NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|20137701|sp|O73881|]
View 

RecName: Full=Bublin coiled-coil protein; AltName: Full=UPF0184 protein C9orf16 homolog

Protein Classification

UPF0184 family protein (domain architecture ID 10508482)

UPF0184 family protein similar to Homo sapiens protein C9orf16

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
UPF0184 pfam03670
Uncharacterized protein family (UPF0184);
1-84 1.98e-30

Uncharacterized protein family (UPF0184);


:

Pssm-ID: 112485  Cd Length: 83  Bit Score: 103.49  E-value: 1.98e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20137701     1 MSGPNGDPNISVEDGLINDDDDFGSEEYEAINSMLDQINSYLDDLEERNDSLNGKLHELMESNRQARLEFRAQLSnHTPQ 80
Cdd:pfam03670   1 MSGPNGDDPSSVEDGGNTNVDEFGLQEYEAINSMLDQINSALDALEERNDDLMSQLRELLESNRQIRLEFAEQLD-NAPE 79

                  ....
gi 20137701    81 EDSA 84
Cdd:pfam03670  80 SGSD 83
 
Name Accession Description Interval E-value
UPF0184 pfam03670
Uncharacterized protein family (UPF0184);
1-84 1.98e-30

Uncharacterized protein family (UPF0184);


Pssm-ID: 112485  Cd Length: 83  Bit Score: 103.49  E-value: 1.98e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20137701     1 MSGPNGDPNISVEDGLINDDDDFGSEEYEAINSMLDQINSYLDDLEERNDSLNGKLHELMESNRQARLEFRAQLSnHTPQ 80
Cdd:pfam03670   1 MSGPNGDDPSSVEDGGNTNVDEFGLQEYEAINSMLDQINSALDALEERNDDLMSQLRELLESNRQIRLEFAEQLD-NAPE 79

                  ....
gi 20137701    81 EDSA 84
Cdd:pfam03670  80 SGSD 83
 
Name Accession Description Interval E-value
UPF0184 pfam03670
Uncharacterized protein family (UPF0184);
1-84 1.98e-30

Uncharacterized protein family (UPF0184);


Pssm-ID: 112485  Cd Length: 83  Bit Score: 103.49  E-value: 1.98e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20137701     1 MSGPNGDPNISVEDGLINDDDDFGSEEYEAINSMLDQINSYLDDLEERNDSLNGKLHELMESNRQARLEFRAQLSnHTPQ 80
Cdd:pfam03670   1 MSGPNGDDPSSVEDGGNTNVDEFGLQEYEAINSMLDQINSALDALEERNDDLMSQLRELLESNRQIRLEFAEQLD-NAPE 79

                  ....
gi 20137701    81 EDSA 84
Cdd:pfam03670  80 SGSD 83
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH