NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|61230203|sp|P0A288|]
View 

RecName: Full=Peptide chain release factor 1; Short=RF-1

Protein Classification

peptide chain release factor 1 (domain architecture ID 11479061)

peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
prfA PRK00591
peptide chain release factor 1; Validated
2-358 0e+00

peptide chain release factor 1; Validated


:

Pssm-ID: 234801  Cd Length: 359  Bit Score: 677.18  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    2 KPSIVAKLEALHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMML---DDPEMREMA 78
Cdd:PRK00591   1 KPSMLDKLEALEERYEELEALLSDPEVISDQKRFRKLSKEYAELEPIVEAYREYKQAQEDLEEAKEMLeeeSDPEMREMA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   79 QEELREAKEKSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGG 158
Cdd:PRK00591  81 KEELKELEERLEELEEELKILLLPKDPNDDKNVILEIRAGTGGDEAALFAGDLFRMYSRYAERQGWKVEILSASEGELGG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  159 YKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAElPDINPADLRIDTFRSSGAGGQHVN 238
Cdd:PRK00591 161 YKEVIAEISGDGVYSKLKFESGVHRVQRVPATESQGRIHTSAATVAVLPEAEEVE-VEINPKDLRIDTFRSSGAGGQHVN 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  239 TTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRVT 318
Cdd:PRK00591 240 TTDSAVRITHLPTGIVVECQDERSQHKNKAKAMKVLRARLYDAERQKAQAEEAATRKSQVGSGDRSERIRTYNFPQGRVT 319
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|
gi 61230203  319 DHRINLTLYRLDETMEGKLDMLIEPIVQEHQADLLAALSE 358
Cdd:PRK00591 320 DHRINLTLYKLDEVMEGDLDELIDALIAEDQAEKLAALGE 359
 
Name Accession Description Interval E-value
prfA PRK00591
peptide chain release factor 1; Validated
2-358 0e+00

peptide chain release factor 1; Validated


Pssm-ID: 234801  Cd Length: 359  Bit Score: 677.18  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    2 KPSIVAKLEALHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMML---DDPEMREMA 78
Cdd:PRK00591   1 KPSMLDKLEALEERYEELEALLSDPEVISDQKRFRKLSKEYAELEPIVEAYREYKQAQEDLEEAKEMLeeeSDPEMREMA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   79 QEELREAKEKSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGG 158
Cdd:PRK00591  81 KEELKELEERLEELEEELKILLLPKDPNDDKNVILEIRAGTGGDEAALFAGDLFRMYSRYAERQGWKVEILSASEGELGG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  159 YKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAElPDINPADLRIDTFRSSGAGGQHVN 238
Cdd:PRK00591 161 YKEVIAEISGDGVYSKLKFESGVHRVQRVPATESQGRIHTSAATVAVLPEAEEVE-VEINPKDLRIDTFRSSGAGGQHVN 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  239 TTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRVT 318
Cdd:PRK00591 240 TTDSAVRITHLPTGIVVECQDERSQHKNKAKAMKVLRARLYDAERQKAQAEEAATRKSQVGSGDRSERIRTYNFPQGRVT 319
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|
gi 61230203  319 DHRINLTLYRLDETMEGKLDMLIEPIVQEHQADLLAALSE 358
Cdd:PRK00591 320 DHRINLTLYKLDEVMEGDLDELIDALIAEDQAEKLAALGE 359
PrfA COG0216
Protein chain release factor A [Translation, ribosomal structure and biogenesis];
1-359 0e+00

Protein chain release factor A [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223294  Cd Length: 363  Bit Score: 628.86  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   1 MKPSIVAKLEALHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMMLD---DPEMREM 77
Cdd:COG0216   1 MKPSLLEKLESLLERYEELEALLSDPEVISDPDEYRKLSKEYAELEPIVEKYREYKKAQEDLEDAKEMLAeekDPEMREM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  78 AQEELREAKEKSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHG 157
Cdd:COG0216  81 AEEEIKELEAKIEELEEELKILLLPKDPNDDKNIILEIRAGTGGDEAALFAGDLFRMYSRYAESKGWKVEILSASESELG 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203 158 GYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAELPDINPADLRIDTFRSSGAGGQHV 237
Cdd:COG0216 161 GYKEIIASISGKGVYSRLKFESGVHRVQRVPATESQGRIHTSAATVAVLPEVEEVEEIEINPKDLRIDTFRSSGAGGQHV 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203 238 NTTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRV 317
Cdd:COG0216 241 NTTDSAVRITHLPTGIVVECQDERSQHKNKAKAMKVLRARLYDAERQKAQAEEASERKSQVGSGDRSERIRTYNFPQNRV 320
                       330       340       350       360
                ....*....|....*....|....*....|....*....|...
gi 61230203 318 TDHRINLTLYRLDETME-GKLDMLIEPIVQEHQADLLAALSEQ 359
Cdd:COG0216 321 TDHRINLTLYKLDEVMEgGKLDEIIDALIAEDQAEQLAELGEQ 363
prfA TIGR00019
peptide chain release factor 1; This model describes peptide chain release factor 1 (PrfA, ...
1-359 0e+00

peptide chain release factor 1; This model describes peptide chain release factor 1 (PrfA, RF-1), and excludes the related peptide chain release factor 2 (PrfB, RF-2). RF-1 helps recognize and terminate translation at UAA and UAG stop codons. The mitochondrial release factors are prfA-like, although not included above the trusted cutoff for this model. RF-1 does not have a translational frameshift. [Protein synthesis, Translation factors]


Pssm-ID: 129130  Cd Length: 360  Bit Score: 603.61  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203     1 MKPSIVAKLEALHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMMLD--DPEMREMA 78
Cdd:TIGR00019   1 MKPSLLEKLESLLERYEELEALLSDPEVISDQDKLRKLSKEYSQLEEIVDCYREYQQAQEDIKEAKEILEesDPEMREMA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    79 QEELREAKEKSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGG 158
Cdd:TIGR00019  81 KEELEELEEKIEELEEQLKVLLLPKDPNDEKNVILEIRAGTGGDEAAIFAGDLFRMYSRYAESKGWKVEILSANETELGG 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   159 YKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAElPDINPADLRIDTFRSSGAGGQHVN 238
Cdd:TIGR00019 161 YKEVIAEIKGDGVYSRLKFESGVHRVQRVPVTESQGRIHTSAATVAVMPELEEVE-VDINPADLRIDTFRSSGAGGQHVN 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   239 TTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRVT 318
Cdd:TIGR00019 240 TTDSAVRITHLPTGIVVECQDERSQHKNKDKAMKVLRARLYEAEQEKQQAAQASTRKSQVGSGDRSERIRTYNFPQNRVT 319
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|.
gi 61230203   319 DHRINLTLYRLDETMEGKLDMLIEPIVQEHQADLLAALSEQ 359
Cdd:TIGR00019 320 DHRINLTLYKLDEVLEGDLDELIEALIAEDQAQQLAALSEE 360
PCRF pfam03462
PCRF domain; This domain is found in peptide chain release factors.
12-203 5.99e-109

PCRF domain; This domain is found in peptide chain release factors.


Pssm-ID: 397500  Cd Length: 192  Bit Score: 316.25  E-value: 5.99e-109
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    12 LHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMMLDDPEMREMAQEELREAKEKSEQ 91
Cdd:pfam03462   1 LEERYEELEALLSDPDVWDDQERAQKLSKEYSELEPVVEAYREYKQALEDLEEAKELLEDPELAELAEEELEELEKRLEE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    92 LEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGGYKEIIAKISGDGV 171
Cdd:pfam03462  81 LEEELKLLLLPKDPNDDKNAILEIRAGAGGDEAALFAGDLFRMYTRYAERKGWKVEVLDYSETEAGGIKEATFEISGEGA 160
                         170       180       190
                  ....*....|....*....|....*....|..
gi 61230203   172 YGRLKFESGGHRVQRVPATESQGRIHTSACTV 203
Cdd:pfam03462 161 YGRLKFESGVHRVQRVPPTESQGRIHTSFATV 192
PCRF smart00937
This domain is found in peptide chain release factors;
68-178 1.63e-54

This domain is found in peptide chain release factors;


Pssm-ID: 214923 [Multi-domain]  Cd Length: 116  Bit Score: 174.57  E-value: 1.63e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203     68 MLDDPEMREMAQEELREAKEKSEQLEQQLQVLL-LPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRV 146
Cdd:smart00937   5 EEEDDEMRELAEEELEELEAELEEELEELLKLLlLPKDPNDDKNAILEIRAGAGGDEAALFAGDLLRMYLRYAERKGWKV 84
                           90       100       110
                   ....*....|....*....|....*....|..
gi 61230203    147 EIMSMSEGEHGGYKEIIAKISGDGVYGRLKFE 178
Cdd:smart00937  85 EVLDESEGELGGIKEATLKISGEGAYGKLKFE 116
 
Name Accession Description Interval E-value
prfA PRK00591
peptide chain release factor 1; Validated
2-358 0e+00

peptide chain release factor 1; Validated


Pssm-ID: 234801  Cd Length: 359  Bit Score: 677.18  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    2 KPSIVAKLEALHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMML---DDPEMREMA 78
Cdd:PRK00591   1 KPSMLDKLEALEERYEELEALLSDPEVISDQKRFRKLSKEYAELEPIVEAYREYKQAQEDLEEAKEMLeeeSDPEMREMA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   79 QEELREAKEKSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGG 158
Cdd:PRK00591  81 KEELKELEERLEELEEELKILLLPKDPNDDKNVILEIRAGTGGDEAALFAGDLFRMYSRYAERQGWKVEILSASEGELGG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  159 YKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAElPDINPADLRIDTFRSSGAGGQHVN 238
Cdd:PRK00591 161 YKEVIAEISGDGVYSKLKFESGVHRVQRVPATESQGRIHTSAATVAVLPEAEEVE-VEINPKDLRIDTFRSSGAGGQHVN 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  239 TTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRVT 318
Cdd:PRK00591 240 TTDSAVRITHLPTGIVVECQDERSQHKNKAKAMKVLRARLYDAERQKAQAEEAATRKSQVGSGDRSERIRTYNFPQGRVT 319
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|
gi 61230203  319 DHRINLTLYRLDETMEGKLDMLIEPIVQEHQADLLAALSE 358
Cdd:PRK00591 320 DHRINLTLYKLDEVMEGDLDELIDALIAEDQAEKLAALGE 359
PrfA COG0216
Protein chain release factor A [Translation, ribosomal structure and biogenesis];
1-359 0e+00

Protein chain release factor A [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223294  Cd Length: 363  Bit Score: 628.86  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   1 MKPSIVAKLEALHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMMLD---DPEMREM 77
Cdd:COG0216   1 MKPSLLEKLESLLERYEELEALLSDPEVISDPDEYRKLSKEYAELEPIVEKYREYKKAQEDLEDAKEMLAeekDPEMREM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  78 AQEELREAKEKSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHG 157
Cdd:COG0216  81 AEEEIKELEAKIEELEEELKILLLPKDPNDDKNIILEIRAGTGGDEAALFAGDLFRMYSRYAESKGWKVEILSASESELG 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203 158 GYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAELPDINPADLRIDTFRSSGAGGQHV 237
Cdd:COG0216 161 GYKEIIASISGKGVYSRLKFESGVHRVQRVPATESQGRIHTSAATVAVLPEVEEVEEIEINPKDLRIDTFRSSGAGGQHV 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203 238 NTTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRV 317
Cdd:COG0216 241 NTTDSAVRITHLPTGIVVECQDERSQHKNKAKAMKVLRARLYDAERQKAQAEEASERKSQVGSGDRSERIRTYNFPQNRV 320
                       330       340       350       360
                ....*....|....*....|....*....|....*....|...
gi 61230203 318 TDHRINLTLYRLDETME-GKLDMLIEPIVQEHQADLLAALSEQ 359
Cdd:COG0216 321 TDHRINLTLYKLDEVMEgGKLDEIIDALIAEDQAEQLAELGEQ 363
prfA TIGR00019
peptide chain release factor 1; This model describes peptide chain release factor 1 (PrfA, ...
1-359 0e+00

peptide chain release factor 1; This model describes peptide chain release factor 1 (PrfA, RF-1), and excludes the related peptide chain release factor 2 (PrfB, RF-2). RF-1 helps recognize and terminate translation at UAA and UAG stop codons. The mitochondrial release factors are prfA-like, although not included above the trusted cutoff for this model. RF-1 does not have a translational frameshift. [Protein synthesis, Translation factors]


Pssm-ID: 129130  Cd Length: 360  Bit Score: 603.61  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203     1 MKPSIVAKLEALHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMMLD--DPEMREMA 78
Cdd:TIGR00019   1 MKPSLLEKLESLLERYEELEALLSDPEVISDQDKLRKLSKEYSQLEEIVDCYREYQQAQEDIKEAKEILEesDPEMREMA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    79 QEELREAKEKSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGG 158
Cdd:TIGR00019  81 KEELEELEEKIEELEEQLKVLLLPKDPNDEKNVILEIRAGTGGDEAAIFAGDLFRMYSRYAESKGWKVEILSANETELGG 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   159 YKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAElPDINPADLRIDTFRSSGAGGQHVN 238
Cdd:TIGR00019 161 YKEVIAEIKGDGVYSRLKFESGVHRVQRVPVTESQGRIHTSAATVAVMPELEEVE-VDINPADLRIDTFRSSGAGGQHVN 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   239 TTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRVT 318
Cdd:TIGR00019 240 TTDSAVRITHLPTGIVVECQDERSQHKNKDKAMKVLRARLYEAEQEKQQAAQASTRKSQVGSGDRSERIRTYNFPQNRVT 319
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|.
gi 61230203   319 DHRINLTLYRLDETMEGKLDMLIEPIVQEHQADLLAALSEQ 359
Cdd:TIGR00019 320 DHRINLTLYKLDEVLEGDLDELIEALIAEDQAQQLAALSEE 360
PCRF pfam03462
PCRF domain; This domain is found in peptide chain release factors.
12-203 5.99e-109

PCRF domain; This domain is found in peptide chain release factors.


Pssm-ID: 397500  Cd Length: 192  Bit Score: 316.25  E-value: 5.99e-109
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    12 LHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMMLDDPEMREMAQEELREAKEKSEQ 91
Cdd:pfam03462   1 LEERYEELEALLSDPDVWDDQERAQKLSKEYSELEPVVEAYREYKQALEDLEEAKELLEDPELAELAEEELEELEKRLEE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    92 LEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGGYKEIIAKISGDGV 171
Cdd:pfam03462  81 LEEELKLLLLPKDPNDDKNAILEIRAGAGGDEAALFAGDLFRMYTRYAERKGWKVEVLDYSETEAGGIKEATFEISGEGA 160
                         170       180       190
                  ....*....|....*....|....*....|..
gi 61230203   172 YGRLKFESGGHRVQRVPATESQGRIHTSACTV 203
Cdd:pfam03462 161 YGRLKFESGVHRVQRVPPTESQGRIHTSFATV 192
prfB PRK00578
peptide chain release factor 2; Validated
8-342 3.11e-95

peptide chain release factor 2; Validated


Pssm-ID: 234799  Cd Length: 367  Bit Score: 287.94  E-value: 3.11e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203    8 KLEALHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMML---DDPEMREMAQEELRE 84
Cdd:PRK00578  24 DVDALKERLEELEAEAEDPDFWNDQERAQKVTKELSSLKAKLDTLEELRQRLDDLEELLELAeeeDDEETLAEAEAELKA 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   85 AKEKSEQLEQQLQVlllpKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGGYKEIIA 164
Cdd:PRK00578 104 LEKKLAALELERLL----SGEYDANNAILTIHAGAGGTEAQDWASMLLRMYLRWAERHGFKVEVLDYSEGEEAGIKSATF 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  165 KISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAELPDINPADLRIDTFRSSGAGGQHVNTTDSAI 244
Cdd:PRK00578 180 KIKGPYAYGYLKSETGVHRLVRISPFDSAGRRHTSFASVEVYPEVDDTIEIEINPKDLRIDTYRSSGAGGQHVNKTDSAV 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  245 RITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTRrnllgsGDRSDRN-----RTYNF-PQGRVT 318
Cdd:PRK00578 260 RITHIPTGIVVQCQNERSQHQNKASAMKMLKAKLYELELEKRAAEKDALK------GEKKEIGwgsqiRSYVLhPYQMVK 333
                        330       340
                 ....*....|....*....|....
gi 61230203  319 DHRINLTLYRLDETMEGKLDMLIE 342
Cdd:PRK00578 334 DLRTGYETGNTQAVLDGDLDGFIE 357
PrfB COG1186
Protein chain release factor B [Translation, ribosomal structure and biogenesis];
111-342 1.62e-72

Protein chain release factor B [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224107  Cd Length: 239  Bit Score: 225.19  E-value: 1.62e-72
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203 111 AFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPAT 190
Cdd:COG1186   1 AYLTIHAGAGGTEAQDWASMLLRMYTRWAERKGFKVEVLDTSDGEEAGIKSATLKIKGENAYGYLKTETGVHRLVRISPF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203 191 ESQGRIHTSACTVAVMPELPEAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKA 270
Cdd:COG1186  81 DSNGRRHTSFASVEVFPELDISIEIEIPDDDLRIDTYRASGAGGQHVNKTDSAVRLTHLPTGIVVLCQNERSQHLNKALA 160
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 61230203 271 LSVLGARIHAAETAKRQQA----EASTRRNLLGSGDRSDRNRTYNfpqgRVTDHRINLTLYRLDETMEGKLDMLIE 342
Cdd:COG1186 161 RKMLKGKLYILAQEKRSQEknreRALKKLIGWGNQIRSYVLDPYQ----PTKDLRTGVERRNKSKVLDGDKDGFIK 232
PRK08787 PRK08787
peptide chain release factor 2; Provisional
45-342 6.84e-66

peptide chain release factor 2; Provisional


Pssm-ID: 136970  Cd Length: 313  Bit Score: 211.06  E-value: 6.84e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   45 LSDVSRcFTDWQQVQDDIETAQMMLDDPEMREMAQEELREAKEKSEQLeqqlqvlllpkdpdDERNAFLEVRAGTGGDEA 124
Cdd:PRK08787  16 LADAGE-LLDLAESEQDEDTALAVIADLDKYQAHVEKLEFQRMFSGQM--------------DGANAFVDIQAGAGGTEA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  125 ALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVA 204
Cdd:PRK08787  81 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  205 VMPELPEAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETA 284
Cdd:PRK08787 161 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 240
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 61230203  285 KR---QQAEASTRRNlLGSGDRSdrnRTYNFPQGRVTDHRINLTLYRLDETMEGKLDMLIE 342
Cdd:PRK08787 241 KRnaeKDALEATKSD-IGWGSQI---RNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVE 297
PRK07342 PRK07342
peptide chain release factor 2; Provisional
25-342 5.00e-65

peptide chain release factor 2; Provisional


Pssm-ID: 235997  Cd Length: 339  Bit Score: 209.35  E-value: 5.00e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   25 DAGIIADQDRFRALSREYAQLSDV---SRCFTdwQQVQDDIETAQM--MLDDPEMREMAQEELREAKEKSEQLEQQLQVL 99
Cdd:PRK07342   5 DPSLWNDAQEAQKLMRERQQLDDSingINHLE--QTLNDNIELIAMgeEEGDKSIVEDAEKTIRDLKDEIDRRQIDALLS 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  100 LLpKDPDDernAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGGYKEIIAKISGDGVYGRLKFES 179
Cdd:PRK07342  83 GE-ADAND---TYLEVHAGAGGTESQDWASMLLRMYTRWAERQGRKVEVLEVHDGEEAGIKSATILVKGHNAYGWLKTES 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  180 GGHRVQRVPATESQGRIHTSACTVAVMPELPEAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQD 259
Cdd:PRK07342 159 GVHRLVRISPYDSNARRHTSFASIWVYPVIDDNIEVDVNESDVRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVQCQQ 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  260 ERSQHKNKAKALSVLGARIHAAETAKRQQ---AEASTRRNlLGSGDRSdrnRTYNF-PQGRVTDHRINLTLYRLDETMEG 335
Cdd:PRK07342 239 ERSQHKNRAKAWSMLRARLYEEELKKREEatnAAAASKTD-IGWGHQI---RSYVLqPYQLVKDLRTGVESTNPQDVLDG 314

                 ....*..
gi 61230203  336 KLDMLIE 342
Cdd:PRK07342 315 DLNEFME 321
PRK05589 PRK05589
peptide chain release factor 2; Provisional
57-341 1.99e-64

peptide chain release factor 2; Provisional


Pssm-ID: 235520  Cd Length: 325  Bit Score: 207.35  E-value: 1.99e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   57 QVQDDIETAQMMLDDPEmrEMAQEELREAKEKSEQLEQQLQVLLLPKDPDdERNAFLEVRAGTGGDEAALFAGDLFRMYS 136
Cdd:PRK05589  36 RIEDIEVLCEMMSEEDD--EMKKEIISEVKNIKEEIDRFKIETLLSGEYD-RNNAILTLHSGVGGTDAQDWTEMLLRMYT 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  137 RYAEARRWRVEIMSMSEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAELPD 216
Cdd:PRK05589 113 RWAEKKGYKVEIIDLLEGDEAGIKSVTLKITGEFAYGYLKAEKGIHRLVRISPFNANGKRQTSFASVEVLPELTDDQDIE 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  217 INPADLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGAR-IHAAETAKRQQAEASTrr 295
Cdd:PRK05589 193 IRSEDLKIDTYRAGGAGGQHVNKTESAVRITHIPTGIVVQCQNERSQHSNKETAMKMLKSKlVELKERAHKEKIEDLT-- 270
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 61230203  296 nllgsGDRSDRN-----RTYNF-PQGRVTDHRINLTLYRLDETMEGKLDMLI 341
Cdd:PRK05589 271 -----GELKDMGwgsqiRSYVFhPYNLVKDHRTGVETSNVDSVMDGDIDNFI 317
RF-1 pfam00472
RF-1 domain; This domain is found in peptide chain release factors such as RF-1 and RF-2, and ...
216-321 9.38e-61

RF-1 domain; This domain is found in peptide chain release factors such as RF-1 and RF-2, and a number of smaller proteins of unknown function. This domain contains the peptidyl-tRNA hydrolase activity. The domain contains a highly conserved motif GGQ, where the glutamine is thought to coordinate the water that mediates the hydrolysis.


Pssm-ID: 395378 [Multi-domain]  Cd Length: 111  Bit Score: 190.34  E-value: 9.38e-61
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   216 DINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTR- 294
Cdd:pfam00472   4 EIDPKDLRIDTFRSSGAGGQHVNKTDSAVRLTHIPTGIVVKCQDERSQHQNREKALKRLRARLYEAELEEEKEEEKKRRa 83
                          90       100
                  ....*....|....*....|....*...
gi 61230203   295 RNLLGSGDRSDRNRTYNF-PQGRVTDHR 321
Cdd:pfam00472  84 KSQVGSGDRSEQIRTYNFkPQSRVKDHR 111
PRK06746 PRK06746
peptide chain release factor 2; Provisional
26-342 3.14e-55

peptide chain release factor 2; Provisional


Pssm-ID: 75726  Cd Length: 326  Bit Score: 183.78  E-value: 3.14e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   26 AGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMMLDDpEMREMAQEELREAKEKSEQLEQQLQVLLLPKDP 105
Cdd:PRK06746   4 AGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKE-EYDEDLHEELESEVKGLIQEMNEYELQLLLSDP 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  106 DDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQ 185
Cdd:PRK06746  83 YDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHRLV 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  186 RVPATESQGRIHTSACTVAVMPELPEAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHK 265
Cdd:PRK06746 163 RISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQIK 242
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 61230203  266 NKAKALSVLGARIHAAETaKRQQAEASTRRNLLGSGDRSDRNRTYNF-PQGRVTDHRINLTLYRLDETMEGKLDMLIE 342
Cdd:PRK06746 243 NREHAMKMLKAKLYQKKL-EEQQAELDEIRGEQKEIGWGSQIRSYVFhPYSLVKDHRTNTEVGNVQAVMDGEIDPFID 319
PCRF smart00937
This domain is found in peptide chain release factors;
68-178 1.63e-54

This domain is found in peptide chain release factors;


Pssm-ID: 214923 [Multi-domain]  Cd Length: 116  Bit Score: 174.57  E-value: 1.63e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203     68 MLDDPEMREMAQEELREAKEKSEQLEQQLQVLL-LPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRV 146
Cdd:smart00937   5 EEEDDEMRELAEEELEELEAELEEELEELLKLLlLPKDPNDDKNAILEIRAGAGGDEAALFAGDLLRMYLRYAERKGWKV 84
                           90       100       110
                   ....*....|....*....|....*....|..
gi 61230203    147 EIMSMSEGEHGGYKEIIAKISGDGVYGRLKFE 178
Cdd:smart00937  85 EVLDESEGELGGIKEATLKISGEGAYGKLKFE 116
release_prfH TIGR03072
putative peptide chain release factor H; Members of this protein family are bacterial proteins ...
112-310 1.52e-27

putative peptide chain release factor H; Members of this protein family are bacterial proteins homologous to peptide chain release factors 1 (RF-1, product of the prfA gene), and 2 (RF-2, product of the prfB gene). The member from Escherichia coli K-12, designated prfH, appears to be a pseudogene. This class I release factor is always found as the downstream gene of a two-gene operon. [Protein synthesis, Translation factors]


Pssm-ID: 213768  Cd Length: 200  Bit Score: 107.17  E-value: 1.52e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   112 FLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEH-GGYKEIIAKISGDGVYGRLKFESGGHRVqrvpAT 190
Cdd:TIGR03072   2 LLQLSSAQGPAECCLAVAKALERLTREAAARGVRVEVLEQEPGEVpGTLRSALVSLDGEAAAALADRWEGTLLW----IC 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203   191 ESQGRIHTSACT--VAVMPElpeAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKA 268
Cdd:TIGR03072  78 PSPYRPHHRRKNwfIGVQRF---SASEEATEDEIRFETLRSSGPGGQHVNKTESAVRATHLASGISVKVQSERSQHANKR 154
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 61230203   269 KALSVLGARIhAAETAKRQQAEASTRRNLLGSGDRSDRNRTY 310
Cdd:TIGR03072 155 LATLLLAVRL-ADLQQEQAAALRAERRTAHHQIERGNPVRVF 195
prfH PRK08179
peptide chain release factor-like protein; Reviewed
212-295 7.84e-23

peptide chain release factor-like protein; Reviewed


Pssm-ID: 181271  Cd Length: 200  Bit Score: 94.35  E-value: 7.84e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  212 AELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIhAAETAKRQQAEA 291
Cdd:PRK08179  99 SADEEEQSDEIRFETLRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAWKL-EQQQQEQSAALK 177

                 ....
gi 61230203  292 STRR 295
Cdd:PRK08179 178 SQRR 181
PRK09256 PRK09256
aminoacyl-tRNA hydrolase;
217-308 1.59e-09

aminoacyl-tRNA hydrolase;


Pssm-ID: 181730 [Multi-domain]  Cd Length: 138  Bit Score: 55.54  E-value: 1.59e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61230203  217 INPADLRIDTFRSSGAGGQHVNTTDSA------IRITHLP---------------TG---IVVECQDERSQHKNKAKALS 272
Cdd:PRK09256  10 IPENELEWRFIRASGPGGQNVNKVSTAvelrfdIAASSLPefykerllalaghriTKdgvIVIKAQEFRSQERNREDALE 89
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 61230203  273 VLGARI-HAAETAKRQQA----EASTRRNLLGSGDRSD--RNR 308
Cdd:PRK09256  90 RLVALIrEALKPPKKRRAtkptRGSKERRLESKKQRGEvkALR 132
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH