NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|81901112|sp|Q8K426|]
View 

RecName: Full=Resistin-like gamma; AltName: Full=Resistin-like molecule gamma; Short=RELMgamma; AltName: Full=Ten-cysteine protein 1; Short=XCP1; Flags: Precursor

Protein Classification

RELM domain-containing protein( domain architecture ID 10536565)

RELM domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Resistin pfam06954
Resistin; This family consists of several mammalian resistin proteins. Resistin is a 12.5-kDa ...
 31-116 9.49e-41

Resistin; This family consists of several mammalian resistin proteins. Resistin is a 12.5-kDa cysteine-rich secreted polypeptide first reported from rodent adipocytes. It belongs to a multigene family termed RELMs or FIZZ proteins. Plasma resistin levels are significantly increased in both genetically susceptible and high-fat-diet-induced obese mice. Immunoneutralization of resistin improves hyperglycemia and insulin resistance in high-fat-diet-induced obese mice, while administration of recombinant resistin impairs glucose tolerance and insulin action in normal mice. It has been demonstrated that increases in circulating resistin levels markedly stimulate glucose production in the presence of fixed physiological insulin levels, whereas insulin suppressed resistin expression. It has been suggested that resistin could be a link between obesity and type 2 diabetes.


:

Pssm-ID: 462049  Cd Length: 85  Bit Score: 130.14  E-value: 9.49e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81901112    31 GTLESIVEKKVKELLANRDDcPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWAT 110
Cdd:pfam06954   1 CSLDSAVDKKIKEALSSLED-PAIVTKKLSCTSVTSRGRLASCPAGMTVTGCACGYACGSWDIRAETTCHCQCAGMDWTT 79


                  ....*.
gi 81901112   111 ARCCQL 116
Cdd:pfam06954  80 ARCCQL 85
 
Name Accession Description Interval E-value
Resistin pfam06954
Resistin; This family consists of several mammalian resistin proteins. Resistin is a 12.5-kDa ...
 31-116 9.49e-41

Resistin; This family consists of several mammalian resistin proteins. Resistin is a 12.5-kDa cysteine-rich secreted polypeptide first reported from rodent adipocytes. It belongs to a multigene family termed RELMs or FIZZ proteins. Plasma resistin levels are significantly increased in both genetically susceptible and high-fat-diet-induced obese mice. Immunoneutralization of resistin improves hyperglycemia and insulin resistance in high-fat-diet-induced obese mice, while administration of recombinant resistin impairs glucose tolerance and insulin action in normal mice. It has been demonstrated that increases in circulating resistin levels markedly stimulate glucose production in the presence of fixed physiological insulin levels, whereas insulin suppressed resistin expression. It has been suggested that resistin could be a link between obesity and type 2 diabetes.


Pssm-ID: 462049  Cd Length: 85  Bit Score: 130.14  E-value: 9.49e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81901112    31 GTLESIVEKKVKELLANRDDcPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWAT 110
Cdd:pfam06954   1 CSLDSAVDKKIKEALSSLED-PAIVTKKLSCTSVTSRGRLASCPAGMTVTGCACGYACGSWDIRAETTCHCQCAGMDWTT 79


                  ....*.
gi 81901112   111 ARCCQL 116
Cdd:pfam06954  80 ARCCQL 85
RELM cd16333
resistin-like molecule (RELM) hormone family; RELMs, secreted proteins with roles including ...
 31-117 2.32e-37

resistin-like molecule (RELM) hormone family; RELMs, secreted proteins with roles including insulin resistance and the activation of inflammatory processes, are also known as found in inflammatory zone (FIZZ), and include four members in mouse (RELM-alpha/FIZZ1/HIMF, RELM-beta/FIZZ2, Resistin/FIZZ3, and RELM-gamma/FIZZ4) and two members in human (resistin and RELM-beta). Little is yet known about the differences and similarities in function of the different isoforms. RELMs are potentially implicated in a wide range of physiological and pathological processes including obesity-associated diabetes, cardiovascular system function, cancer development and metastasis. There are significant differences between human and rodent RELMs with respect to gene and protein structure, differential gene regulation, different tissue distribution profiles, and insulin resistance induction. Resistin appears to convey insulin resistance in rodents, and to instigate inflammatory processes in humans. In the pathophysiology of obesity-associated diabetes, mouse resistin is secreted by adipocytes and increases hepatic gluconeogenesis, thereby promoting insulin resistance, human resistin is secreted by macrophages and may play a role through inflammatory contributions. Elevated levels of human resistin have been reported in various cancers including colorectal, endometrial, and postmenopausal breast cancers, and may initiate the production of further inflammatory cytokines, to promote tumor cell progression; contrary to this, in vitro overexpression of human RELM-beta abolishes invasion, metastasis and angiogenesis of gastric cancer cells. Resistin circulates as hexamers and trimers; structural similarity has been noted between the resistin homotrimer and the proprotein convertase subtilisin/kexin type 9, C-terminal cysteine-rich domain.


Pssm-ID: 319989  Cd Length: 86  Bit Score: 121.38  E-value: 2.32e-37
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81901112  31 GTLESIVEKKVKELLANRDDCPStVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWAT 110
Cdd:cd16333   1 CSIESVVDKKIKEALSSLEPRPS-VNKTLSCTSVKSRGRLASCPAGYAVTGCACGYGCGSWDIRTGTTCHCQCAGIDWTA 79


                ....*..
gi 81901112 111 ARCCQLA 117
Cdd:cd16333  80 ARCCKLV 86
 
Name Accession Description Interval E-value
Resistin pfam06954
Resistin; This family consists of several mammalian resistin proteins. Resistin is a 12.5-kDa ...
 31-116 9.49e-41

Resistin; This family consists of several mammalian resistin proteins. Resistin is a 12.5-kDa cysteine-rich secreted polypeptide first reported from rodent adipocytes. It belongs to a multigene family termed RELMs or FIZZ proteins. Plasma resistin levels are significantly increased in both genetically susceptible and high-fat-diet-induced obese mice. Immunoneutralization of resistin improves hyperglycemia and insulin resistance in high-fat-diet-induced obese mice, while administration of recombinant resistin impairs glucose tolerance and insulin action in normal mice. It has been demonstrated that increases in circulating resistin levels markedly stimulate glucose production in the presence of fixed physiological insulin levels, whereas insulin suppressed resistin expression. It has been suggested that resistin could be a link between obesity and type 2 diabetes.


Pssm-ID: 462049  Cd Length: 85  Bit Score: 130.14  E-value: 9.49e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81901112    31 GTLESIVEKKVKELLANRDDcPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWAT 110
Cdd:pfam06954   1 CSLDSAVDKKIKEALSSLED-PAIVTKKLSCTSVTSRGRLASCPAGMTVTGCACGYACGSWDIRAETTCHCQCAGMDWTT 79


                  ....*.
gi 81901112   111 ARCCQL 116
Cdd:pfam06954  80 ARCCQL 85
RELM cd16333
resistin-like molecule (RELM) hormone family; RELMs, secreted proteins with roles including ...
 31-117 2.32e-37

resistin-like molecule (RELM) hormone family; RELMs, secreted proteins with roles including insulin resistance and the activation of inflammatory processes, are also known as found in inflammatory zone (FIZZ), and include four members in mouse (RELM-alpha/FIZZ1/HIMF, RELM-beta/FIZZ2, Resistin/FIZZ3, and RELM-gamma/FIZZ4) and two members in human (resistin and RELM-beta). Little is yet known about the differences and similarities in function of the different isoforms. RELMs are potentially implicated in a wide range of physiological and pathological processes including obesity-associated diabetes, cardiovascular system function, cancer development and metastasis. There are significant differences between human and rodent RELMs with respect to gene and protein structure, differential gene regulation, different tissue distribution profiles, and insulin resistance induction. Resistin appears to convey insulin resistance in rodents, and to instigate inflammatory processes in humans. In the pathophysiology of obesity-associated diabetes, mouse resistin is secreted by adipocytes and increases hepatic gluconeogenesis, thereby promoting insulin resistance, human resistin is secreted by macrophages and may play a role through inflammatory contributions. Elevated levels of human resistin have been reported in various cancers including colorectal, endometrial, and postmenopausal breast cancers, and may initiate the production of further inflammatory cytokines, to promote tumor cell progression; contrary to this, in vitro overexpression of human RELM-beta abolishes invasion, metastasis and angiogenesis of gastric cancer cells. Resistin circulates as hexamers and trimers; structural similarity has been noted between the resistin homotrimer and the proprotein convertase subtilisin/kexin type 9, C-terminal cysteine-rich domain.


Pssm-ID: 319989  Cd Length: 86  Bit Score: 121.38  E-value: 2.32e-37
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81901112  31 GTLESIVEKKVKELLANRDDCPStVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWAT 110
Cdd:cd16333   1 CSIESVVDKKIKEALSSLEPRPS-VNKTLSCTSVKSRGRLASCPAGYAVTGCACGYGCGSWDIRTGTTCHCQCAGIDWTA 79


                ....*..
gi 81901112 111 ARCCQLA 117
Cdd:cd16333  80 ARCCKLV 86
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH