR 2170
Cdd:PHA03246 2074 FVQACADRFQLFTKYVRTGIHDWspDYCIKAHGTIYCALIAITLTRKTGSNLSDIYFIPGQYGPTIDKkelkkfAANGRR 2153
                        2250      2260      2270      2280      2290      2300      2310      2320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2171 RPRVTFNMNDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGAILFVQRLTPH------PSPEVRVLPAVA 2244
Cdd:PHA03246 2154 RQVVRLDPADVMVTIMACTPGHVLTFSKLDLINQYDFMDKTLYNVLTDSISTVAFVNCLSTQlskdgkVDPNCRPLSLTG 2233
                        2330      2340      2350      2360      2370      2380      2390      2400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2245 AGPPPATGLLFGTRLADWRHGKLSSSDPLAPWRAApELAAGGAAAALGGLGGPRALVAVSVLGRMCLPSAALAALWSCMF 2324
Cdd:PHA03246 2234 GEWDPSGGSLFAIRYSDWKQGRLSDTDPLKPWEDI-SGDEGAGLAKIRAVVPSSLLTTTTVLARMCIPPTALAVMWSSLL 2312
                        2410      2420      2430      2440      2450      2460      2470      2480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2325 PEGYSEY-DSLDALLAARLGAGRPPDPQGGREDVPA-------PPAHALYRPSGQRV--LVRGGAPDPAARVTVMDLVLA 2394
Cdd:PHA03246 2313 PDGIEQTcKSYDDVVTARGDGASTLDVTTSTIDHTGvkniqtnLDCPNLYEYTGTATtfTVVSTPPSRVLKVNAMDIAAC 2392
                        2490      2500      2510      2520      2530      2540      2550      2560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2395 ATLLGAPVVVALRSDPAFSKGSELELCVTLFDSRErGADAALRE--VVSSDVETWATDLLHADLNAIENACLAAQLPALS 2472
Cdd:PHA03246 2393 ATLFGARIVIAAECPEAYSSDSGLSLCIRLFDSRS-GSKGCFLEpgAVSSDITSWGAKLLAADSNPIENACLGQQLEHLS 2471
                        2570      2580      2590      2600      2610      2620
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 30984464  2473 ALIAARPLAGSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSDE--IEELPFVSPGADVLAGLAAE 2539
Cdd:PHA03246 2472 HLIASKPLSSAPPCLVIVDAGMVPVKVLWAKEELDPIPIIRLTSADDalISELPYIDAGIRGETGADFQ 2540
Herpes_UL36 pfam03586
Herpesvirus UL36 tegument protein; The UL36 open reading frame (ORF) encodes the largest ...
1405-1654 5.36e-97

Herpesvirus UL36 tegument protein; The UL36 open reading frame (ORF) encodes the largest herpes simplex virus type 1 (HSV-1) protein, a 270-kDa polypeptide designated VP1/2, which is also a component of the virion tegument. A null mutation in the UL36 gene of herpes simplex virus type 1 results in accumulation of unenveloped DNA-filled capsids in the cytoplasm of infected cells. This family only covers a small central part of this large protein.


Pssm-ID: 397577 [Multi-domain]  Cd Length: 252  Bit Score: 313.72  E-value: 5.36e-97
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   1405 ERWAADVEAALDRVENRAEFDAVELRRLQALAAQNKYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQHHPAL 1484
Cdd:pfam03586    3 ERWASDIEALLERVESGAEFDVVELRRLRDLAGTGGYDPRDFRKRAEQVVGANAKAVTLALETVLAFNPYTPENQRHPML 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   1485 PPLAAARRIDWGPAFGAAAETYAEMFRVDTEPLARLLRITGGLLDLAQAGGGFIDYHEAVSRLAEDLNGVPSLRHYVPFF 1564
Cdd:pfam03586   83 PPLAALHSITWSDAFGAAADTYTDMFGVSTEPLARLLRIAGGILERADANDGNIDYHEAVLHLSGDLGQVPALRQYVDFY 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   1565 RRGHAEYLELCDRLDALRADVHRALGGVPLDLAAAAEQTVRLRGDPAAAAELVRTGVTLACPSEDALAACVGALERVDQA 1644
Cdd:pfam03586  163 QRGYAEFVDIRARLDELRADARRAIGRVALELAAALEEIAAVRNDPEAAKEALEAGVTIPCPSEDALVACVEALKRVDQK 242
                          250
                   ....*....|
gi 30984464   1645 PVKDTAYAEH 1654
Cdd:pfam03586  243 PFEGTAYAEY 252
Herpes_teg_N pfam04843
Herpesvirus tegument protein, N-terminal conserved region;
15-185 1.72e-41

Herpesvirus tegument protein, N-terminal conserved region;


Pssm-ID: 398488 [Multi-domain]  Cd Length: 158  Bit Score: 150.99  E-value: 1.72e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464     15 RNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAW--TRASAGSDPPRMCSAVELPTFLEYPSG 92
Cdd:pfam04843    2 RHQFDCKFGPAAGSQCLSNCLSFLHSSYLNGERPVLSREALDGILEEGARLdtLLRTSGMLPPRYAQLHELPGYVRTGAW 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464     93 RGLRCVFSRLYGEVA------FFGKPApglletqcpahdffagpwarrplsYTLVTIGALGMGLYRDGDEAYLFDPHGLR 166
Cdd:pfam04843   82 GCKIRRSSEIYGLLGhelsrnFNGTPQ------------------------YCLITCGSLAMAIVIKGKTYYLFDPHCTP 137
                          170       180
                   ....*....|....*....|.
gi 30984464    167 EG--SPAFVAKIRAGEVYTYL 185
Cdd:pfam04843  138 EGnsTAAVIVTVSAGDVYEYL 158
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
455-608 6.27e-13

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 74.95  E-value: 6.27e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    455 PTPAGPT--TASSEPPTPAG------PTTASSEP---------------------PTPAGRPPTPAGRPPTP-------- 497
Cdd:pfam05109  461 PASTGPTvsTADVTSPTPAGttsgasPVTPSPSPrdngteskapdmtsptsavttPTPNATSPTPAVTTPTPnatsptlg 540
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    498 -ANPTASSEPPTPAGRPPTPAGRPPTP---------ANPTASSEPPTPNpegAPAPSSNEQPPAAASTDEATQKALDALR 567
Cdd:pfam05109  541 kTSPTSAVTTPTPNATSPTPAVTTPTPnatiptlgkTSPTSAVTTPTPN---ATSPTVGETSPQANTTNHTLGGTSSTPV 617
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|.
gi 30984464    568 DRQPPEPPCGSLTEllGRHPDTDGGVSRLAAHEAGIAREVT 608
Cdd:pfam05109  618 VTSPPKNATSAVTT--GQHNITSSSTSSMSLRPSSISETLS 656
PHA03269 PHA03269
envelope glycoprotein C; Provisional
455-574 8.15e-13

envelope glycoprotein C; Provisional


Pssm-ID: 165527  Cd Length: 566  Bit Score: 74.38  E-value: 8.15e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPA-GPTTASSEPPTPAGRPPTPAGRPPTPAN-PT-ASSEPPTPAGRPPTPAGRPPTPANPTASSE 531
Cdd:PHA03269   27 PIPELHTSAATQKPDPApAPHQAASRAPDPAVAPTSAASRKPDLAQaPTpAASEKFDPAPAPHQAASRAPDPAVAPQLAA 106
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 30984464   532 PPTPNPEGAPAPSSNEQP-PAAASTDEATQKALDALRDRQPPEP 574
Cdd:PHA03269  107 APKPDAAEAFTSAAQAHEaPADAGTSAASKKPDPAAHTQHSPPP 150
PHA03269 PHA03269
envelope glycoprotein C; Provisional
455-563 5.07e-11

envelope glycoprotein C; Provisional


Pssm-ID: 165527  Cd Length: 566  Bit Score: 68.22  E-value: 5.07e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAgPTTASSEPPTPA-GPTTASSEPPTPAGRPPTPAGRPPTPA-NPT-ASSEPPTPAGRPPTPAGRPPTPANPTASSE 531
Cdd:PHA03269   42 PAPA-PHQAASRAPDPAvAPTSAASRKPDLAQAPTPAASEKFDPApAPHqAASRAPDPAVAPQLAAAPKPDAAEAFTSAA 120
                          90       100       110
                  ....*....|....*....|....*....|..
gi 30984464   532 PPTPNPEGAPAPSSNEQPPAAASTDEATQKAL 563
Cdd:PHA03269  121 QAHEAPADAGTSAASKKPDPAAHTQHSPPPFA 152
PHA03269 PHA03269
envelope glycoprotein C; Provisional
451-534 7.47e-10

envelope glycoprotein C; Provisional


Pssm-ID: 165527  Cd Length: 566  Bit Score: 64.75  E-value: 7.47e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   451 SSEPPTPA-GPTTASSEPPTPA-GPTTASSEPPTPAGRPPTPAGRPPTPANP--TASSEPPTPAGRPPTPAGRPPTPANP 526
Cdd:PHA03269   64 ASRKPDLAqAPTPAASEKFDPApAPHQAASRAPDPAVAPQLAAAPKPDAAEAftSAAQAHEAPADAGTSAASKKPDPAAH 143

                  ....*...
gi 30984464   527 TASSEPPT 534
Cdd:PHA03269  144 TQHSPPPF 151
PHA03269 PHA03269
envelope glycoprotein C; Provisional
451-552 2.20e-09

envelope glycoprotein C; Provisional


Pssm-ID: 165527  Cd Length: 566  Bit Score: 63.21  E-value: 2.20e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   451 SSEPPTPA-GPTTASSEPPTPA-GPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTP-AGRPPTPAG-RPPTPANP 526
Cdd:PHA03269   50 ASRAPDPAvAPTSAASRKPDLAqAPTPAASEKFDPAPAPHQAASRAPDPAVAPQLAAAPKPdAAEAFTSAAqAHEAPADA 129
                          90       100
                  ....*....|....*....|....*.
gi 30984464   527 TASSEPPTPNPegaPAPSSNEQPPAA 552
Cdd:PHA03269  130 GTSAASKKPDP---AAHTQHSPPPFA 152
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
455-614 2.23e-09

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 63.19  E-value: 2.23e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTAssePPTPAGRPPTPAGRPPTPANPTASSEPPTP-AGRPPTPAGRPPTPANPTASSEPP 533
Cdd:PRK14951  366 PAAAAEAAAPAEKKTPARPEAA---APAAAPVAQAAAAPAPAAAPAAAASAPAAPpAAAPPAPVAAPAAAAPAAAPAAAP 442
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   534 TPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEPPCGSL--TELlgrHPDTDGGVSRLAAHEA--GIAREVTE 609
Cdd:PRK14951  443 AAVALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLtpTEE---GDVWHATVQQLAAAEAitALARELAL 519

                  ....*
gi 30984464   610 CSRLT 614
Cdd:PRK14951  520 QSELV 524
kgd PRK12270
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ...
468-553 1.12e-08

multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit;


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 61.44  E-value: 1.12e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   468 PTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNE 547
Cdd:PRK12270   38 PGSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDEV 117

                  ....*....
gi 30984464   548 QP---PAAA 553
Cdd:PRK12270  118 TPlrgAAAA 126
PHA03378 PHA03378
EBNA-3B; Provisional
455-575 1.23e-08

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 61.24  E-value: 1.23e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTT--------ASSEPPtPAGPTTAS--SEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPA 524
Cdd:PHA03378  676 PSPTGANTmlpiqwapGTMQPP-PRAPTPMRppAAPPGRAQRPAAATGRARPPAAAPGRARPPAAAPGRARPPAAAPGRA 754
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 30984464   525 NPTASSEPPTPNPEGAPAPSSNEQPPAAASTdeATQKALDALRDRQPPEPP 575
Cdd:PHA03378  755 RPPAAAPGRARPPAAAPGAPTPQPPPQAPPA--PQQRPRGAPTPQPPPQAG 803
PHA03269 PHA03269
envelope glycoprotein C; Provisional
488-594 2.01e-08

envelope glycoprotein C; Provisional


Pssm-ID: 165527  Cd Length: 566  Bit Score: 60.13  E-value: 2.01e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   488 PTPAgrPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQP-PAAASTDEATQK----- 561
Cdd:PHA03269   23 NTNI--PIPELHTSAATQKPDPAPAPHQAASRAPDPAVAPTSAASRKPDLAQAPTPAASEKFdPAPAPHQAASRApdpav 100
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 30984464   562 --ALDALRDRQPPEPPCGSLTellgRHPDT-DGGVS 594
Cdd:PHA03269  101 apQLAAAPKPDAAEAFTSAAQ----AHEAPaDAGTS 132
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
451-540 2.24e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 59.82  E-value: 2.24e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   451 SSEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPtpagrPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASS 530
Cdd:PRK14950  372 TAAAPSPVRPTPAPSTRPKAAAAANIPPKEPVRETATP-----PPVPPRPVAPPVPHTPESAPKLTRAAIPVDEKPKYTP 446
                          90
                  ....*....|
gi 30984464   531 EPPTPNPEGA 540
Cdd:PRK14950  447 PAPPKEEEKA 456
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
366-573 2.41e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 60.00  E-value: 2.41e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   366 SAGRHHPKRASLPTRTRRSARHAATPFSRGSGGDEQTRPAAGPRPPTPASrpptPGAPPTPGAPPTPGAPPTPGAPPTPA 445
Cdd:PRK07764  591 APGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEAS----AAPAPGVAAPEHHPKHVAVPDASDGG 666
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   446 GPTTASSEPPTPAGPTTASSEPPTPAGPTTASSEP-PTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPA 524
Cdd:PRK07764  667 DGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPaPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPD 746
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 30984464   525 NPTASSEPP--TPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPE 573
Cdd:PRK07764  747 DPPDPAGAPaqPPPPPAPAPAAAPAAAPPPSPPSEEEEMAEDDAPSMDDED 797
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
487-575 3.18e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 59.44  E-value: 3.18e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   487 PPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPAAASTDEATQKALDAL 566
Cdd:PRK14950  363 VPAPQPAKPTAAAPSPVRPTPAPSTRPKAAAAANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAPKLTRAAIPVDEKP 442

                  ....*....
gi 30984464   567 RDRQPPEPP 575
Cdd:PRK14950  443 KYTPPAPPK 451
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
386-602 3.37e-08

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 59.50  E-value: 3.37e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   386 RHAATPFSRGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTA-- 463
Cdd:PRK12323  359 RMLAFRPGQSGGGAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAArq 438
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   464 --SSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAP 541
Cdd:PRK12323  439 asARGPGGAPAPAPAPAAAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAP 518
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 30984464   542 APSSNEQPPAAASTDEATQKALDALRDRQPPEPPCGSLTELLGRHPDTDGGVSRLAAHEAG 602
Cdd:PRK12323  519 AGWVAESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDMFDG 579
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
349-568 3.72e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 59.23  E-value: 3.72e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   349 SKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFSRGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGA 428
Cdd:PRK07764  592 PGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPA 671
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   429 PPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPT 508
Cdd:PRK07764  672 KAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDP 751
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   509 PAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRD 568
Cdd:PRK07764  752 AGAPAQPPPPPAPAPAAAPAAAPPPSPPSEEEEMAEDDAPSMDDEDRRDAEEVAMELLEE 811
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
454-571 3.78e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 59.23  E-value: 3.78e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   454 PPTPAGPTTASSEPPTPAGPTTASSEPPT---PAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRP-PTPANPTAS 529
Cdd:PRK07764  399 PSAAAAAPAAAPAPAAAAPAAAAAPAPAAapqPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAPaPAAAPEPTA 478
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 30984464   530 SEPPTPNPEGAPAPSsnEQPPAAASTDEATQkALDALRDRQP 571
Cdd:PRK07764  479 APAPAPPAAPAPAAA--PAAPAAPAAPAGAD-DAATLRERWP 517
fibronec_FbpA NF033913
LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described ...
460-555 8.01e-08

LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.


Pssm-ID: 411474 [Multi-domain]  Cd Length: 386  Bit Score: 57.38  E-value: 8.01e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   460 PTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRP---------PTPANPTAss 530
Cdd:NF033913  168 PSSETPAPSIPALPEAPAQSAESEEPSVAASSEETPSPETPAAPETPEEPAAPAPSPESEPsvaasseetPSPSTPAA-- 245
                          90       100
                  ....*....|....*....|....*.
gi 30984464   531 ePPTPNPEGAPA-PSSNEQPPAAAST 555
Cdd:NF033913  246 -PETPAESEAPAqPAESEESSVAATT 270
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
453-555 1.27e-07

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 57.61  E-value: 1.27e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTPAgpttasSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPtpanptasSEPPTPAGRPPTPAGRPPTPANPTASSEP 532
Cdd:NF033930  355 GPDGDE------EETPAPAPQPEQPAPAPAPAPKPEQPAPAPK--------PEKPADQQAEEDYARRSEEEYNRLTQQQP 420
                          90       100
                  ....*....|....*....|....
gi 30984464   533 PTP-NPEGAPAPSSnEQPPAAAST 555
Cdd:NF033930  421 PKAeKPAPAPAPKP-EQPAPAPKT 443
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
384-575 1.35e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 57.69  E-value: 1.35e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   384 SARHAATPFSRGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTA 463
Cdd:PRK07764  594 AAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKA 673
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   464 SSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAP 543
Cdd:PRK07764  674 GGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPAG 753
                         170       180       190
                  ....*....|....*....|....*....|..
gi 30984464   544 SSNEQPPAAASTDEATQKALDALRDRQPPEPP 575
Cdd:PRK07764  754 APAQPPPPPAPAPAAAPAAAPPPSPPSEEEEM 785
PHA03378 PHA03378
EBNA-3B; Provisional
454-566 1.56e-07

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 57.38  E-value: 1.56e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   454 PPTPAGPTTASSEP-PTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEP-PTPAGRPPTPAGRPPTPANPTASSE 531
Cdd:PHA03378  710 PPGRAQRPAAATGRaRPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPGRaRPPAAAPGAPTPQPPPQAPPAPQQR 789
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 30984464   532 P-----PTPNPEGAPAPSSnEQPPAAASTDEATQKALDAL 566
Cdd:PHA03378  790 PrgaptPQPPPQAGPTSMQ-LMPRAAPGQQGPTKQILRQL 828
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
385-572 1.72e-07

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 57.19  E-value: 1.72e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   385 ARHAATPFSRGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTAS 464
Cdd:PRK12323  375 ATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAPAP 454
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   465 SEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPT------------ASSEP 532
Cdd:PRK12323  455 AAAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAApagwvaesipdpATADP 534
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 30984464   533 PTPNPEGAPAPSSNEQPPAAASTDE-ATQKALDALRDRQPP 572
Cdd:PRK12323  535 DDAFETLAPAPAAAPAPRAAAATEPvVAPRPPRASASGLPD 575
kgd PRK12270
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ...
480-559 2.52e-07

multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit;


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 56.82  E-value: 2.52e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   480 PPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPAAASTDEAT 559
Cdd:PRK12270   39 GSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDEVT 118
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
455-592 2.54e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 56.53  E-value: 2.54e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPT 534
Cdd:PRK07764  615 PAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPA 694
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 30984464   535 PNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEPPCGSLTELLGRHPDTDGG 592
Cdd:PRK07764  695 GAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPA 752
PHA03291 PHA03291
envelope glycoprotein I; Provisional
452-576 2.64e-07

envelope glycoprotein I; Provisional


Pssm-ID: 223033  Cd Length: 401  Bit Score: 55.73  E-value: 2.64e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   452 SEPPTPAGPTTASSEPptpAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPP-TPAGRPPTPANPTASS 530
Cdd:PHA03291  173 AAPPLGEGSADGSCDP---ALPLSAPRLGPADVFVPATPRPTPRTTASPETTPTPSTTTSPPStTIPAPSTTIAAPQAGT 249
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 30984464   531 EPPTPNPEGAPAPSSNEQPPAAAS-TDEATQKALDALRDRQPPEPPC 576
Cdd:PHA03291  250 TPEAEGTPAPPTPGGGEAPPANATpAPEASRYELTVTQIIQIAIPAS 296
gliding_GltJ NF033761
adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also ...
403-574 3.00e-07

adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.


Pssm-ID: 411345 [Multi-domain]  Cd Length: 671  Bit Score: 56.38  E-value: 3.00e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   403 RPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGapptpagpttassePPTPAGPTTASSEPPTPAGPTTASSEPPT 482
Cdd:NF033761  395 RSQPPPTPAPVVAPAPPPAPAPPPPPPPAAAQPPPPP--------------AATPPAAATAAATPAAPPAAAPAAAAPAA 460
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   483 PaGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPAN---PTASSEPPTPNPEGAPAPSSNEQPPAAASTDEAT 559
Cdd:NF033761  461 A-GTPPAAPAAAPTPPPAPKAAEPPAAAPAAPARVARPERRTTrrrTSSSRRVPAPTAPVDAEPAPAPKPAPSSSSFGSG 539
                         170
                  ....*....|....*
gi 30984464   560 QKALDALRDRQPPEP 574
Cdd:NF033761  540 DDDFDELFGTKKPKP 554
fibronec_FbpA NF033913
LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described ...
431-551 4.06e-07

LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.


Pssm-ID: 411474 [Multi-domain]  Cd Length: 386  Bit Score: 55.07  E-value: 4.06e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   431 TPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGPTTassePPTPAGRPPTPAGRPPTPANPTASSEPPTPA 510
Cdd:NF033913  169 SSETPAPSIPALPEAPAQSAESEEPSVAASSEETPSPETPAAPET----PEEPAAPAPSPESEPSVAASSEETPSPSTPA 244
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 30984464   511 GrPPTPAgRPPTPANPTASSEPP-----TPNPEgAPAPSSNEQPPA 551
Cdd:NF033913  245 A-PETPA-ESEAPAQPAESEESSvaattSPSPS-TPAESETQTPPA 287
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
452-606 5.79e-07

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 55.27  E-value: 5.79e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   452 SEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPA-NPTASSEPPTPAGRPPTPAGRPPTPANPTASS 530
Cdd:PRK12323  383 AQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPApEALAAARQASARGPGGAPAPAPAPAAAPAAAA 462
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 30984464   531 EPPTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEPPCGSLTELLGRHPDTDG-GVSRLAAHEAGIARE 606
Cdd:PRK12323  463 RPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAeSIPDPATADPDDAFE 539
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
403-568 6.12e-07

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 55.63  E-value: 6.12e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   403 RPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAG---------PTTASSEPPTPAGP 473
Cdd:PRK07003  380 VPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATAdrgddaadgDAPVPAKANARASA 459
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   474 TTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRP-PTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPAA 552
Cdd:PRK07003  460 DSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPsAATPAAVPDARAPAAASREDAPAAAAPPAPEARPPTPAA 539
                         170
                  ....*....|....*....
gi 30984464   553 ASTDE---ATQKALDALRD 568
Cdd:PRK07003  540 AAPAAragGAAAALDVLRN 558
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
451-628 8.06e-07

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 54.88  E-value: 8.06e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   451 SSEPPTPAGPTTASSEPPTPAGPTTASSEPPT--PAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTA 528
Cdd:PRK12323  400 AAPPAAPAAAPAAAAAARAVAAAPARRSPAPEalAAARQASARGPGGAPAPAPAPAAAPAAAARPAAAGPRPVAAAAAAA 479
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   529 ssePPTPNPEGAPAPSSNEQPPAAASTDEATQKALDALrDRQPPEPPCGSLTELLGRHPDTDGGVSRLAAHEAGIAREVT 608
Cdd:PRK12323  480 ---PARAAPAAAPAPADDDPPPWEELPPEFASPAPAQP-DAAPAGWVAESIPDPATADPDDAFETLAPAPAAAPAPRAAA 555
                         170       180
                  ....*....|....*....|
gi 30984464   609 ECSRLTinALRSPFPGSPGL 628
Cdd:PRK12323  556 ATEPVV--APRPPRASASGL 573
kgd PRK12270
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ...
451-529 9.55e-07

multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit;


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 54.90  E-value: 9.55e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 30984464   451 SSEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTAS 529
Cdd:PRK12270   40 STAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDEVT 118
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
393-575 9.67e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 54.61  E-value: 9.67e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   393 SRGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPTPAG 472
Cdd:PRK07764  591 APGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWP 670
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   473 PTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTP-NPEGAPAPSSNEQPPA 551
Cdd:PRK07764  671 AKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPaADDPVPLPPEPDDPPD 750
                         170       180
                  ....*....|....*....|....
gi 30984464   552 AASTDEATQKALDALRDRQPPEPP 575
Cdd:PRK07764  751 PAGAPAQPPPPPAPAPAAAPAAAP 774
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
463-565 1.06e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 54.43  E-value: 1.06e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   463 ASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPP-TPAGRPPTPANPTASSEPPTPNPEGAP 541
Cdd:PRK14950  358 ALLVPVPAPQPAKPTAAAPSPVRPTPAPSTRPKAAAAANIPPKEPVRETATPpPVPPRPVAPPVPHTPESAPKLTRAAIP 437
                          90       100
                  ....*....|....*....|....
gi 30984464   542 APSSNEQPPAAASTDEatQKALDA 565
Cdd:PRK14950  438 VDEKPKYTPPAPPKEE--EKALIA 459
FAP pfam07174
Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment ...
454-523 1.88e-06

Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix.


Pssm-ID: 399866  Cd Length: 301  Bit Score: 52.60  E-value: 1.88e-06
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    454 PPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTP 523
Cdd:pfam07174   42 EPAPPPPSTATAPPAPPPPPPAPAAPAPPPPPAAPNAPNPPPPPADPNAPPPPPADPNAPPPPAVDPNAP 111
PHA03378 PHA03378
EBNA-3B; Provisional
455-575 1.98e-06

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 53.92  E-value: 1.98e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEP----PTPAGPTTasSEPPTPAGRPPTPAGRPPTPANPTASsePPTPAGRPPTPAGR-PPTPANPTAS 529
Cdd:PHA03378  659 ITPYKPTWTQIGHipyqPSPTGANT--MLPIQWAPGTMQPPPRAPTPMRPPAA--PPGRAQRPAAATGRaRPPAAAPGRA 734
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 30984464   530 SEP---PTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEPP 575
Cdd:PHA03378  735 RPPaaaPGRARPPAAAPGRARPPAAAPGRARPPAAAPGAPTPQPPPQAP 783
PTZ00144 PTZ00144
dihydrolipoamide succinyltransferase; Provisional
470-534 2.16e-06

dihydrolipoamide succinyltransferase; Provisional


Pssm-ID: 240289 [Multi-domain]  Cd Length: 418  Bit Score: 53.15  E-value: 2.16e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 30984464   470 PAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPT 534
Cdd:PTZ00144  125 PAAAPAAAAAAKAEKTTPEKPKAAAPTPEPPAASKPTPPAAAKPPEPAPAAKPPPTPVARADPRE 189
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
453-552 2.72e-06

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 53.40  E-value: 2.72e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAgRPPTPANPTASSEP---PTPAG-------RPPTPAGRPPT 522
Cdd:NF033804  876 EPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPDQP-EPSKPEEPTYETEKplePAPVApsyenepTPPVKTPDQPE 954
                          90       100       110
                  ....*....|....*....|....*....|
gi 30984464   523 PANPTASSEPPTPNPEGAPAPSSNEQPPAA 552
Cdd:NF033804  955 PSKPVEPTYDPLPTPPVAPTPKQLPTPPAV 984
FAP pfam07174
Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment ...
473-558 4.09e-06

Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix.


Pssm-ID: 399866  Cd Length: 301  Bit Score: 51.44  E-value: 4.09e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    473 PTTASSEPPtPAGRPPTPAGRPPTPANPTA--SSEPPTPAGRPPTPAGRPPTPANPTASSEPPTpNPEGAPAPSSNEQPP 550
Cdd:pfam07174   34 PAVAHADPE-PAPPPPSTATAPPAPPPPPPapAAPAPPPPPAAPNAPNPPPPPADPNAPPPPPA-DPNAPPPPAVDPNAP 111

                   ....*...
gi 30984464    551 AAASTDEA 558
Cdd:pfam07174  112 EPGRIDNA 119
kgd PRK12270
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ...
454-535 4.14e-06

multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit;


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 52.97  E-value: 4.14e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   454 PPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPP 533
Cdd:PRK12270   38 PGSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDEV 117

                  ..
gi 30984464   534 TP 535
Cdd:PRK12270  118 TP 119
fibronec_FbpA NF033913
LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described ...
455-573 4.34e-06

LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.


Pssm-ID: 411474 [Multi-domain]  Cd Length: 386  Bit Score: 51.99  E-value: 4.34e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPP---TPAGPT-----------TASSEPPTPAGRPPTPA--GRPPTPANPTASSEPPTPAGRPPTPAg 518
Cdd:NF033913  126 PASTEPTTQPVEASvqeTQASASdsmvtddstsvTTDSPEETPSSETPAPSipALPEAPAQSAESEEPSVAASSEETPS- 204
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 30984464   519 rPPTPANPTASSEP--PTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPE 573
Cdd:NF033913  205 -PETPAAPETPEEPaaPAPSPESEPSVAASSEETPSPSTPAAPETPAESEAPAQPAE 260
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
455-549 4.67e-06

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 52.63  E-value: 4.67e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPagRPPTPAGRPPTPANPTASSE--- 531
Cdd:NF033804  865 PTPPVKTPDQPEPSKPEEPTYETEKPLEPAPVAPTYENEPTPPVKTPDQPEPSKP--EEPTYETEKPLEPAPVAPSYene 942
                          90       100
                  ....*....|....*....|
gi 30984464   532 --PPTPNPEgAPAPSSNEQP 549
Cdd:NF033804  943 ptPPVKTPD-QPEPSKPVEP 961
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
470-575 4.74e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 52.68  E-value: 4.74e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   470 PAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQP 549
Cdd:PRK07764  386 GVAGGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQ 465
                          90       100
                  ....*....|....*....|....*.
gi 30984464   550 PAAASTDEATQKALDALRDRQPPEPP 575
Cdd:PRK07764  466 PAPAPAAAPEPTAAPAPAPPAAPAPA 491
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
455-602 5.12e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 52.30  E-value: 5.12e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGrPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEP-P 533
Cdd:PRK07764  590 PAPGAAGGEGPPAPASSGPPEEAARPAAPAA-PAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGdG 668
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 30984464   534 TPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEPPCGSLTELLGRHPDTDGGVSRLAAHEAG 602
Cdd:PRK07764  669 WPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADD 737
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
397-598 7.36e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 51.91  E-value: 7.36e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   397 GGDEQTRPAAGPRPPTPASRPPTPGAPPTPGapptpgapptpgapptpagpTTASSEPPTPAGPTTASSEPPTPAGPTTA 476
Cdd:PRK07764  589 GPAPGAAGGEGPPAPASSGPPEEAARPAAPA--------------------APAAPAAPAPAGAAAAPAEASAAPAPGVA 648
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   477 SSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPAAASTD 556
Cdd:PRK07764  649 APEHHPKHVAVPDASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGA 728
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 30984464   557 EATQKALDALRDRQPPEPPCGSLTELLGRHPDTDGGVSRLAA 598
Cdd:PRK07764  729 SAPSPAADDPVPLPPEPDDPPDPAGAPAQPPPPPAPAPAAAP 770
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
353-578 9.69e-06

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 51.71  E-value: 9.69e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   353 RPTWTPPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFSR---GSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAP 429
Cdd:PHA03307  193 PPPSTPPAAASPRPPRRSSPISASASSPAPAPGRSAADDAGAsssDSSSSESSGCGWGPENECPLPRPAPITLPTRIWEA 272
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   430 PTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGP------------TTASSEPPTPAGRPPTPA-GRPPT 496
Cdd:PHA03307  273 SGWNGPSSRPGPASSSSSPRERSPSPSPSSPGSGPAPSSPRASSsssssresssssTSSSSESSRGAAVSPGPSpSRSPS 352
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   497 PANPTASSEPPTPAGRPPtPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPA-----AASTDEATQKALDALRDRQP 571
Cdd:PHA03307  353 PSRPPPPADPSSPRKRPR-PSRAPSSPAASAGRPTRRRARAAVAGRARRRDATGRfpagrPRPSPLDAGAASGAFYARYP 431

                  ....*..
gi 30984464   572 PEPPCGS 578
Cdd:PHA03307  432 LLTPSGE 438
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
356-569 1.02e-05

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 51.46  E-value: 1.02e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    356 WTPPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFSRGSGgdeqTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAP 435
Cdd:pfam05109  439 FAAPNTTTGLPSSTHVPTNLTAPASTGPTVSTADVTSPTPAG----TTSGASPVTPSPSPRDNGTESKAPDMTSPTSAVT 514
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    436 PTPGAPPTPAGPTtaSSEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPT--PANPTASSEPPTPAGRP 513
Cdd:pfam05109  515 TPTPNATSPTPAV--TTPTPNATSPTLGKTSPTSAVTTPTPNATSPTPAVTTPTPNATIPTlgKTSPTSAVTTPTPNATS 592
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 30984464    514 PTpAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDR 569
Cdd:pfam05109  593 PT-VGETSPQANTTNHTLGGTSSTPVVTSPPKNATSAVTTGQHNITSSSTSSMSLR 647
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
451-574 1.03e-05

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 51.61  E-value: 1.03e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   451 SSEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRP--PTPAGRPPTPANPTA 528
Cdd:PTZ00449  517 SGLPPKAPGDKEGEEGEHEDSKESDEPKEGGKPGETKEGEVGKKPGPAKEHKPSKIPTLSKKPefPKDPKHPKDPEEPKK 596
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 30984464   529 SSEPPTPN-PEGAPAPssneQPPAAASTDEATQKALDALRDRQPPEP 574
Cdd:PTZ00449  597 PKRPRSAQrPTRPKSP----KLPELLDIPKSPKRPESPKSPKRPPPP 639
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
451-554 1.28e-05

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 50.86  E-value: 1.28e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   451 SSEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTP-AGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTAS 529
Cdd:PLN02217  563 AGNPGSTNSTPTGSAASSNTTFSSDSPSTVVAPSTSPPAGhLGSPPATPSKIVSPSTSPPASHLGSPSTTPSSPESSIKV 642
                          90       100
                  ....*....|....*....|....*
gi 30984464   530 SEPPTPNPEGAPAPSSNEQPPAAAS 554
Cdd:PLN02217  643 ASTETASPESSIKVASTESSVSMVS 667
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
337-574 3.37e-05

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 49.85  E-value: 3.37e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   337 LPRPNQHYPLGFSKRRRPTWTPPSSLedlSAGRHHPKRASLPTRTRRSARHAATPfsRGSGGDEQTRPAAGPRPPTPASR 416
Cdd:PRK07003  380 VPAPGARAAAAVGASAVPAVTAVTGA---AGAALAPKAAAAAAATRAEAPPAAPA--PPATADRGDDAADGDAPVPAKAN 454
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   417 PPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPT--PAGPTTASSEPPTPAGRPPTPAGRP 494
Cdd:PRK07003  455 ARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVpdARAPAAASREDAPAAAAPPAPEARP 534
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   495 PTPANPTA----------------------SSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPeGAPAPSSNEQPPAA 552
Cdd:PRK07003  535 PTPAAAAPaaraggaaaaldvlrnagmrvsSDRGARAAAAAKPAAAPAAAPKPAAPRVAVQVPTP-RARAATGDAPPNGA 613
                         250       260
                  ....*....|....*....|..
gi 30984464   553 ASTDEATQkaldalrDRQPPEP 574
Cdd:PRK07003  614 ARAEQAAE-------SRGAPPP 628
PRK14971 PRK14971
DNA polymerase III subunit gamma/tau;
461-570 3.56e-05

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 49.39  E-value: 3.56e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   461 TTASSEPPTPAGPTTASSEPPT-PAGRPPTPAGRPPTPANPTASSEPPTPAGRP-PTPAGRPPT-PANPTASSE---PPT 534
Cdd:PRK14971  363 TQKGDDASGGRGPKQHIKPVFTqPAAAPQPSAAAAASPSPSQSSAAAQPSAPQSaTQPAGTPPTvSVDPPAAVPvnpPST 442
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 30984464   535 PNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQ 570
Cdd:PRK14971  443 APQAVRPAQFKEEKKIPVSKVSSLGPSTLRPIQEKA 478
PRK14971 PRK14971
DNA polymerase III subunit gamma/tau;
458-558 3.91e-05

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 49.39  E-value: 3.91e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   458 AGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTpanptASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNP 537
Cdd:PRK14971  388 AAPQPSAAAAASPSPSQSSAAAQPSAPQSATQPAGTPPT-----VSVDPPAAVPVNPPSTAPQAVRPAQFKEEKKIPVSK 462
                          90       100
                  ....*....|....*....|...
gi 30984464   538 EGAPAPSSNE--QPPAAASTDEA 558
Cdd:PRK14971  463 VSSLGPSTLRpiQEKAEQATGNI 485
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
395-554 4.53e-05

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 49.46  E-value: 4.53e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   395 GSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPT--PAGPTTASSEPPTPAG 472
Cdd:PRK07003  366 GAPGGGVPARVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPaaPAPPATADRGDDAADG 445
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   473 PTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPAA 552
Cdd:PRK07003  446 DAPVPAKANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARAPAAASREDAPAAA 525

                  ..
gi 30984464   553 AS 554
Cdd:PRK07003  526 AP 527
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
393-578 5.72e-05

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 49.01  E-value: 5.72e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   393 SRGSGGDEQTRPAA--GPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEP-----------PTPAG 459
Cdd:PHA03307   13 AAAEGGEFFPRPPAtpGDAADDLLSGSQGQLVSDSAELAAVTVVAGAAACDRFEPPTGPPPGPGteapanesrstPTWSL 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   460 PTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEG 539
Cdd:PHA03307   93 STLAPASPAREGSPTPPGPSSPDPPPPTPPPASPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRQA 172
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 30984464   540 APAPSSNEQPPAAASTDEATQKALDALRDRQPPEPPCGS 578
Cdd:PHA03307  173 ALPLSSPEETARAPSSPPAEPPPSTPPAAASPRPPRRSS 211
kgd PRK12270
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ...
493-573 7.06e-05

multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit;


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 48.73  E-value: 7.06e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   493 RPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPnPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPP 572
Cdd:PRK12270   37 GPGSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAA-PAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVED 115

                  .
gi 30984464   573 E 573
Cdd:PRK12270  116 E 116
kgd PRK12270
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ...
487-565 7.37e-05

multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit;


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 48.73  E-value: 7.37e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 30984464   487 PPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSneqPPAAASTDEATQKALDA 565
Cdd:PRK12270   40 STAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAA---PPAAAAAAAPAAAAVED 115
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
451-574 7.64e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 48.32  E-value: 7.64e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   451 SSEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASS 530
Cdd:PRK07994  365 LPEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAARQQLQRAQGATKAKKSEPA 444
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 30984464   531 EPPTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEP 574
Cdd:PRK07994  445 AASRARPVNSALERLASVRPAPSALEKAPAKKEAYRWKATNPVE 488
PRK12495 PRK12495
hypothetical protein; Provisional
452-540 8.52e-05

hypothetical protein; Provisional


Pssm-ID: 183558 [Multi-domain]  Cd Length: 226  Bit Score: 46.79  E-value: 8.52e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   452 SEPPTPAGPTTaSSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSE 531
Cdd:PRK12495   88 SDAGSQASPDD-DAQPAAEAEAADQSAPPEASSTSATDEAATDPPATAAARDGPTPDPTAQPATPDERRSPRQRPPVSGE 166

                  ....*....
gi 30984464   532 PPTPNPEGA 540
Cdd:PRK12495  167 PPTPSTPDA 175
FAP pfam07174
Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment ...
471-553 9.23e-05

Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix.


Pssm-ID: 399866  Cd Length: 301  Bit Score: 47.21  E-value: 9.23e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    471 AGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPagrPPTPANPTASSEPPTPNPEGAPAPSS---NE 547
Cdd:pfam07174   24 AGASAVAVALPAVAHADPEPAPPPPSTATAPPAPPPPPPAPAAPAP---PPPPAAPNAPNPPPPPADPNAPPPPPadpNA 100

                   ....*.
gi 30984464    548 QPPAAA 553
Cdd:pfam07174  101 PPPPAV 106
gliding_GltJ NF033761
adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also ...
315-575 9.25e-05

adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.


Pssm-ID: 411345 [Multi-domain]  Cd Length: 671  Bit Score: 48.30  E-value: 9.25e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   315 SDSA-----GGDDAEDDEDGAMEVVS-----PLPRPNQHYPLGFSKRRRPTWTP-PSSLEDLSAGRHHPKRASLPTRTRR 383
Cdd:NF033761  251 EEDVgwkpsAASVLASLVKEENEALSkpppaPAPVPEREPPSASRLLDLPPPPPePVSSPSPGAPATGAAPAPMPAAPQP 330
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   384 SARHA-ATPFSRGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTT 462
Cdd:NF033761  331 APAYAqPAPQPYQPAPYPPPGYPGAYPPAAVAPGAGGKRGLIVGIVAGVLLLVGGAGAGFWAGGRSQPPPTPAPVVAPAP 410
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   463 ASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTAS---SEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEG 539
Cdd:NF033761  411 PPAPAPPPPPPPAAAQPPPPPAATPPAAATAAATPAAPPAAapaAAAPAAAGTPPAAPAAAPTPPPAPKAAEPPAAAPAA 490
                         250       260       270
                  ....*....|....*....|....*....|....*.
gi 30984464   540 APAPSSNEQPPAAASTDEATQKALDALRDRQPPEPP 575
Cdd:NF033761  491 PARVARPERRTTRRRTSSSRRVPAPTAPVDAEPAPA 526
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
404-578 1.03e-04

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 48.31  E-value: 1.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   404 PAAGPRPPTP-ASRPPTPGAPPTPGAPPTPGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGPTTASSEPPT 482
Cdd:PRK07003  368 PGGGVPARVAgAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATADRGDDAADGDA 447
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   483 PAgRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAgrPPTPANPTASSEPPT-PNPEGAPAPSSNEQPPAAASTDEATQK 561
Cdd:PRK07003  448 PV-PAKANARASADSRCDERDAQPPADSGSASAPA--SDAPPDAAFEPAPRAaAPSAATPAAVPDARAPAAASREDAPAA 524
                         170
                  ....*....|....*..
gi 30984464   562 ALDALRDRQPPEPPCGS 578
Cdd:PRK07003  525 AAPPAPEARPPTPAAAA 541
PHA03246 PHA03246
large tegument protein UL36; Provisional
3189-3287 1.05e-04

large tegument protein UL36; Provisional


Pssm-ID: 223020  Cd Length: 3095  Bit Score: 48.43  E-value: 1.05e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  3189 LGSLDPETDpetDPFAHPPDPRAPEAgDRASPSSYfgpppLSANAALSRRYVRSTGRSALAVLIEACWRIRRQLRMTRHA 3268
Cdd:PHA03246 3004 LSSTDSDSD---DSRSTVYNSNSTDT-DMSSTSRV-----IIADTLLTRRDFRKASRGALYALTKACEKIARQITQTRDQ 3074
                          90
                  ....*....|....*....
gi 30984464  3269 LLNRSGAVLTGLYHVRMLL 3287
Cdd:PHA03246 3075 LRSRVITLAIEIFKIKMLL 3093
kgd PRK12270
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ...
486-564 1.08e-04

multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit;


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 48.35  E-value: 1.08e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 30984464   486 RPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPAAASTDEATQKALD 564
Cdd:PRK12270   37 GPGSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVED 115
dnaA PRK14086
chromosomal replication initiator protein DnaA;
455-627 1.41e-04

chromosomal replication initiator protein DnaA;


Pssm-ID: 237605 [Multi-domain]  Cd Length: 617  Bit Score: 47.51  E-value: 1.41e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTP-ANPTASSE--PPTPAGRPPTPAGRPP--TPANPTAS 529
Cdd:PRK14086   98 PPPHARRTSEPELPRPGRRPYEGYGGPRADDRPPGLPRQDQLPtARPAYPAYqqRPEPGAWPRAADDYGWqqQRLGFPPR 177
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   530 SEPPTPNPEgAPAPSSNEQPPAAASTDEATQKAlDALRDRQPPEPPCGSLTELLGRHPDTDGgvsrlAAHEAGIAREVTE 609
Cdd:PRK14086  178 APYASPASY-APEQERDREPYDAGRPEYDQRRR-DYDHPRPDWDRPRRDRTDRPEPPPGAGH-----VHRGGPGPPERDD 250
                         170
                  ....*....|....*...
gi 30984464   610 CSRLTInalRSPFPGSPG 627
Cdd:PRK14086  251 APVVPI---RPSAPGPLA 265
Vip_LPXTG_Lm NF033201
cell invasion LPXTG protein Vip; Vip (Virulence protein), like the LPXTG-type internalins, is ...
453-555 1.47e-04

cell invasion LPXTG protein Vip; Vip (Virulence protein), like the LPXTG-type internalins, is an LPXTG-anchored surface protein of the mammalian cell-invading pathogen Listeria monocytogenes, but absent from the related species Listeria innocua. For certain cell types, Vip is required for Listeria's ability to invade. It appears to bind the endoplasmic reticulum (ER) resident chaperone Gp96 as its receptor.


Pssm-ID: 380203 [Multi-domain]  Cd Length: 414  Bit Score: 47.19  E-value: 1.47e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTPAGPTTASSEPPTPAGPTTassePPTPAgrpptpagrPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSeP 532
Cdd:NF033201  264 ERSKPVTPPKNDPETDNPEEPVT----PVDPA---------TPTPDEPSTPTDPATPTPDEPSTPTDPATPEKPEITT-P 329
                          90       100
                  ....*....|....*....|...
gi 30984464   533 PTPNPEGAPAPSSNEQPPAAAST 555
Cdd:NF033201  330 ENPESTVVESDSSENEPEKSADS 352
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
458-558 1.72e-04

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 46.87  E-value: 1.72e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   458 AGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPP--TPANPTASSEPPTPAGRPPTPAGRPPTPAnPTASSEPPTP 535
Cdd:PTZ00436  227 AAPAKAAAPPAKAAAAPAKAAAAPAKAAAPPAKAAAPPakAAAPPAKAAAPPAKAAAPPAKAAAPPAKA-AAAPAKAAAA 305
                          90       100
                  ....*....|....*....|...
gi 30984464   536 NPEGAPAPSSNEQPPAAASTDEA 558
Cdd:PTZ00436  306 PAKAAAAPAKAAAPPAKAAAPPA 328
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
453-574 1.81e-04

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 47.23  E-value: 1.81e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTPAGPTTASSEPPTPaGPTTASSEPPTP-----AGRPPTPAGRPPTPAnPTASSEPPTPAGR-----PPT-PAGRPP 521
Cdd:PLN03209  381 KPPTSPIPTPPSSSPASS-KSVDAVAKPAEPdvvpsPGSASNVPEVEPAQV-EAKKTRPLSPYARyedlkPPTsPSPTAP 458
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 30984464   522 TPANPTA---SSEPPTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEP 574
Cdd:PLN03209  459 TGVSPSVsstSSVPAVPDTAPATAATDAAAPPPANMRPLSPYAVYDDLKPPTSPSP 514
PRK10856 PRK10856
cytoskeleton protein RodZ;
474-563 1.85e-04

cytoskeleton protein RodZ;


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 46.56  E-value: 1.85e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   474 TTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPAN--PTASSEPPTPNPEGAPAPSSNEQppA 551
Cdd:PRK10856  165 DTSTTTDPATTPAPAAPVDTTPTNSQTPAVATAPAPAVDPQQNAVVAPSQANvdTAATPAPAAPATPDGAAPLPTDQ--A 242
                          90
                  ....*....|..
gi 30984464   552 AASTDEATQKAL 563
Cdd:PRK10856  243 GVSTPAADPNAL 254
kgd PRK12270
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ...
453-534 1.94e-04

multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit;


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 47.19  E-value: 1.94e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAgrPPTPANPTASSEPPTPAGRPPT------PAGRppTPANP 526
Cdd:PRK12270   56 SAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAA--APAAPPAAAAAAAPAAAAVEDEvtplrgAAAA--VAKNM 131

                  ....*...
gi 30984464   527 TASSEPPT 534
Cdd:PRK12270  132 DASLEVPT 139
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
453-574 1.96e-04

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 47.15  E-value: 1.96e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSE- 531
Cdd:PRK07003  359 EPAVTGGGAPGGGVPARVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATADr 438
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 30984464   532 --PPTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEP 574
Cdd:PRK07003  439 gdDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPASD 483
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
451-579 2.01e-04

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 46.84  E-value: 2.01e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   451 SSEPPTPAGP--TTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTpagrPPTPAGRPPTPANPTA 528
Cdd:PLN03209  451 TSPSPTAPTGvsPSVSSTSSVPAVPDTAPATAATDAAAPPPANMRPLSPYAVYDDLKPPT----SPSPAAPVGKVAPSST 526
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 30984464   529 SSEPPTPNPEGAPAPSSNEQppaaasTDEATQKALDAL---RDRQPPEPPCGSL 579
Cdd:PLN03209  527 NEVVKVGNSAPPTALADEQH------HAQPKPRPLSPYtmyEDLKPPTSPTPSP 574
fibronec_FbpA NF033913
LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described ...
2974-3063 2.30e-04

LPXTG-anchored fibronectin-binding protein FbpA; FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.


Pssm-ID: 411474 [Multi-domain]  Cd Length: 386  Bit Score: 46.59  E-value: 2.30e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  2974 PTPPSKPPAFFQPSLATGGSVAPGGDfRRRAPSRPtaAVPAAPSRPPArrlARPAVSRSTESFALP--PDELARPRTPEA 3051
Cdd:NF033913  181 PEAPAQSAESEEPSVAASSEETPSPE-TPAAPETP--EEPAAPAPSPE---SEPSVAASSEETPSPstPAAPETPAESEA 254
                          90
                  ....*....|..
gi 30984464  3052 PAPPTETEEAPV 3063
Cdd:NF033913  255 PAQPAESEESSV 266
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
452-575 2.50e-04

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 46.84  E-value: 2.50e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   452 SEPPTPAGPTTAssEPPTPAGPTTASSEPPTPAGR--PPTPAGRPPTPANPTASSE---PPTpAGRPPTPAGRPPTPANP 526
Cdd:PLN03209  325 SQRVPPKESDAA--DGPKPVPTKPVTPEAPSPPIEeePPQPKAVVPRPLSPYTAYEdlkPPT-SPIPTPPSSSPASSKSV 401
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 30984464   527 TASSEPPTPNPEGAPAPSSNEQPPAAASTDEATQKALD---ALRDRQPPEPP 575
Cdd:PLN03209  402 DAVAKPAEPDVVPSPGSASNVPEVEPAQVEAKKTRPLSpyaRYEDLKPPTSP 453
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
457-575 2.55e-04

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 46.78  E-value: 2.55e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   457 PAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAgrPPTPANPTASSEPPTPN 536
Cdd:PRK07994  361 PAAPLPEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQ--LLAARQQLQRAQGATKA 438
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 30984464   537 PEGAPAPSSNEQPPAAASTDEAtqkALDALRDRQPPEPP 575
Cdd:PRK07994  439 KKSEPAAASRARPVNSALERLA---SVRPAPSALEKAPA 474
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
453-527 2.64e-04

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 46.86  E-value: 2.64e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 30984464   453 EPPTPAGPTTASSEP--PTPAGPTTaSSEPPTPAGRPPTPagRPPTPANPTASSEPPTPAGrpPTPAGRPPTPANPT 527
Cdd:NF033804  915 EPSKPEEPTYETEKPlePAPVAPSY-ENEPTPPVKTPDQP--EPSKPVEPTYDPLPTPPVA--PTPKQLPTPPAVPT 986
flhF PRK06995
flagellar biosynthesis protein FlhF;
456-561 2.71e-04

flagellar biosynthesis protein FlhF;


Pssm-ID: 235904 [Multi-domain]  Cd Length: 484  Bit Score: 46.50  E-value: 2.71e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   456 TPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTpaNPTASSEPPTP-AGRPPTPAGRPPTPANPTASSEPPT 534
Cdd:PRK06995   52 APPAAAAPAAAQPPPAAAPAAVSRPAAPAAEPAPWLVEHAK--RLTAQREQLVArAAAPAAPEAQAPAAPAERAAAENAA 129
                          90       100
                  ....*....|....*....|....*....
gi 30984464   535 PNPEGAP--APSSNEQPPAAASTDEATQK 561
Cdd:PRK06995  130 RRLARAAaaAPRPRVPADAAAAVADAVKA 158
PRK13042 PRK13042
superantigen-like protein SSL4; Reviewed;
461-538 2.85e-04

superantigen-like protein SSL4; Reviewed;


Pssm-ID: 183854  Cd Length: 291  Bit Score: 45.78  E-value: 2.85e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 30984464   461 TTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTP-AGRPPTPANPTASSEPPTPNPE 538
Cdd:PRK13042   24 TTQAANATTPSSTKVEAPQSTPPSTKVEAPQSKPNATTPPSTKVEAPQQTPNATTPsSTKVETPQSPTTKQVPTEINPK 102
PLN02983 PLN02983
biotin carboxyl carrier protein of acetyl-CoA carboxylase
463-550 2.99e-04

biotin carboxyl carrier protein of acetyl-CoA carboxylase


Pssm-ID: 215533  Cd Length: 274  Bit Score: 45.60  E-value: 2.99e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   463 ASSEPPTPAgpTTASSEPPTPAGRPPTPagrpPTPANPTASSEPPTPAGRPPTPAgrpptPANPTASSEPPTPNPEG--- 539
Cdd:PLN02983  140 ALPQPPPPA--PVVMMQPPPPHAMPPAS----PPAAQPAPSAPASSPPPTPASPP-----PAKAPKSSHPPLKSPMAgtf 208
                          90
                  ....*....|...
gi 30984464   540 --APAPSsneQPP 550
Cdd:PLN02983  209 yrSPAPG---EPP 218
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
404-569 3.28e-04

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 46.52  E-value: 3.28e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   404 PAAGPRPPTPASRPPTpgapptpgapptpgapptpgapptpagpttASSEPPTPAGPTTASSEPPTPAGPTTA-SSEPPT 482
Cdd:PRK07764  392 GAPAAAAPSAAAAAPA------------------------------AAPAPAAAAPAAAAAPAPAAAPQPAPApAPAPAP 441
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   483 PAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNeqPPAAASTDEATQKA 562
Cdd:PRK07764  442 PSPAGNAPAGGAPSPPPAAAPSAQPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAG--ADDAATLRERWPEI 519

                  ....*..
gi 30984464   563 LDALRDR 569
Cdd:PRK07764  520 LAAVPKR 526
kgd PRK12270
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ...
502-583 3.30e-04

multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit;


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 46.42  E-value: 3.30e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   502 ASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEPPCGSLTE 581
Cdd:PRK12270   39 GSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDEVT 118

                  ..
gi 30984464   582 LL 583
Cdd:PRK12270  119 PL 120
PHA02682 PHA02682
ORF080 virion core protein; Provisional
461-571 3.30e-04

ORF080 virion core protein; Provisional


Pssm-ID: 177464 [Multi-domain]  Cd Length: 280  Bit Score: 45.62  E-value: 3.30e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   461 TTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPT-------PAGRPPTPANPTASSE-- 531
Cdd:PHA02682   69 NSACMQRPSGQSPLAPSPACAAPAPACPACAPAAPAPAVTCPAPAPACPPATAPTcpppavcPAPARPAPACPPSTRQcp 148
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 30984464   532 --PPTPNPEGAPAP---------SSNEQPPAAASTDEATQKALDALRDRQP 571
Cdd:PHA02682  149 paPPLPTPKPAPAAkpiflhnqlPPPDYPAASCPTIETAPAASPVLEPRIP 199
Pro-rich pfam15240
Proline-rich; This family includes several eukaryotic proline-rich proteins.
454-526 3.34e-04

Proline-rich; This family includes several eukaryotic proline-rich proteins.


Pssm-ID: 405837 [Multi-domain]  Cd Length: 167  Bit Score: 43.87  E-value: 3.34e-04
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 30984464    454 PPTPAGPTTASSE---PPTPAGPTTASS-EPPTPAGRPPTPAGRPPTPANPtaSSEPPTPAGRPPTPAGRPPTPANP 526
Cdd:pfam15240   88 PPPQGGPRPPPGKpqgPPPQGGNQQQGPpPPGKPQGPPPQGGGPPPQGGNQ--QGPPPPPPGNPQGPPQRPPQPGNP 162
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
466-575 3.39e-04

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 46.38  E-value: 3.39e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   466 EPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGrpPTPANPTASSEPPTPNPEGAPAPSS 545
Cdd:PRK07003  359 EPAVTGGGAPGGGVPARVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALA--PKAAAAAAATRAEAPPAAPAPPATA 436
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 30984464   546 NE-----QPPAAASTDEATQKALDALRDRQPPEPP 575
Cdd:PRK07003  437 DRgddaaDGDAPVPAKANARASADSRCDERDAQPP 471
PRK03427 PRK03427
cell division protein ZipA; Provisional
453-552 3.45e-04

cell division protein ZipA; Provisional


Pssm-ID: 235124 [Multi-domain]  Cd Length: 333  Bit Score: 45.80  E-value: 3.45e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   453 EPPTP-AGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAgrpPTPAGRPPTPANPTASSE 531
Cdd:PRK03427   93 QPPYAsAQPRQPVQQPPEAQVPPQHAPRPAQPAPQPVQQPAYQPQPEQPLQQPVSPQVA---PAPQPVHSAPQPAQQAFQ 169
                          90       100
                  ....*....|....*....|.
gi 30984464   532 PPTPNPEGAPAPSSNEQPPAA 552
Cdd:PRK03427  170 PAEPVAAPQPEPVAEPAPVMD 190
PRK10856 PRK10856
cytoskeleton protein RodZ;
455-546 3.51e-04

cytoskeleton protein RodZ;


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 45.79  E-value: 3.51e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEpPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPT 534
Cdd:PRK10856  161 SVPLDTSTTTDPATTPAPAAPVDTT-PTNSQTPAVATAPAPAVDPQQNAVVAPSQANVDTAATPAPAAPATPDGAAPLPT 239
                          90
                  ....*....|...
gi 30984464   535 PN-PEGAPAPSSN 546
Cdd:PRK10856  240 DQaGVSTPAADPN 252
Pro-rich pfam15240
Proline-rich; This family includes several eukaryotic proline-rich proteins.
453-578 3.74e-04

Proline-rich; This family includes several eukaryotic proline-rich proteins.


Pssm-ID: 405837 [Multi-domain]  Cd Length: 167  Bit Score: 43.87  E-value: 3.74e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    453 EPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEP 532
Cdd:pfam15240   36 EGQSQQGGQGPQGPPPGGFPPQPPASDDPPGPPPPGGPQQPPPQGGKQKPQGPPPQGGPRPPPGKPQGPPPQGGNQQQGP 115
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 30984464    533 PTPNPEGAPAPSSNEQPPAAASTdeatqkaldalrdRQPPEPPCGS 578
Cdd:pfam15240  116 PPPGKPQGPPPQGGGPPPQGGNQ-------------QGPPPPPPGN 148
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
358-584 3.76e-04

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 46.32  E-value: 3.76e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   358 PPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFsrGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPGAPPtpgappt 437
Cdd:PHA03307   31 AADDLLSGSQGQLVSDSAELAAVTVVAGAAACDRF--EPPTGPPPGPGTEAPANESRSTPTWSLSTLAPASPA------- 101
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   438 pgaPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPA 517
Cdd:PHA03307  102 ---REGSPTPPGPSSPDPPPPTPPPASPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRQAALPLSS 178
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 30984464   518 GRPPTPANPTASSEPPT-PNPEGAPAPSSNEQPPAAASTDEATQKALDALRDRQPPEPPCGSLTELLG 584
Cdd:PHA03307  179 PEETARAPSSPPAEPPPsTPPAAASPRPPRRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSG 246
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
505-575 3.96e-04

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 46.06  E-value: 3.96e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 30984464   505 EPPTPAGRPPTPAGRPPTPANPTAssepPTPNPEG-APAPSSNEQPPAAASTDEA--TQKALDALRDRQPPEPP 575
Cdd:NF033930  355 GPDGDEEETPAPAPQPEQPAPAPA----PAPKPEQpAPAPKPEKPADQQAEEDYArrSEEEYNRLTQQQPPKAE 424
PRK10856 PRK10856
cytoskeleton protein RodZ;
471-554 4.90e-04

cytoskeleton protein RodZ;


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 45.02  E-value: 4.90e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   471 AGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAG-RPPTPANPTASSEPPTPNPegAPAPSSNEQP 549
Cdd:PRK10856  169 TTDPATTPAPAAPVDTTPTNSQTPAVATAPAPAVDPQQNAVVAPSQANvDTAATPAPAAPATPDGAAP--LPTDQAGVST 246

                  ....*
gi 30984464   550 PAAAS 554
Cdd:PRK10856  247 PAADP 251
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
338-526 5.43e-04

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 45.64  E-value: 5.43e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   338 PRPNQHYPLGFSKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFSRGSGGDEQTRPAAGPRPPTPASRP 417
Cdd:PRK12323  385 PAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAPAPAAAPAAAARP 464
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   418 PTPGAPPTPGapptPGAPPTPGAPPTPAGPTTASSEPP---TPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRP 494
Cdd:PRK12323  465 AAAGPRPVAA----AAAAAPARAAPAAAPAPADDDPPPweeLPPEFASPAPAQPDAAPAGWVAESIPDPATADPDDAFET 540
                         170       180       190
                  ....*....|....*....|....*....|..
gi 30984464   495 PTPAnPTASSEPPTPAGRPPTPAGRPPTPANP 526
Cdd:PRK12323  541 LAPA-PAAAPAPRAAAATEPVVAPRPPRASAS 571
DedD COG3147
Cell division protein DedD (periplasmic protein involved in septation) [Cell cycle control, ...
455-548 5.52e-04

Cell division protein DedD (periplasmic protein involved in septation) [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225689 [Multi-domain]  Cd Length: 226  Bit Score: 44.11  E-value: 5.52e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464  455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPP---TPANPTASSEPPTPAGRPPTpagrPPTPANPTASSE 531
Cdd:COG3147   58 PAVVQVVALPTQPPEGVAQEIQDAGDAAAASVDPQPVAQPPvesTPAGVPVAAQTPKPVKPPKQ----PPAGAVPAKPTP 133
                         90
                 ....*....|....*..
gi 30984464  532 PPTPNPEGAPAPSSNEQ 548
Cdd:COG3147  134 KPEPKPVAEPAAAPTGQ 150
PRK10905 PRK10905
cell division protein DamX; Validated
461-562 6.78e-04

cell division protein DamX; Validated


Pssm-ID: 236792 [Multi-domain]  Cd Length: 328  Bit Score: 44.54  E-value: 6.78e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   461 TTASSEPPTPAgPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPagrPPTPANPTASSEPPTPN-PEG 539
Cdd:PRK10905  121 STLPTEPATVA-PVRNGNASRQTAKTQTAERPATTRPARKQAVIEPKKPQATAKTE---PKPVAQTPKRTEPAAPVaSTK 196
                          90       100
                  ....*....|....*....|...
gi 30984464   540 APAPSSNEQPPAAASTDEATQKA 562
Cdd:PRK10905  197 APAATSTPAPKETATTAPVQTAS 219
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
456-565 7.09e-04

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 44.94  E-value: 7.09e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   456 TPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPAN--PTASSEPPTPAGRPPTPAGRPPTPANPTASSEPP 533
Cdd:PTZ00436  232 AAAPPAKAAAAPAKAAAAPAKAAAPPAKAAAPPAKAAAPPAKAAapPAKAAAPPAKAAAPPAKAAAAPAKAAAAPAKAAA 311
                          90       100       110
                  ....*....|....*....|....*....|..
gi 30984464   534 TPNPEGAPaPSSNEQPPAAASTDEATQKALDA 565
Cdd:PTZ00436  312 APAKAAAP-PAKAAAPPAKAATPPAKAAAPPA 342
opacity_OapA NF033909
opacity-associated protein OapA; This family consists of full-length homologs to OapA, ...
455-562 7.80e-04

opacity-associated protein OapA; This family consists of full-length homologs to OapA, opacity-associated protein A as described in Haemophilus influenzae. OapA shares a C-terminal homology domain, called the OapA domain, with the Escherichia coli protein YtfB, which is now known to bind peptidoglycan through its OapA domain and to act as a cell division protein.


Pssm-ID: 411470 [Multi-domain]  Cd Length: 421  Bit Score: 44.85  E-value: 7.80e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPP-TPANPTASSEPPTPAGRPPTPAG--RPPTPANPTASSE 531
Cdd:NF033909  192 PPAQNDNAAAQTNQAENAPKAAEPNNATAVEPQAENAGSTQqATEQTTTTAAENKPEPVKPAQTEpvKAVEVSKVQETVK 271
                          90       100       110
                  ....*....|....*....|....*....|....
gi 30984464   532 PP-TPNPEGAPAPSSNEQP--PAAASTDEATQKA 562
Cdd:NF033909  272 PKvAQEDVKKEEPKVAEKAkpPTKKTEQTVAKTA 305
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
465-554 8.96e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 44.91  E-value: 8.96e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464    465 SEPPTPAGPTTASSEPPTPAGRP-----PTPAGRPPT--PANPTASSEPPTPAG-----RPPTPAGRP---------PTP 523
Cdd:pfam05109  427 STTTSPTLNTTGFAAPNTTTGLPssthvPTNLTAPAStgPTVSTADVTSPTPAGttsgaSPVTPSPSPrdngteskaPDM 506
                           90       100       110
                   ....*....|....*....|....*....|.
gi 30984464    524 ANPTASSEPPTPNPEgAPAPSSNEQPPAAAS 554
Cdd:pfam05109  507 TSPTSAVTTPTPNAT-SPTPAVTTPTPNATS 536
PTZ00144 PTZ00144
dihydrolipoamide succinyltransferase; Provisional
455-535 1.19e-03

dihydrolipoamide succinyltransferase; Provisional


Pssm-ID: 240289 [Multi-domain]  Cd Length: 418  Bit Score: 44.29  E-value: 1.19e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   455 PTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPAGRPPTPAGRpptpANPTASSEPPT 534
Cdd:PTZ00144  120 TGGAPPAAAPAAAAAAKAEKTTPEKPKAAAPTPEPPAASKPTPPAAAKPPEPAPAAKPPPTPVAR----ADPRETRVPMS 195

                  .
gi 30984464   535 P 535
Cdd:PTZ00144  196 R 196
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
454-581 1.25e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 44.46  E-value: 1.25e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984464   454 PPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPAGRPPTP----</