NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2020513089|gb|QTJ15163|]
View 

large T antigen [JC polyomavirus]

Protein Classification

PHA02624 family protein (domain architecture ID 11476056)

PHA02624 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA02624 PHA02624
large T antigen; Provisional
1-636 0e+00

large T antigen; Provisional


:

Pssm-ID: 222912 [Multi-domain]  Cd Length: 647  Bit Score: 1123.53  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089   1 MDKVLNREESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVKVAHQPdFGTWNSS 80
Cdd:PHA02624    1 MDKTLSREESKELMDLLGLPMAAWGNLPLMRKAYLRKCKEYHPDKGGDEEKMKRLNSLYKKLQEGVKSARQS-FGTQDSS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089  81 EVPTYGTDEWESWWNTFNEKWDEDLFCHEEMFASDDENT---------------GSQHSTPPKKKKKVEDPKDFPVDLHA 145
Cdd:PHA02624   80 EIPTYGTPEWEQWWEEFNEKWDEDLFCDEELSSSDDEDEppppspppsqeeesqSSSQATPPKKKKKNPAPNDFPSCLLA 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 146 FLSQAVFSNRTVASFAVYTTKEKAQILYKKLMEKYSVTFISRHGFG*******LTPHRHRVSAINNYCQKLCTFSFLICK 225
Cdd:PHA02624  160 FLSHAIFSNKTLTCFLIYTTKEKAELLYKKLLEKFNPTFISRHSYDGGALLFIITPGKHRVSAVNNFCKKHCTVSFLICK 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 226 GVNKEYLFYSALCRQPYAVVEESIQGGLKEHDFNPEEPEEtKQVSWKLVTQYALDTKCEDVFLLMGMYLDFQENPLQCKK 305
Cdd:PHA02624  240 GVKKEYELYSALCRDPFKLLEESIPGGLKEYEFNPEEEEE-KQVNWKLITDFALETNCDDVLLLLGLYLEFAVPPEECKK 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 306 CEKKDQPNHFNHHEKHYYNAQIFADSKNQKSICQQAVDTVAAKQRVDSIHMTREEMLIQRFNFLLDKMDLIFgaHGNAVL 385
Cdd:PHA02624  319 CQKKKLKTHFKYHEKHHENAKLFLDSKNQKTICQQAVDGVLAKRRVKLLTMTREELLAERFKKLLDKMDEIF--KGSVDI 396
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 386 EQYMAGVAWIHCLLPQMDTVIYEFLKCIVLNIPKKRYWLFKGPIDSGKTTLAAALLDLCGGKSLNVNMPLERLNFELGVG 465
Cdd:PHA02624  397 LQYMAGVAWLHCLLPNFDDVIYDILKLIVENVPKRRYWLFKGPVNSGKTTLAAALLDLCGGKSLNVNCPPDKLNFELGCA 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 466 IDQFMVVFEDVKGTGAESRDLPSGHGISNLDCLRDYLDGSVKVNLERKHQNKRTQVFPPGIVTMNEYSVPRTLQARFVRQ 545
Cdd:PHA02624  477 IDQFMVVFEDVKGQPADNKDLPSGQGMNNLDNLRDYLDGSVPVNLEKKHLNKRSQIFPPGIVTMNEYLIPQTVKARFAKV 556
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 546 IDFRPKAYLRKSLSCSEYLLEKRILQSGMTLLLLLIWFRPVADFAAAIHERIVQWKERLDLEISMYTFSTMKANVGMGRP 625
Cdd:PHA02624  557 LDFKPKPYLKKSLKKNEYLLEKRILQSGETLLLLLIWYRPVEDFAEEIQEKVVTWKERLDKEVSDTTFATMKENIHEGKD 636
                         650
                  ....*....|.
gi 2020513089 626 ILDFPREEDSE 636
Cdd:PHA02624  637 PLEKIVEEDSD 647
 
Name Accession Description Interval E-value
PHA02624 PHA02624
large T antigen; Provisional
1-636 0e+00

large T antigen; Provisional


Pssm-ID: 222912 [Multi-domain]  Cd Length: 647  Bit Score: 1123.53  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089   1 MDKVLNREESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVKVAHQPdFGTWNSS 80
Cdd:PHA02624    1 MDKTLSREESKELMDLLGLPMAAWGNLPLMRKAYLRKCKEYHPDKGGDEEKMKRLNSLYKKLQEGVKSARQS-FGTQDSS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089  81 EVPTYGTDEWESWWNTFNEKWDEDLFCHEEMFASDDENT---------------GSQHSTPPKKKKKVEDPKDFPVDLHA 145
Cdd:PHA02624   80 EIPTYGTPEWEQWWEEFNEKWDEDLFCDEELSSSDDEDEppppspppsqeeesqSSSQATPPKKKKKNPAPNDFPSCLLA 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 146 FLSQAVFSNRTVASFAVYTTKEKAQILYKKLMEKYSVTFISRHGFG*******LTPHRHRVSAINNYCQKLCTFSFLICK 225
Cdd:PHA02624  160 FLSHAIFSNKTLTCFLIYTTKEKAELLYKKLLEKFNPTFISRHSYDGGALLFIITPGKHRVSAVNNFCKKHCTVSFLICK 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 226 GVNKEYLFYSALCRQPYAVVEESIQGGLKEHDFNPEEPEEtKQVSWKLVTQYALDTKCEDVFLLMGMYLDFQENPLQCKK 305
Cdd:PHA02624  240 GVKKEYELYSALCRDPFKLLEESIPGGLKEYEFNPEEEEE-KQVNWKLITDFALETNCDDVLLLLGLYLEFAVPPEECKK 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 306 CEKKDQPNHFNHHEKHYYNAQIFADSKNQKSICQQAVDTVAAKQRVDSIHMTREEMLIQRFNFLLDKMDLIFgaHGNAVL 385
Cdd:PHA02624  319 CQKKKLKTHFKYHEKHHENAKLFLDSKNQKTICQQAVDGVLAKRRVKLLTMTREELLAERFKKLLDKMDEIF--KGSVDI 396
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 386 EQYMAGVAWIHCLLPQMDTVIYEFLKCIVLNIPKKRYWLFKGPIDSGKTTLAAALLDLCGGKSLNVNMPLERLNFELGVG 465
Cdd:PHA02624  397 LQYMAGVAWLHCLLPNFDDVIYDILKLIVENVPKRRYWLFKGPVNSGKTTLAAALLDLCGGKSLNVNCPPDKLNFELGCA 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 466 IDQFMVVFEDVKGTGAESRDLPSGHGISNLDCLRDYLDGSVKVNLERKHQNKRTQVFPPGIVTMNEYSVPRTLQARFVRQ 545
Cdd:PHA02624  477 IDQFMVVFEDVKGQPADNKDLPSGQGMNNLDNLRDYLDGSVPVNLEKKHLNKRSQIFPPGIVTMNEYLIPQTVKARFAKV 556
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 546 IDFRPKAYLRKSLSCSEYLLEKRILQSGMTLLLLLIWFRPVADFAAAIHERIVQWKERLDLEISMYTFSTMKANVGMGRP 625
Cdd:PHA02624  557 LDFKPKPYLKKSLKKNEYLLEKRILQSGETLLLLLIWYRPVEDFAEEIQEKVVTWKERLDKEVSDTTFATMKENIHEGKD 636
                         650
                  ....*....|.
gi 2020513089 626 ILDFPREEDSE 636
Cdd:PHA02624  637 PLEKIVEEDSD 647
Polyoma_lg_T_C pfam06431
Polyomavirus large T antigen C-terminus;
266-679 0e+00

Polyomavirus large T antigen C-terminus;


Pssm-ID: 283968  Cd Length: 417  Bit Score: 872.75  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 266 TKQVSWKLVTQYALDTKCEDVFLLMGMYLDFQENPLQCKKCEKKDQPNHFNHHEKHYYNAQIFADSKNQKSICQQAVDTV 345
Cdd:pfam06431   1 TKQVSWKLVTEYAMETKCEDVFLLLGMYLEFQYNFEMCKKCIKKDQPSHFKYHEKHYANAAIFADSKNQKSICQQAVDTV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 346 AAKQRVDSIHMTREEMLIQRFNFLLDKMDLIFGAHGNAVLEQYMAGVAWIHCLLPQMDTVIYEFLKCIVLNIPKKRYWLF 425
Cdd:pfam06431  81 LAKKRVDSLHMTREEMLTERFNDLLDKMDLIFGAHGNAVLEQYMAGVAWLHCLLPKMDSVIYDFLKCIVYNIPKKRYWLF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 426 KGPIDSGKTTLAAALLDLCGGKSLNVNMPLERLNFELGVGIDQFMVVFEDVKGTGAESRDLPSGHGISNLDCLRDYLDGS 505
Cdd:pfam06431 161 KGPIDSGKTTLAAALLDLCGGKALNVNLPLERLNFELGVAIDQFMVVFEDVKGTGAESRDLPSGHGINNLDNLRDYLDGS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 506 VKVNLERKHQNKRTQVFPPGIVTMNEYSVPRTLQARFVRQIDFRPKAYLRKSLSCSEYLLEKRILQSGMTLLLLLIWFRP 585
Cdd:pfam06431 241 VKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVRQIDFRPKDYLRKSLERSEFLLEKRILQSGMTLLLLLIWFRP 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 586 VADFAAAIHERIVQWKERLDLEISMYTFSTMKANVGMGRPILDFPREEDSEAEDSGHGSSTESQSQCSSQVSEASGADTQ 665
Cdd:pfam06431 321 VADFAQSIQSRIVEWKERLDKEISMYTFSKMKFNVAMGIGILDWLREEDSEDEDSGHGSSTESQSQCKSQVSHESGIDSQ 400
                         410
                  ....*....|....
gi 2020513089 666 EHCTYHICKGFQCF 679
Cdd:pfam06431 401 SQGSFHACKGFQCF 414
DnaJ smart00271
DnaJ molecular chaperone homology domain;
11-67 3.45e-09

DnaJ molecular chaperone homology domain;


Pssm-ID: 197617 [Multi-domain]  Cd Length: 60  Bit Score: 53.01  E-value: 3.45e-09
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2020513089   11 MELMDLLGLDRSAwgNIPVMRKAYLKKCKELHPDKGGD-----EDKMKRMNFLYKKMEQGVK 67
Cdd:smart00271   1 TDYYEILGVPRDA--SLDEIKKAYRKLALKYHPDKNPGdkeeaEEKFKEINEAYEVLSDPEK 60
DnaJ cd06257
DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and ...
12-60 1.06e-04

DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Hsp40 proteins are characterized by the presence of a J domain, which mediates the interaction with Hsp70. They may contain other domains as well, and the architectures provide a means of classification.


Pssm-ID: 99751 [Multi-domain]  Cd Length: 55  Bit Score: 40.22  E-value: 1.06e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 2020513089  12 ELMDLLGLDRSAwgNIPVMRKAYLKKCKELHPDKGGD----EDKMKRMNFLYK 60
Cdd:cd06257     1 DYYDILGVPPDA--SDEEIKKAYRKLALKYHPDKNPDdpeaEEKFKEINEAYE 51
 
Name Accession Description Interval E-value
PHA02624 PHA02624
large T antigen; Provisional
1-636 0e+00

large T antigen; Provisional


Pssm-ID: 222912 [Multi-domain]  Cd Length: 647  Bit Score: 1123.53  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089   1 MDKVLNREESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVKVAHQPdFGTWNSS 80
Cdd:PHA02624    1 MDKTLSREESKELMDLLGLPMAAWGNLPLMRKAYLRKCKEYHPDKGGDEEKMKRLNSLYKKLQEGVKSARQS-FGTQDSS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089  81 EVPTYGTDEWESWWNTFNEKWDEDLFCHEEMFASDDENT---------------GSQHSTPPKKKKKVEDPKDFPVDLHA 145
Cdd:PHA02624   80 EIPTYGTPEWEQWWEEFNEKWDEDLFCDEELSSSDDEDEppppspppsqeeesqSSSQATPPKKKKKNPAPNDFPSCLLA 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 146 FLSQAVFSNRTVASFAVYTTKEKAQILYKKLMEKYSVTFISRHGFG*******LTPHRHRVSAINNYCQKLCTFSFLICK 225
Cdd:PHA02624  160 FLSHAIFSNKTLTCFLIYTTKEKAELLYKKLLEKFNPTFISRHSYDGGALLFIITPGKHRVSAVNNFCKKHCTVSFLICK 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 226 GVNKEYLFYSALCRQPYAVVEESIQGGLKEHDFNPEEPEEtKQVSWKLVTQYALDTKCEDVFLLMGMYLDFQENPLQCKK 305
Cdd:PHA02624  240 GVKKEYELYSALCRDPFKLLEESIPGGLKEYEFNPEEEEE-KQVNWKLITDFALETNCDDVLLLLGLYLEFAVPPEECKK 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 306 CEKKDQPNHFNHHEKHYYNAQIFADSKNQKSICQQAVDTVAAKQRVDSIHMTREEMLIQRFNFLLDKMDLIFgaHGNAVL 385
Cdd:PHA02624  319 CQKKKLKTHFKYHEKHHENAKLFLDSKNQKTICQQAVDGVLAKRRVKLLTMTREELLAERFKKLLDKMDEIF--KGSVDI 396
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 386 EQYMAGVAWIHCLLPQMDTVIYEFLKCIVLNIPKKRYWLFKGPIDSGKTTLAAALLDLCGGKSLNVNMPLERLNFELGVG 465
Cdd:PHA02624  397 LQYMAGVAWLHCLLPNFDDVIYDILKLIVENVPKRRYWLFKGPVNSGKTTLAAALLDLCGGKSLNVNCPPDKLNFELGCA 476
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 466 IDQFMVVFEDVKGTGAESRDLPSGHGISNLDCLRDYLDGSVKVNLERKHQNKRTQVFPPGIVTMNEYSVPRTLQARFVRQ 545
Cdd:PHA02624  477 IDQFMVVFEDVKGQPADNKDLPSGQGMNNLDNLRDYLDGSVPVNLEKKHLNKRSQIFPPGIVTMNEYLIPQTVKARFAKV 556
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 546 IDFRPKAYLRKSLSCSEYLLEKRILQSGMTLLLLLIWFRPVADFAAAIHERIVQWKERLDLEISMYTFSTMKANVGMGRP 625
Cdd:PHA02624  557 LDFKPKPYLKKSLKKNEYLLEKRILQSGETLLLLLIWYRPVEDFAEEIQEKVVTWKERLDKEVSDTTFATMKENIHEGKD 636
                         650
                  ....*....|.
gi 2020513089 626 ILDFPREEDSE 636
Cdd:PHA02624  637 PLEKIVEEDSD 647
Polyoma_lg_T_C pfam06431
Polyomavirus large T antigen C-terminus;
266-679 0e+00

Polyomavirus large T antigen C-terminus;


Pssm-ID: 283968  Cd Length: 417  Bit Score: 872.75  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 266 TKQVSWKLVTQYALDTKCEDVFLLMGMYLDFQENPLQCKKCEKKDQPNHFNHHEKHYYNAQIFADSKNQKSICQQAVDTV 345
Cdd:pfam06431   1 TKQVSWKLVTEYAMETKCEDVFLLLGMYLEFQYNFEMCKKCIKKDQPSHFKYHEKHYANAAIFADSKNQKSICQQAVDTV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 346 AAKQRVDSIHMTREEMLIQRFNFLLDKMDLIFGAHGNAVLEQYMAGVAWIHCLLPQMDTVIYEFLKCIVLNIPKKRYWLF 425
Cdd:pfam06431  81 LAKKRVDSLHMTREEMLTERFNDLLDKMDLIFGAHGNAVLEQYMAGVAWLHCLLPKMDSVIYDFLKCIVYNIPKKRYWLF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 426 KGPIDSGKTTLAAALLDLCGGKSLNVNMPLERLNFELGVGIDQFMVVFEDVKGTGAESRDLPSGHGISNLDCLRDYLDGS 505
Cdd:pfam06431 161 KGPIDSGKTTLAAALLDLCGGKALNVNLPLERLNFELGVAIDQFMVVFEDVKGTGAESRDLPSGHGINNLDNLRDYLDGS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 506 VKVNLERKHQNKRTQVFPPGIVTMNEYSVPRTLQARFVRQIDFRPKAYLRKSLSCSEYLLEKRILQSGMTLLLLLIWFRP 585
Cdd:pfam06431 241 VKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVRQIDFRPKDYLRKSLERSEFLLEKRILQSGMTLLLLLIWFRP 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 586 VADFAAAIHERIVQWKERLDLEISMYTFSTMKANVGMGRPILDFPREEDSEAEDSGHGSSTESQSQCSSQVSEASGADTQ 665
Cdd:pfam06431 321 VADFAQSIQSRIVEWKERLDKEISMYTFSKMKFNVAMGIGILDWLREEDSEDEDSGHGSSTESQSQCKSQVSHESGIDSQ 400
                         410
                  ....*....|....
gi 2020513089 666 EHCTYHICKGFQCF 679
Cdd:pfam06431 401 SQGSFHACKGFQCF 414
T_Ag_DNA_bind pfam02217
Origin of replication binding protein; This domain of large T antigen binds to the SV40 origin ...
137-230 4.22e-46

Origin of replication binding protein; This domain of large T antigen binds to the SV40 origin of DNA replication.


Pssm-ID: 280395  Cd Length: 94  Bit Score: 158.24  E-value: 4.22e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089 137 KDFPVDLHAFLSQAVFSNRTVASFAVYTTKEKAQILYKKLMEKYSVTFISRHGFG*******LTPHRHRVSAINNYCQKL 216
Cdd:pfam02217   1 IDFPADLEAYLSHAISSNKTPNCFLIYTTKEKLQQLYPKLMEKFSPTFHSLAHWGGGYALFIITPTKHRVSAVKNFCKKH 80
                          90
                  ....*....|....
gi 2020513089 217 CTFSFLICKGVNKE 230
Cdd:pfam02217  81 CTVSFLIVKGVKKP 94
PHA03102 PHA03102
Small T antigen; Reviewed
7-108 4.94e-40

Small T antigen; Reviewed


Pssm-ID: 222986  Cd Length: 153  Bit Score: 144.04  E-value: 4.94e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2020513089   7 REESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVKVAHQPDFGTWNSSevptyg 86
Cdd:PHA03102    1 REESKELMDLLGLPRSAWGNLPLMRKAYLRKCLEFHPDKGGDEEKMKELNTLYKKFRESVKSLRDLDGEEDSSS------ 74
                          90       100
                  ....*....|....*....|....*..
gi 2020513089  87 tdEWESWWN-----TFNEKWDEDLFCH 108
Cdd:PHA03102   75 --EEEDVPSgyvgaTFGDRVNALYCKD 99
DnaJ smart00271
DnaJ molecular chaperone homology domain;
11-67 3.45e-09

DnaJ molecular chaperone homology domain;


Pssm-ID: 197617 [Multi-domain]  Cd Length: 60  Bit Score: 53.01  E-value: 3.45e-09
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2020513089   11 MELMDLLGLDRSAwgNIPVMRKAYLKKCKELHPDKGGD-----EDKMKRMNFLYKKMEQGVK 67
Cdd:smart00271   1 TDYYEILGVPRDA--SLDEIKKAYRKLALKYHPDKNPGdkeeaEEKFKEINEAYEVLSDPEK 60
DnaJ cd06257
DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and ...
12-60 1.06e-04

DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Hsp40 proteins are characterized by the presence of a J domain, which mediates the interaction with Hsp70. They may contain other domains as well, and the architectures provide a means of classification.


Pssm-ID: 99751 [Multi-domain]  Cd Length: 55  Bit Score: 40.22  E-value: 1.06e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 2020513089  12 ELMDLLGLDRSAwgNIPVMRKAYLKKCKELHPDKGGD----EDKMKRMNFLYK 60
Cdd:cd06257     1 DYYDILGVPPDA--SDEEIKKAYRKLALKYHPDKNPDdpeaEEKFKEINEAYE 51
DnaJ pfam00226
DnaJ domain. DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is ...
15-59 8.04e-04

DnaJ domain. DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature.


Pssm-ID: 365959  Cd Length: 63  Bit Score: 37.84  E-value: 8.04e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 2020513089  15 DLLGLDRSAwgNIPVMRKAYLKKCKELHPDKG----GDEDKMKRMNFLY 59
Cdd:pfam00226   4 EILGVSPDA--SDEEIKKAYRKLALKYHPDKNpgdpEAEEKFKEINEAY 50
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH