NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1697578996|gb|QDH77222|]
View 

cytochrome b, partial (mitochondrion) [Rattus sp. KINA776]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CYTB super family cl31797
cytochrome b; Provisional
1-211 7.70e-160

cytochrome b; Provisional


The actual alignment was detected with superfamily member MTH00100:

Pssm-ID: 177162 [Multi-domain]  Cd Length: 379  Bit Score: 446.39  E-value: 7.70e-160
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00100   43 LQILTGLFLAMHYTSDTTTAFSSVAHICRDVNYGWIIRYLHANGASMFFICLFLHVGRGLYYGSYLFLETWNIGIILLFT 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00100  123 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIITALAMVHLLFLHE 202
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00100  203 TGSNNPSGIPSDSDKIPFHPYYTIKDILGLLLLILTLMLLVLFSPDLLGDP 253
 
Name Accession Description Interval E-value
CYTB MTH00100
cytochrome b; Provisional
1-211 7.70e-160

cytochrome b; Provisional


Pssm-ID: 177162 [Multi-domain]  Cd Length: 379  Bit Score: 446.39  E-value: 7.70e-160
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00100   43 LQILTGLFLAMHYTSDTTTAFSSVAHICRDVNYGWIIRYLHANGASMFFICLFLHVGRGLYYGSYLFLETWNIGIILLFT 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00100  123 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIITALAMVHLLFLHE 202
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00100  203 TGSNNPSGIPSDSDKIPFHPYYTIKDILGLLLLILTLMLLVLFSPDLLGDP 253
Cytochrome_b_N cd00284
Cytochrome b (N-terminus)/b6/petB: Cytochrome b is a subunit of cytochrome bc1, an 11-subunit ...
1-164 4.94e-81

Cytochrome b (N-terminus)/b6/petB: Cytochrome b is a subunit of cytochrome bc1, an 11-subunit mitochondrial respiratory enzyme. Cytochrome b spans the mitochondrial membrane with 8 transmembrane helices (A-H) in eukaryotes. In plants and cyanobacteria, cytochrome b6 is analogous to eukaryote cytochrome b, containing two chains: helices A-D are encoded by the petB gene and helices E-H are encoded by the petD gene in these organisms. Cytochrome b/b6 contains two bound hemes and two ubiquinol/ubiquinone binding sites. The C-terminal portion of cytochrome b is described in a separate CD.


Pssm-ID: 238176  Cd Length: 200  Bit Score: 239.96  E-value: 4.94e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSY--TFLETWNIGVVLL 78
Cdd:cd00284    35 IQILTGVFLAMHYTPDVTLAFSSVQYIMRDVNFGWLIRSLHANGASMFFLMLYLHIFRGLYYGSYkkPRELTWVIGVILL 114
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  79 FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFL 158
Cdd:cd00284   115 LLTMATAFMGYVLPWGQMSYWGATVITNLFSAIPVIGITLVEWLWGGFSVDNATLTRFFALHFLLPFIIAVIVILHLLFL 194

                  ....*.
gi 1697578996 159 HETGSN 164
Cdd:cd00284   195 HEQGSS 200
Cytochrome_B pfam00033
Cytochrome b/b6/petB;
1-162 1.01e-74

Cytochrome b/b6/petB;


Pssm-ID: 306530  Cd Length: 189  Bit Score: 223.41  E-value: 1.01e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYG--SYTFLETWNIGVVLL 78
Cdd:pfam00033  26 VQILTGVFLAFYYTPDVTLAFLSVQYIMRDVNFGWLIRSVHANGASMFFLMLYLHIFRGLYYGgfSYPRELTWVIGVILL 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  79 FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFL 158
Cdd:pfam00033 106 VLTMSTAFIGYVLPWGQMSYWGATVITNLLSAIPVIGDTLVEWIWGSFSVDQATLTRFFSLHFLLPFILAILMLLHLLFL 185

                  ....
gi 1697578996 159 HETG 162
Cdd:pfam00033 186 HETG 189
QcrB COG1290
Cytochrome b subunit of the bc complex [Energy production and conversion];
1-211 1.17e-69

Cytochrome b subunit of the bc complex [Energy production and conversion];


Pssm-ID: 224209 [Multi-domain]  Cd Length: 381  Bit Score: 217.22  E-value: 1.17e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYT--FLETWNIGVVLL 78
Cdd:COG1290    51 IQVITGIFLALYYVPSAGLAFPSVPFIMREVPYGWLLRYMHLWGASLMFALVYLHMFRGFFYGAYKkpRELNWILGVLLF 130
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  79 FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFH-FILPFIIAALAIVHLLF 157
Cdd:COG1290   131 LLTMATAFFGYSLPWDQMSYWGATVITNLFSAIPFIGTWLVQWLFGGFSVSDPTLNRFFALHvLLLPAIILALVGLHLSL 210
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1697578996 158 LHETGSNNPTGLNSDA--DKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:COG1290   211 LHKQGITNPAGIERKKklDVIPFHPYYTVKDLLGVVVFLLLFAYFLFFPPNFAGHP 266
 
Name Accession Description Interval E-value
CYTB MTH00100
cytochrome b; Provisional
1-211 7.70e-160

cytochrome b; Provisional


Pssm-ID: 177162 [Multi-domain]  Cd Length: 379  Bit Score: 446.39  E-value: 7.70e-160
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00100   43 LQILTGLFLAMHYTSDTTTAFSSVAHICRDVNYGWIIRYLHANGASMFFICLFLHVGRGLYYGSYLFLETWNIGIILLFT 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00100  123 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIITALAMVHLLFLHE 202
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00100  203 TGSNNPSGIPSDSDKIPFHPYYTIKDILGLLLLILTLMLLVLFSPDLLGDP 253
CYTB MTH00119
cytochrome b; Provisional
1-211 5.61e-142

cytochrome b; Provisional


Pssm-ID: 214425 [Multi-domain]  Cd Length: 380  Bit Score: 400.82  E-value: 5.61e-142
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00119   44 TQILTGLFLAMHYTADISLAFSSVAHICRDVQYGWLIRNLHANGASMFFICIYLHIGRGLYYGSYLYKETWNTGVILLLL 123
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00119  124 LMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGQTLVEWIWGGFSVDNPTLTRFFALHFLLPFLIAGLTLIHLLFLHE 203
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00119  204 TGSNNPLGLNSNTDKIPFHPYFSYKDLLGLTLMLTLLLTLALFSPNLLGDP 254
CYTB MTH00156
cytochrome b; Provisional
1-211 1.18e-139

cytochrome b; Provisional


Pssm-ID: 214440 [Multi-domain]  Cd Length: 356  Bit Score: 394.15  E-value: 1.18e-139
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00156   33 IQIITGLFLAMHYTADIELAFSSVIHICRDVNYGWLLRTLHANGASFFFICIYLHIGRGIYYGSYKLKHTWMSGVIILFL 112
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00156  113 VMATAFLGYVLPWGQMSFWGATVITNLLSAIPYLGTDLVQWIWGGFSVDNATLTRFFTFHFLLPFIILAMVMIHLLFLHQ 192
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00156  193 TGSNNPLGLNSNIDKIPFHPYFTFKDLVGFIIMLMLLILLTLINPYLLGDP 243
CYTB MTH00131
cytochrome b; Provisional
1-211 4.86e-139

cytochrome b; Provisional


Pssm-ID: 177189 [Multi-domain]  Cd Length: 380  Bit Score: 393.63  E-value: 4.86e-139
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00131   43 TQILTGLFLAMHYTSDISTAFSSVAHICRDVNYGWLIRNLHANGASFFFICIYLHIGRGLYYGSYLYKETWNIGVVLLLL 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00131  123 VMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGNTLVQWIWGGFSVDNATLTRFFAFHFLFPFVIAAATILHLLFLHE 202
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00131  203 TGSNNPLGLNSDADKISFHPYFSYKDLLGFAILLLALTSLALFSPNLLGDP 253
CYTB MTH00074
cytochrome b; Provisional
1-211 2.36e-137

cytochrome b; Provisional


Pssm-ID: 177145 [Multi-domain]  Cd Length: 380  Bit Score: 389.43  E-value: 2.36e-137
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00074   44 AQIITGLFLAMHYTADTSSAFSSVAHICRDVNYGWLMRNIHANGASFFFICIYLHIGRGLYYGSYMYKETWNIGVILLFL 123
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00074  124 VMATAFVGYVLPWGQMSFWGATVITNLLSAIPYMGDTLVQWIWGGFSVDKATLTRFFAFHFLLPFLIAGASIIHLLFLHE 203
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00074  204 TGSNNPTGLNSNPDKVPFHPYFSYKDLLGFLIMLTALALLSLFSPNLLGDP 254
CYTB MTH00191
cytochrome b; Provisional
1-211 1.53e-135

cytochrome b; Provisional


Pssm-ID: 177239 [Multi-domain]  Cd Length: 365  Bit Score: 384.27  E-value: 1.53e-135
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00191   40 IQILTGLFLAMHYTADISLAFSSVVHICRDVNYGWLLRNIHANGASFFFICIYLHIGRGLYYGSYLNKETWNVGVILLIL 119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00191  120 SMATAFLGYVLPWGQMSFWGATVITNLLSAIPYIGDDLVQWLWGGFSVDNATLTRFFTFHFLLPFLIAALSLIHLLFLHE 199
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00191  200 TGSNNPLGLNSDSDKIPFHPYFSYKDILGFFILLFLLLFLVLFSPNLLGDP 250
CYTB MTH00145
cytochrome b; Provisional
1-211 4.31e-130

cytochrome b; Provisional


Pssm-ID: 177203 [Multi-domain]  Cd Length: 379  Bit Score: 370.77  E-value: 4.31e-130
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00145   44 IQILTGLFLSMHYTAHVDLAFSSVIHIMRDVNYGWLLRSLHANGASFFFICIYLHIGRGLYYGSYLMQHTWNIGVTLLLL 123
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00145  124 SMGTAFLGYVLPWGQMSFWGATVITNLLSAIPYVGKMLVEWVWGGFSVGNATLKRFFSLHFLLPFVILGLSVLHLLFLHE 203
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00145  204 TGSNNPLGLDSDGDKVPFHPYYTIKDLVGFVVLLFLLVFLVLFFPNLLGDP 254
CYTB MTH00016
cytochrome b; Validated
1-211 3.99e-124

cytochrome b; Validated


Pssm-ID: 177102 [Multi-domain]  Cd Length: 378  Bit Score: 355.52  E-value: 3.99e-124
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00016   44 IQILTGLFLSMHYTPHIDLAFSSVAHISRDVNYGWLLRNLHANGASFFFICLYLHIGRGIYYGSYFLMETWNIGVILLLL 123
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00016  124 TMATAFLGYVLPWGQMSFWGATVITNLLSAIPYIGKMLVQWLWGGFSVDNATLTRFFALHFLLPFVIAALSMIHLLFLHQ 203
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00016  204 TGSNNPLGVNSNSDKVPFHPYYTSKDIVGFIVMLFLLLSVVLLWPNILGDP 254
CYTB MTH00034
cytochrome b; Validated
1-211 5.32e-123

cytochrome b; Validated


Pssm-ID: 177109 [Multi-domain]  Cd Length: 379  Bit Score: 352.86  E-value: 5.32e-123
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00034   43 IQIITGIFLAMHYTADISLAFSSVSHICRDVNYGWLLRNIHANGASLFFICLYFHIGRGLYYGSYVNIETWNIGVILFLL 122
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00034  123 TMLTAFVGYVLPWGQMSFWAATVITNLVSAVPYIGTDIVQWIWGGFSVDNATLTRFFAFHFLFPFIIAALSIIHLLFLHQ 202
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00034  203 TGSNNPTGLNSNYDKVPFHTYFTTKDLVGFLILFAALSSLALLFPTALNDP 253
CYTB MTH00224
cytochrome b; Provisional
1-211 2.43e-106

cytochrome b; Provisional


Pssm-ID: 164767 [Multi-domain]  Cd Length: 379  Bit Score: 310.70  E-value: 2.43e-106
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00224   44 IQVLTGLFLSMHYAPNIEMAFSSVAHISRDVNYGWLLRSIHANGASMFFLFIYLHVGRGLYYGSFNLSETWNIGVILFIL 123
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00224  124 TMATAFLGYVLPWGQMSFWGATVITNLFSAIPYIGKDLVEWIWGGFAVDNATLNRFFSFHFLLPFAIMGATILHIMFLHQ 203
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00224  204 TGSNNPIGINADSARIPFHPYYSIKDALGYLIAILLLSLMVLFEPNLFTDP 254
CYTB MTH00022
cytochrome b; Validated
1-211 2.17e-105

cytochrome b; Validated


Pssm-ID: 164595 [Multi-domain]  Cd Length: 379  Bit Score: 308.17  E-value: 2.17e-105
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00022   42 IQIITGCFLSMHYCSDVSLAFASVGHIMRDVNYGFLLRYLHANGASLFFLCLYIHIGRGLYYGGYLKFHVWNVGVVIFLL 121
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00022  122 TMATAFMGYVLPWGQMSFWGATVITNLLSAIPYVGTDIVQWVWGGFSVSNATLNRFFSLHFLFPFILAFLVIVHLIYLHV 201
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00022  202 DGSNNPIGLNSSVDKVSFHVYYTSKDWYGIVVLFFLLSFIVYFAPNLLGDP 252
CYTB MTH00053
cytochrome b; Provisional
1-211 4.40e-102

cytochrome b; Provisional


Pssm-ID: 164624 [Multi-domain]  Cd Length: 381  Bit Score: 299.70  E-value: 4.40e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00053   44 IQIITGIFLAMHYCADVNLAFSSVAHITRDVNYGFILRYLHANGASMFFLCVYFHIGRGIYYGSYTKIIVWNVGVLIFLL 123
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00053  124 MILTAFIGYVLPWGQMSFWAATVITNLLSAIPYVGDDIVRWVWGGFSVSNATLNRFYSLHYLLPFILAGLALVHLIALHE 203
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00053  204 DGSNNPIGVRSDIDKIPFHYYYVLKDLYGAVILLIILSIIVFLFPYSLGDA 254
Cytochrome_b_N cd00284
Cytochrome b (N-terminus)/b6/petB: Cytochrome b is a subunit of cytochrome bc1, an 11-subunit ...
1-164 4.94e-81

Cytochrome b (N-terminus)/b6/petB: Cytochrome b is a subunit of cytochrome bc1, an 11-subunit mitochondrial respiratory enzyme. Cytochrome b spans the mitochondrial membrane with 8 transmembrane helices (A-H) in eukaryotes. In plants and cyanobacteria, cytochrome b6 is analogous to eukaryote cytochrome b, containing two chains: helices A-D are encoded by the petB gene and helices E-H are encoded by the petD gene in these organisms. Cytochrome b/b6 contains two bound hemes and two ubiquinol/ubiquinone binding sites. The C-terminal portion of cytochrome b is described in a separate CD.


Pssm-ID: 238176  Cd Length: 200  Bit Score: 239.96  E-value: 4.94e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSY--TFLETWNIGVVLL 78
Cdd:cd00284    35 IQILTGVFLAMHYTPDVTLAFSSVQYIMRDVNFGWLIRSLHANGASMFFLMLYLHIFRGLYYGSYkkPRELTWVIGVILL 114
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  79 FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFL 158
Cdd:cd00284   115 LLTMATAFMGYVLPWGQMSYWGATVITNLFSAIPVIGITLVEWLWGGFSVDNATLTRFFALHFLLPFIIAVIVILHLLFL 194

                  ....*.
gi 1697578996 159 HETGSN 164
Cdd:cd00284   195 HEQGSS 200
CYTB MTH00033
cytochrome b; Provisional
1-192 1.38e-78

cytochrome b; Provisional


Pssm-ID: 133672 [Multi-domain]  Cd Length: 383  Bit Score: 240.22  E-value: 1.38e-78
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00033   40 IQILTGVLLAMHYRSDVSLAFSSVAHIVRDVNYGWILRYVHANGASLFFICVYCHIGRGLYYGGYSRVLTWIVGVLIFFI 119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00033  120 MMLTAFIGYVLPWGQMSFWAATVITNLVSAIPSVGGSIVEWIWGGFSVSNCTLNRFFSLHYLLPFVLVGLVLAHLLTLHE 199
                         170       180       190
                  ....*....|....*....|....*....|..
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFM 192
Cdd:MTH00033  200 KGSNEPLGLVGLSDRTAFHVYFTIKDILGFLI 231
Cytochrome_B pfam00033
Cytochrome b/b6/petB;
1-162 1.01e-74

Cytochrome b/b6/petB;


Pssm-ID: 306530  Cd Length: 189  Bit Score: 223.41  E-value: 1.01e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYG--SYTFLETWNIGVVLL 78
Cdd:pfam00033  26 VQILTGVFLAFYYTPDVTLAFLSVQYIMRDVNFGWLIRSVHANGASMFFLMLYLHIFRGLYYGgfSYPRELTWVIGVILL 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  79 FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFL 158
Cdd:pfam00033 106 VLTMSTAFIGYVLPWGQMSYWGATVITNLLSAIPVIGDTLVEWIWGSFSVDQATLTRFFSLHFLLPFILAILMLLHLLFL 185

                  ....
gi 1697578996 159 HETG 162
Cdd:pfam00033 186 HETG 189
CYTB MTH00086
cytochrome b; Provisional
1-211 1.08e-73

cytochrome b; Provisional


Pssm-ID: 177151 [Multi-domain]  Cd Length: 355  Bit Score: 226.74  E-value: 1.08e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00086   32 FQILTGTFLAFYYTADSSMAFSSVQYIMYEVNFGWLFRIFHFNGASLFFIFLYLHIFKGLFMMSYRLKKVWISGLTIYLL 111
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00086  112 VMMEAFMGYVLVWAQMSFWAAVVITSLLSVIPIWGPSIVMWIWGGFGVSSATLKFFFVLHFLLPWGLLVLVLFHLIFLHS 191
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMlLLCLMTLVLFFPDLLGDP 211
Cdd:MTH00086  192 TGSTSSLYCHGDYDKICFGPEYWNKDAYNIIF-WLVFIIFSLFYPFNLGDP 241
QcrB COG1290
Cytochrome b subunit of the bc complex [Energy production and conversion];
1-211 1.17e-69

Cytochrome b subunit of the bc complex [Energy production and conversion];


Pssm-ID: 224209 [Multi-domain]  Cd Length: 381  Bit Score: 217.22  E-value: 1.17e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYT--FLETWNIGVVLL 78
Cdd:COG1290    51 IQVITGIFLALYYVPSAGLAFPSVPFIMREVPYGWLLRYMHLWGASLMFALVYLHMFRGFFYGAYKkpRELNWILGVLLF 130
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  79 FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFH-FILPFIIAALAIVHLLF 157
Cdd:COG1290   131 LLTMATAFFGYSLPWDQMSYWGATVITNLFSAIPFIGTWLVQWLFGGFSVSDPTLNRFFALHvLLLPAIILALVGLHLSL 210
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1697578996 158 LHETGSNNPTGLNSDA--DKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:COG1290   211 LHKQGITNPAGIERKKklDVIPFHPYYTVKDLLGVVVFLLLFAYFLFFPPNFAGHP 266
CYTB MTH00046
cytochrome b; Validated
1-210 4.72e-59

cytochrome b; Validated


Pssm-ID: 177121 [Multi-domain]  Cd Length: 355  Bit Score: 189.04  E-value: 4.72e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLETWNIGVVLLFA 80
Cdd:MTH00046   34 IQVLTGVLLSLLYVADSLCSFFCVMSLSNDSFFTWCVRYWHIWGVNVLFILLFIHMGRALYYSSYSKKGVWNVGFILYLL 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  81 VMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHE 160
Cdd:MTH00046  114 VMVEAFLGYILPWHQMSYWAATVLTSIVDSVPIVGSLVYKYIVGGFSVTGVTLVRVFSVHICLGFVILGLMVVHLFYLHK 193
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1697578996 161 TGSNNPTGL-NSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGD 210
Cdd:MTH00046  194 SGSSNPLFSsNGYSDVVYFHSYFTVKDLFLFMVVCSLLVFWLFVSPDLVLD 244
Cytochrom_B_N_2 pfam13631
Cytochrome b(N-terminal)/b6/petB;
46-211 4.88e-45

Cytochrome b(N-terminal)/b6/petB;


Pssm-ID: 379304  Cd Length: 169  Bit Score: 147.38  E-value: 4.88e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  46 SMFFICLFLHVGRGMYYGSYTFLE--TWNIGVVLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIW 123
Cdd:pfam13631   1 LIFIAAIYVHMLRIFFTGAYRKPRelNWIIGVLLLLLTMGEGFTGYSLPDDLLSGTGLRIGLGILSSIPVVGTWLVWLLF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996 124 GGFSVDKATLTRFFAFHF-ILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVL 202
Cdd:pfam13631  81 GGDFPGTATLPRFYALHVlLLPGLILALIVAHLLLVEKHGQFPPPGTEKNVVGVPFWPVFAVKMLLFFLVTVALLIGLAQ 160

                  ....*....
gi 1697578996 203 FFPDLLGDP 211
Cdd:pfam13631 161 INPIWLGGP 169
PRK03735 PRK03735
cytochrome b6; Provisional
1-166 4.50e-39

cytochrome b6; Provisional


Pssm-ID: 179639  Cd Length: 223  Bit Score: 133.68  E-value: 4.50e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLE--TWNIGVVLL 78
Cdd:PRK03735   54 IQILSGMFLTMYYVPDIKNAYESVYYLQNEVAFGWIVRGMHHWGASLVIVMMFLHTLRVFFTGGYKKPRelNWVVGVLIF 133
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  79 FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFH-FILPFIIAALAIVHLLF 157
Cdd:PRK03735  134 FVTVGLGFTGYLLPWDQKAYFATKVGSQIAEAIPVIGDFIKTLLRGGEIVGAQTLTRFFAIHvFFLPWALAVLMLAHFLM 213

                  ....*....
gi 1697578996 158 LHETGSNNP 166
Cdd:PRK03735  214 IRKQGISGP 222
petB CHL00070
cytochrome b6
1-166 1.96e-33

cytochrome b6


Pssm-ID: 177009  Cd Length: 215  Bit Score: 119.06  E-value: 1.96e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996   1 IQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYYGSYTFLE--TWNIGVVLL 78
Cdd:CHL00070   46 VQVATGFAMTFYYRPTVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRelTWVTGVVLA 125
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1697578996  79 FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFH-FILPFIIAALAIVHLLF 157
Cdd:CHL00070  126 VLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSVSVGQSTLTRFYSLHtFVLPLLTAVFMLMHFLM 205

                  ....*....
gi 1697578996 158 LHETGSNNP 166
Cdd:CHL00070  206 IRKQGISGP 214
cytochrome_b_C cd00290
Cytochrome b(C-terminus)/b6/petD: Cytochrome b is a subunit of cytochrome bc1, an 11-subunit ...
165-211 2.96e-07

Cytochrome b(C-terminus)/b6/petD: Cytochrome b is a subunit of cytochrome bc1, an 11-subunit mitochondrial respiratory enzyme. Cytochrome b spans the mitochondrial membrane with 8 transmembrane helices (A-H) in eukaryotes. In plants and cyanobacteria, cytochrome b6 is analogous to eukaryote cytochrome b, containing two chains: helices A-D are encoded by the petB gene and helices E-H are encoded by the petD gene in these organisms. Cytochrome b/b6 contains two bound hemes and two ubiquinol/ubiquinone binding sites. The C-terminal domain is involved in forming the ubiquinol/ubiquinone binding sites, but not the heme binding sites. The N-terminal portion of cytochrome b, which contains both heme binding sites, is described in a separate CD.


Pssm-ID: 238179 [Multi-domain]  Cd Length: 147  Bit Score: 48.03  E-value: 2.96e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 1697578996 165 NPTGLNSDADKIPFHPYYTIKDLLGVFMLLLCLMTLVLFFPDLLGDP 211
Cdd:cd00290     1 NPLGLASDMDKISFHPYFWPKDLLGAFPILIIFMILVFYAPNLLGHP 47
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH