NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1635479375|gb|QCO76911|]
View 

cytochrome c oxidase subunit 1, partial (mitochondrion) [Acariformes sp. 504-1-Acari-10]

Protein Classification

heme-copper oxidase family protein (domain architecture ID 14)

heme-copper oxidase family protein may catalyze the transfer of electrons from an electron donor onto molecular oxygen

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Heme_Cu_Oxidase_I super family cl00275
Heme-copper oxidase subunit I. Heme-copper oxidases are transmembrane protein complexes in ...
1-142 1.69e-88

Heme-copper oxidase subunit I. Heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and mitochondria which catalyze the reduction of O2 and simultaneously pump protons across the membrane. The superfamily is diverse in terms of electron donors, subunit composition, and heme types. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. It has been proposed that Archaea acquired heme-copper oxidases through gene transfer from Gram-positive bacteria. Membership in the superfamily is defined by subunit I, which contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme and a copper ion. It also contains a low-spin heme, believed to participate in the transfer of electrons to the binuclear center. Only subunit I is common to the entire superfamily. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from the electron donor on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I of cytochrome c oxidase (CcO) and ubiquinol oxidase. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electron transfer occurs in two segments: from the electron donor to the low-spin heme, and from the low-spin heme to the binuclear center. The first segment can be a multi-step process and varies among the different families, while the second segment, a direct transfer, is consistent throughout the superfamily.


The actual alignment was detected with superfamily member MTH00153:

Pssm-ID: 412277  Cd Length: 511  Bit Score: 266.35  E-value: 1.69e-88
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00153   51 IYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSMVESGAGTGWTVYPPL 130
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00153  131 SSNIAHSGASVDLAIFSLHLAGISSILGAINFITTIINMRSKGMTLDRMPLFVWSVLITAIL 192
 
Name Accession Description Interval E-value
COX1 MTH00153
cytochrome c oxidase subunit I; Provisional
1-142 1.69e-88

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177210  Cd Length: 511  Bit Score: 266.35  E-value: 1.69e-88
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00153   51 IYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSMVESGAGTGWTVYPPL 130
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00153  131 SSNIAHSGASVDLAIFSLHLAGISSILGAINFITTIINMRSKGMTLDRMPLFVWSVLITAIL 192
Cyt_c_Oxidase_I cd01663
Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the ...
1-142 1.57e-81

Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, may play a role in assembly or oxygen delivery to the active site. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme (heme a3) and a copper ion (CuB). It also contains a low-spin heme (heme a), believed to participate in the transfer of electrons to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from cytochrome c on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are transferred from cytochrome c (the electron donor) to heme a via the CuA binuclear site in subunit II, and directly from heme a to the binuclear center.


Pssm-ID: 238833  Cd Length: 488  Bit Score: 247.78  E-value: 1.57e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:cd01663    44 LYNVIVTAHALIMIFFMVMPALIGGFGNWLVPLMIGAPDMAFPRLNNLSFWLLPPSLLLLLLSALVEGGAGTGWTVYPPL 123
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:cd01663   124 SSILAHSGPSVDLAIFSLHLAGISSILGAINFITTIFNMRAPGMTLEKMPLFVWSVLITAFL 185
CyoB COG0843
Heme/copper-type cytochrome/quinol oxidase, subunit 1 [Energy production and conversion];
2-142 1.60e-42

Heme/copper-type cytochrome/quinol oxidase, subunit 1 [Energy production and conversion];


Pssm-ID: 223913  Cd Length: 566  Bit Score: 147.44  E-value: 1.60e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   2 YNTIVTAHAFVMIFFMVMPiMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSF-AGVGVGTGWTVYPPL 80
Cdd:COG0843    59 YNQILTLHGVIMIFFFAMP-AIGGFANYLVPLMIGARDVAFPRLNAISFWLLVVGAILLVTSFFvPGGAADTGWTAYPPL 137
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGgMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:COG0843   138 SA-ISYSGPGVDLFILGLHLLGIGSLLGAINFIVTILNMRAPGMTMMKMPLFTWSILITAIL 198
COX1 pfam00115
Cytochrome C and Quinol oxidase polypeptide I;
2-142 4.03e-26

Cytochrome C and Quinol oxidase polypeptide I;


Pssm-ID: 395065  Cd Length: 434  Bit Score: 101.49  E-value: 4.03e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   2 YNTIVTAHAFVMIFFMVMPiMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAgvGVGTGWTVYPPLS 81
Cdd:pfam00115  37 YNQLRTLHGNLMIFGFATP-FIFGFGNYLVPLMIGARDMAFPRLNALSFWLVVLGAVLLLASFFG--GATTGWTEYPPLT 113
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1635479375  82 GgmfhsgfsVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:pfam00115 114 G--------VDLWYLGLLLAGVGSLLGAINFIVTILKRRAPGMYLSRMPLFVWAILATAIL 166
 
Name Accession Description Interval E-value
COX1 MTH00153
cytochrome c oxidase subunit I; Provisional
1-142 1.69e-88

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177210  Cd Length: 511  Bit Score: 266.35  E-value: 1.69e-88
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00153   51 IYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSMVESGAGTGWTVYPPL 130
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00153  131 SSNIAHSGASVDLAIFSLHLAGISSILGAINFITTIINMRSKGMTLDRMPLFVWSVLITAIL 192
Cyt_c_Oxidase_I cd01663
Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the ...
1-142 1.57e-81

Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, may play a role in assembly or oxygen delivery to the active site. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme (heme a3) and a copper ion (CuB). It also contains a low-spin heme (heme a), believed to participate in the transfer of electrons to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from cytochrome c on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are transferred from cytochrome c (the electron donor) to heme a via the CuA binuclear site in subunit II, and directly from heme a to the binuclear center.


Pssm-ID: 238833  Cd Length: 488  Bit Score: 247.78  E-value: 1.57e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:cd01663    44 LYNVIVTAHALIMIFFMVMPALIGGFGNWLVPLMIGAPDMAFPRLNNLSFWLLPPSLLLLLLSALVEGGAGTGWTVYPPL 123
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:cd01663   124 SSILAHSGPSVDLAIFSLHLAGISSILGAINFITTIFNMRAPGMTLEKMPLFVWSVLITAFL 185
COX1 MTH00116
cytochrome c oxidase subunit I; Provisional
1-142 2.26e-77

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177177  Cd Length: 515  Bit Score: 237.68  E-value: 2.26e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00116   53 IYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPL 132
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00116  133 AGNLAHAGASVDLAIFSLHLAGVSSILGAINFITTCINMKPPAMSQYQTPLFVWSVLITAVL 194
COX1 MTH00167
cytochrome c oxidase subunit I; Provisional
1-142 4.14e-77

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177222  Cd Length: 512  Bit Score: 236.88  E-value: 4.14e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00167   53 IYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASSGVEAGAGTGWTVYPPL 132
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00167  133 AGNLAHAGASVDLAIFSLHLAGVSSILGSINFITTIINMKPPGITQYQTPLFVWSILVTTIL 194
COX1 MTH00223
cytochrome c oxidase subunit I; Provisional
2-142 1.30e-73

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177260  Cd Length: 512  Bit Score: 227.94  E-value: 1.30e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   2 YNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPLS 81
Cdd:MTH00223   51 YNVIVTAHAFVMIFFLVMPMMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLYLLLSSSAVESGVGTGWTVYPPLS 130
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1635479375  82 GGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00223  131 SNLAHAGPSVDLAIFSLHLAGVSSILGAINFITTIINMRSPGMQLERLPLFVWSVKVTAFL 191
COX1 MTH00142
cytochrome c oxidase subunit I; Provisional
1-142 2.04e-70

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 214431  Cd Length: 511  Bit Score: 219.59  E-value: 2.04e-70
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00142   51 LYNVIVTAHAFVMIFFMVMPVMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALLLLLSSAAVESGAGTGWTVYPPL 130
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00142  131 SSNLAHSGGSVDLAIFSLHLAGVSSILGAINFITTVINMRAGGMKFERVPLFVWSVKITAIL 192
COX1 MTH00183
cytochrome c oxidase subunit I; Provisional
1-142 6.28e-66

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177234  Cd Length: 516  Bit Score: 208.24  E-value: 6.28e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00183   53 IYNVIVTAHAFVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPL 132
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00183  133 AGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAISQYQTPLFVWAVLITAVL 194
COX1 MTH00077
cytochrome c oxidase subunit I; Provisional
1-142 9.31e-66

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 214419  Cd Length: 514  Bit Score: 207.87  E-value: 9.31e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00077   53 IYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPL 132
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00077  133 AGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTSINMKPPSMSQYQTPLFVWSVLITAVL 194
COX1 MTH00103
cytochrome c oxidase subunit I; Validated
1-142 9.90e-66

cytochrome c oxidase subunit I; Validated


Pssm-ID: 177165  Cd Length: 513  Bit Score: 207.81  E-value: 9.90e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00103   53 IYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPL 132
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00103  133 AGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVLITAVL 194
COX1 MTH00007
cytochrome c oxidase subunit I; Validated
1-142 1.84e-64

cytochrome c oxidase subunit I; Validated


Pssm-ID: 133649  Cd Length: 511  Bit Score: 204.37  E-value: 1.84e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00007   50 LYNTIVTAHAFLMIFFLVMPVFIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPALILLVSSAAVEKGVGTGWTVYPPL 129
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00007  130 ASNLAHAGPSVDLAIFSLHLAGVSSILGAINFITTVINMRWKGLRLERIPLFVWAVVITVVL 191
COX1 MTH00037
cytochrome c oxidase subunit I; Provisional
1-142 5.09e-64

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177112  Cd Length: 517  Bit Score: 203.14  E-value: 5.09e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00037   53 IYNVIVTAHALVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLIPPSFLLLLASAGVESGAGTGWTIYPPL 132
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00037  133 SSNIAHAGGSVDLAIFSLHLAGASSILASINFITTIINMRTPGMTFDRLPLFVWSVFITAFL 194
COX1 MTH00182
cytochrome c oxidase subunit I; Provisional
1-142 2.76e-62

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 214451  Cd Length: 525  Bit Score: 198.89  E-value: 2.76e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00182   55 LYNVIVTAHAFIMIFFLVMPVMIGGFGNWLVPLYIGAPDMAFPRLNNISFWLLPPALILLLGSAFVEQGAGTGWTVYPPL 134
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00182  135 SSIQAHSGGAVDMAIFSLHLAGVSSILGAINFITTIFNMRAPGVTFNRLPLFVWSILITAFL 196
COX1 MTH00184
cytochrome c oxidase subunit I; Provisional
1-142 2.27e-61

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177235  Cd Length: 519  Bit Score: 196.59  E-value: 2.27e-61
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00184   55 LYNVIVTAHAFVMIFFLVMPVMIGGFGNWFVPLYIGAPDMAFPRLNNISFWLLPPALTLLLGSAFVEQGAGTGWTVYPPL 134
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00184  135 SSIQAHSGGSVDMAIFSLHLAGISSILGAMNFITTIFNMRAPGITMDRMPLFVWSILVTTFL 196
COX1 MTH00079
cytochrome c oxidase subunit I; Provisional
1-142 2.02e-57

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177148  Cd Length: 508  Bit Score: 185.65  E-value: 2.02e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00079   54 LYNSVITAHAILMIFFMVMPSMIGGFGNWMLPLMLGAPDMSFPRLNNLSFWLLPTSLFLILDSCFVDMGPGTSWTVYPPL 133
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SgGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00079  134 S-TLGHPGSSVDLAIFSLHCAGISSILGGINFMVTTKNLRSSSISLEHMSLFVWTVFVTVFL 194
COX1 MTH00026
cytochrome c oxidase subunit I; Provisional
1-142 1.07e-53

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 164599  Cd Length: 534  Bit Score: 176.74  E-value: 1.07e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:MTH00026   54 LYNVIVTAHAFVMIFFLVMPTMIGGFGNWFVPLMIGAPDMAFPRLNNISFWLLPPALFLLLGSSLVEQGAGTGWTVYPPL 133
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:MTH00026  134 ASIQAHSGGSVDMAIFSLHLAGLSSILGAMNFITTVMNMRTPGMTMSRIPLFVWSVFITAIL 195
Heme_Cu_Oxidase_I cd00919
Heme-copper oxidase subunit I. Heme-copper oxidases are transmembrane protein complexes in ...
1-142 1.89e-47

Heme-copper oxidase subunit I. Heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and mitochondria which catalyze the reduction of O2 and simultaneously pump protons across the membrane. The superfamily is diverse in terms of electron donors, subunit composition, and heme types. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. It has been proposed that Archaea acquired heme-copper oxidases through gene transfer from Gram-positive bacteria. Membership in the superfamily is defined by subunit I, which contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme and a copper ion. It also contains a low-spin heme, believed to participate in the transfer of electrons to the binuclear center. Only subunit I is common to the entire superfamily. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from the electron donor on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I of cytochrome c oxidase (CcO) and ubiquinol oxidase. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electron transfer occurs in two segments: from the electron donor to the low-spin heme, and from the low-spin heme to the binuclear center. The first segment can be a multi-step process and varies among the different families, while the second segment, a direct transfer, is consistent throughout the superfamily.


Pssm-ID: 238461  Cd Length: 463  Bit Score: 158.85  E-value: 1.89e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMmIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPL 80
Cdd:cd00919    42 LYNQLVTAHGVIMIFFFVMPAIFGGFGNLLPPL-IGARDLAFPRLNNLSFWLFPPGLLLLLSSVLVGGGAGTGWTFYPPL 120
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:cd00919   121 STLSYSSGVGVDLAILGLHLAGVSSILGAINFITTILNMRAPGMTLDKMPLFVWSVLVTAIL 182
CyoB COG0843
Heme/copper-type cytochrome/quinol oxidase, subunit 1 [Energy production and conversion];
2-142 1.60e-42

Heme/copper-type cytochrome/quinol oxidase, subunit 1 [Energy production and conversion];


Pssm-ID: 223913  Cd Length: 566  Bit Score: 147.44  E-value: 1.60e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   2 YNTIVTAHAFVMIFFMVMPiMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSF-AGVGVGTGWTVYPPL 80
Cdd:COG0843    59 YNQILTLHGVIMIFFFAMP-AIGGFANYLVPLMIGARDVAFPRLNAISFWLLVVGAILLVTSFFvPGGAADTGWTAYPPL 137
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGgMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:COG0843   138 SA-ISYSGPGVDLFILGLHLLGIGSLLGAINFIVTILNMRAPGMTMMKMPLFTWSILITAIL 198
COX1 MTH00048
cytochrome c oxidase subunit I; Provisional
1-142 2.25e-39

cytochrome c oxidase subunit I; Provisional


Pssm-ID: 177123  Cd Length: 511  Bit Score: 138.27  E-value: 2.25e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   1 IYNTIVTAHAFVMIFFMVMPIMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVgtGWTVYPPL 80
Cdd:MTH00048   54 VYNFLITNHGIIMIFFFLMPVLIGGFGNYLLPLLLGLSDLNLPRLNALSAWLLVPSIVFLLLSMCLGAGV--GWTFYPPL 131
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1635479375  81 SGGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSiPLFVWSVLITAVL 142
Cdd:MTH00048  132 SSSLFSSSWGVDFLMFSLHLAGVSSLFGSINFICTIYSAFMTNVFSRT-SIILWSYLFTSIL 192
Ubiquinol_Oxidase_I cd01662
Ubiquinol oxidase subunit I. Ubiquinol oxidase, the terminal oxidase in the respiratory ...
2-142 6.46e-39

Ubiquinol oxidase subunit I. Ubiquinol oxidase, the terminal oxidase in the respiratory chains of aerobic bacteria, is a multi-chain transmembrane protein located in the cell membrane. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits in ubiquinol oxidase varies from two to five. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme and a copper ion. It also contains a low-spin heme, believed to participate in the transfer of electrons from ubiquinol to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from ubiquinol on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. It is generally believed that the channels contain water molecules that act as 'proton wires' to transfer the protons. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are believed to be transferred directly from ubiquinol (the electron donor) to the low-spin heme, and directly from the low-spin heme to the binuclear center.


Pssm-ID: 238832  Cd Length: 501  Bit Score: 136.94  E-value: 6.46e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   2 YNTIVTAHAFVMIFFMVMPIMIGgFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPLS 81
Cdd:cd01662    49 YNQIFTMHGTIMIFLFAMPLVFG-LMNYLVPLQIGARDVAFPRLNALSFWLFLFGGLLLNASLLIGGFPDAGWFAYPPLS 127
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1635479375  82 GGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:cd01662   128 GLEYSPGVGVDYWILGLQFSGIGTLLGAINFIVTILKMRAPGMTLMRMPIFTWTTLVTSIL 188
PRK15017 PRK15017
cytochrome o ubiquinol oxidase subunit I; Provisional
2-142 7.85e-30

cytochrome o ubiquinol oxidase subunit I; Provisional


Pssm-ID: 184978  Cd Length: 663  Bit Score: 112.72  E-value: 7.85e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   2 YNTIVTAHAFVMIFFMVMPIMIGgFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAGVGVGTGWTVYPPLS 81
Cdd:PRK15017   99 YDQIFTAHGVIMIFFVAMPFVIG-LMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVGEFAQTGWLAYPPLS 177
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1635479375  82 GGMFHSGFSVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:PRK15017  178 GIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTMFKMPVFTWASLCANVL 238
COX1 pfam00115
Cytochrome C and Quinol oxidase polypeptide I;
2-142 4.03e-26

Cytochrome C and Quinol oxidase polypeptide I;


Pssm-ID: 395065  Cd Length: 434  Bit Score: 101.49  E-value: 4.03e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1635479375   2 YNTIVTAHAFVMIFFMVMPiMIGGFGNWLVPMMIGAQDMAFPRMNNMSFWLLPPSLMFLSISSFAgvGVGTGWTVYPPLS 81
Cdd:pfam00115  37 YNQLRTLHGNLMIFGFATP-FIFGFGNYLVPLMIGARDMAFPRLNALSFWLVVLGAVLLLASFFG--GATTGWTEYPPLT 113
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1635479375  82 GgmfhsgfsVDLAIFSLHLAGVSSILGAINFITTILNMRSLFISLDSIPLFVWSVLITAVL 142
Cdd:pfam00115 114 G--------VDLWYLGLLLAGVGSLLGAINFIVTILKRRAPGMYLSRMPLFVWAILATAIL 166
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH