NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|82260446|sp|Q4S4I5|]
View 

RecName: Full=Vacuolar fusion protein CCZ1 homolog

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Intu_longin_1 pfam19031
First Longin domain of INTU, CCZ1 and HPS4; This entry is specific to the first Longin domain ...
21-148 9.83e-37

First Longin domain of INTU, CCZ1 and HPS4; This entry is specific to the first Longin domain of the HerMon (Hermansky-Pudlak syndrome and MON1/CCZ1) family, including protein sequences of INTU, CCZ1 and HPS4 families. The Mon1/Ccz1 complex (MC1) is the GDP/GTP exchange factor (GEF) for the Rab GTPase Ypt7/Rab7 during vesicular trafficking. The Hps1/Hps4 complex (BLOC-3) is a Rab32 and Rab38 GEF and is required for biogenesis of melanosomes and platelet dense granules. Inturned (INTU) and Fuzzy (FUZ) proteins interact as members of the ciliogenesis and planar polarity effector (CPLANE) complex that controls recruitment of intraflagellar transport machinery to the basal body of primary cilia.


:

Pssm-ID: 436911  Cd Length: 112  Bit Score: 130.82  E-value: 9.83e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82260446    21 LLSFFIYNPTFGPREGEEEKKILFYHPSDVEKNEKIRNVGLCEAIVQFTRTFCPTK--PAKSLHTQKNRQFFFEPENNFW 98
Cdd:pfam19031   1 LPFFFVYNPTEGKKEGEEEKKILYYHPEETSLNEKLSLRGIFEALVSFTETFSPTQssPCLLIELQKYHVAYREVEDDLW 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 82260446    99 IVMVVRNPMiekpnkdgksqtieyqeeEILDTVYGAVVRQCYSMYKLFNG 148
Cdd:pfam19031  81 LIGSVSNPD------------------NIPDPYYSSVLEQLYRFFKLFYG 112
Intu_longin_3 pfam19033
Intu longin-like domain 3; This entry represents a longin-like domain found in Intu and ...
370-468 4.02e-34

Intu longin-like domain 3; This entry represents a longin-like domain found in Intu and related proteins.


:

Pssm-ID: 436913  Cd Length: 98  Bit Score: 123.59  E-value: 4.02e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82260446   370 KEPQFKFIYFNHMNLAEKSTIHMRKTasVCLTSVHPDLMKILGDINCDFAR-VDEDEEIIVKAMTDYWVVGKKSDQRELY 448
Cdd:pfam19033   1 ENSLYSYVYFDPMNLALKSPLHQEKR--QVNGPLDPDFLRLVLDIHSDFSQsLPELKEHIVKTLNDYWVVGRKSNPRELY 78
                          90       100
                  ....*....|....*....|
gi 82260446   449 VILNQKNANLIEVNEEVKKL 468
Cdd:pfam19033  79 VILNNKNASLQDINEEAKKL 98
Intu_longin_2 pfam19032
Intu longin-like domain 2; This entry represents a longin-like domain found in Intu and ...
218-345 1.34e-24

Intu longin-like domain 2; This entry represents a longin-like domain found in Intu and related proteins.


:

Pssm-ID: 436912  Cd Length: 115  Bit Score: 98.09  E-value: 1.34e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82260446   218 VKYTAFLYNDQLIWSGLEQDDMRILYKYLTTSLFPRHTEPElagrdsplrpelagnllHYGRFLTGPLNLNDPEAKfRFP 297
Cdd:pfam19032   1 ILGSCLLYKDYLLWSHLPKEDLQDVYLYLRQHLLLELISKE-----------------RVGRLVTWREVFPTDASD-PGE 62
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 82260446   298 KIFVSAEDGYEELHLIVYKAMSAAACFMISAS-----VELTRDFCEQLDKLVG 345
Cdd:pfam19032  63 DLNNDDTEPLGRYFLLVYGALHATLCVLLEAGgctskPGPDPFYVDELDATLG 115
 
Name Accession Description Interval E-value
Intu_longin_1 pfam19031
First Longin domain of INTU, CCZ1 and HPS4; This entry is specific to the first Longin domain ...
21-148 9.83e-37

First Longin domain of INTU, CCZ1 and HPS4; This entry is specific to the first Longin domain of the HerMon (Hermansky-Pudlak syndrome and MON1/CCZ1) family, including protein sequences of INTU, CCZ1 and HPS4 families. The Mon1/Ccz1 complex (MC1) is the GDP/GTP exchange factor (GEF) for the Rab GTPase Ypt7/Rab7 during vesicular trafficking. The Hps1/Hps4 complex (BLOC-3) is a Rab32 and Rab38 GEF and is required for biogenesis of melanosomes and platelet dense granules. Inturned (INTU) and Fuzzy (FUZ) proteins interact as members of the ciliogenesis and planar polarity effector (CPLANE) complex that controls recruitment of intraflagellar transport machinery to the basal body of primary cilia.


Pssm-ID: 436911  Cd Length: 112  Bit Score: 130.82  E-value: 9.83e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82260446    21 LLSFFIYNPTFGPREGEEEKKILFYHPSDVEKNEKIRNVGLCEAIVQFTRTFCPTK--PAKSLHTQKNRQFFFEPENNFW 98
Cdd:pfam19031   1 LPFFFVYNPTEGKKEGEEEKKILYYHPEETSLNEKLSLRGIFEALVSFTETFSPTQssPCLLIELQKYHVAYREVEDDLW 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 82260446    99 IVMVVRNPMiekpnkdgksqtieyqeeEILDTVYGAVVRQCYSMYKLFNG 148
Cdd:pfam19031  81 LIGSVSNPD------------------NIPDPYYSSVLEQLYRFFKLFYG 112
Intu_longin_3 pfam19033
Intu longin-like domain 3; This entry represents a longin-like domain found in Intu and ...
370-468 4.02e-34

Intu longin-like domain 3; This entry represents a longin-like domain found in Intu and related proteins.


Pssm-ID: 436913  Cd Length: 98  Bit Score: 123.59  E-value: 4.02e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82260446   370 KEPQFKFIYFNHMNLAEKSTIHMRKTasVCLTSVHPDLMKILGDINCDFAR-VDEDEEIIVKAMTDYWVVGKKSDQRELY 448
Cdd:pfam19033   1 ENSLYSYVYFDPMNLALKSPLHQEKR--QVNGPLDPDFLRLVLDIHSDFSQsLPELKEHIVKTLNDYWVVGRKSNPRELY 78
                          90       100
                  ....*....|....*....|
gi 82260446   449 VILNQKNANLIEVNEEVKKL 468
Cdd:pfam19033  79 VILNNKNASLQDINEEAKKL 98
Intu_longin_2 pfam19032
Intu longin-like domain 2; This entry represents a longin-like domain found in Intu and ...
218-345 1.34e-24

Intu longin-like domain 2; This entry represents a longin-like domain found in Intu and related proteins.


Pssm-ID: 436912  Cd Length: 115  Bit Score: 98.09  E-value: 1.34e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82260446   218 VKYTAFLYNDQLIWSGLEQDDMRILYKYLTTSLFPRHTEPElagrdsplrpelagnllHYGRFLTGPLNLNDPEAKfRFP 297
Cdd:pfam19032   1 ILGSCLLYKDYLLWSHLPKEDLQDVYLYLRQHLLLELISKE-----------------RVGRLVTWREVFPTDASD-PGE 62
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 82260446   298 KIFVSAEDGYEELHLIVYKAMSAAACFMISAS-----VELTRDFCEQLDKLVG 345
Cdd:pfam19032  63 DLNNDDTEPLGRYFLLVYGALHATLCVLLEAGgctskPGPDPFYVDELDATLG 115
 
Name Accession Description Interval E-value
Intu_longin_1 pfam19031
First Longin domain of INTU, CCZ1 and HPS4; This entry is specific to the first Longin domain ...
21-148 9.83e-37

First Longin domain of INTU, CCZ1 and HPS4; This entry is specific to the first Longin domain of the HerMon (Hermansky-Pudlak syndrome and MON1/CCZ1) family, including protein sequences of INTU, CCZ1 and HPS4 families. The Mon1/Ccz1 complex (MC1) is the GDP/GTP exchange factor (GEF) for the Rab GTPase Ypt7/Rab7 during vesicular trafficking. The Hps1/Hps4 complex (BLOC-3) is a Rab32 and Rab38 GEF and is required for biogenesis of melanosomes and platelet dense granules. Inturned (INTU) and Fuzzy (FUZ) proteins interact as members of the ciliogenesis and planar polarity effector (CPLANE) complex that controls recruitment of intraflagellar transport machinery to the basal body of primary cilia.


Pssm-ID: 436911  Cd Length: 112  Bit Score: 130.82  E-value: 9.83e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82260446    21 LLSFFIYNPTFGPREGEEEKKILFYHPSDVEKNEKIRNVGLCEAIVQFTRTFCPTK--PAKSLHTQKNRQFFFEPENNFW 98
Cdd:pfam19031   1 LPFFFVYNPTEGKKEGEEEKKILYYHPEETSLNEKLSLRGIFEALVSFTETFSPTQssPCLLIELQKYHVAYREVEDDLW 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 82260446    99 IVMVVRNPMiekpnkdgksqtieyqeeEILDTVYGAVVRQCYSMYKLFNG 148
Cdd:pfam19031  81 LIGSVSNPD------------------NIPDPYYSSVLEQLYRFFKLFYG 112
Intu_longin_3 pfam19033
Intu longin-like domain 3; This entry represents a longin-like domain found in Intu and ...
370-468 4.02e-34

Intu longin-like domain 3; This entry represents a longin-like domain found in Intu and related proteins.


Pssm-ID: 436913  Cd Length: 98  Bit Score: 123.59  E-value: 4.02e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82260446   370 KEPQFKFIYFNHMNLAEKSTIHMRKTasVCLTSVHPDLMKILGDINCDFAR-VDEDEEIIVKAMTDYWVVGKKSDQRELY 448
Cdd:pfam19033   1 ENSLYSYVYFDPMNLALKSPLHQEKR--QVNGPLDPDFLRLVLDIHSDFSQsLPELKEHIVKTLNDYWVVGRKSNPRELY 78
                          90       100
                  ....*....|....*....|
gi 82260446   449 VILNQKNANLIEVNEEVKKL 468
Cdd:pfam19033  79 VILNNKNASLQDINEEAKKL 98
Intu_longin_2 pfam19032
Intu longin-like domain 2; This entry represents a longin-like domain found in Intu and ...
218-345 1.34e-24

Intu longin-like domain 2; This entry represents a longin-like domain found in Intu and related proteins.


Pssm-ID: 436912  Cd Length: 115  Bit Score: 98.09  E-value: 1.34e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82260446   218 VKYTAFLYNDQLIWSGLEQDDMRILYKYLTTSLFPRHTEPElagrdsplrpelagnllHYGRFLTGPLNLNDPEAKfRFP 297
Cdd:pfam19032   1 ILGSCLLYKDYLLWSHLPKEDLQDVYLYLRQHLLLELISKE-----------------RVGRLVTWREVFPTDASD-PGE 62
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 82260446   298 KIFVSAEDGYEELHLIVYKAMSAAACFMISAS-----VELTRDFCEQLDKLVG 345
Cdd:pfam19032  63 DLNNDDTEPLGRYFLLVYGALHATLCVLLEAGgctskPGPDPFYVDELDATLG 115
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH