NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1593656259|gb|TDH03366|]
View 

hypothetical protein EPR50_G00162150 [Perca flavescens]

Protein Classification

MYSc_class_II and Myosin_tail_1 domain-containing protein (domain architecture ID 12036736)

protein containing domains Myosin_N, MYSc_class_II, and Myosin_tail_1

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
925-2005 0e+00

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


:

Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 1421.10  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  925 TRQEEEMGQKDEELKAAKEVAAKVETELKDITQKHTQLMEERAQLEMKLHAETELYAEAEEMRVRLEAKKQELEEVLHEM 1004
Cdd:pfam01576    1 TRQEEEMQAKEEELQKVKEKQQKAESELKELEKKHQQLIEEKNILAEQLQAETELFAEAEEMRARLAARKQELEEILHDL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1005 ESRLEEEEDRSNALHNERKEMEQQLQLMEAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQKERKLLEER 1084
Cdd:pfam01576   81 ESRLEEEEERSQQLQNEKKKMQQHIQDLEEQLEEEEAARQKLQLEKVTTEAKIKKLEEDILLLEDQNSKLSKERKLLEER 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1085 LADMSSNLAEEEEKSKNLSKLKTKHESMISELELRMKKEEKGRLDMEKAKRKVEAELGDLQEQHADLQAQLAELRAQLAA 1164
Cdd:pfam01576  161 ISEFTSNLAEEEEKVKSLNKLKNKHEAMISDLEDRLKKEEKGRQELEKAKRKLDGESTDLQEQIAELQAQIEELRAQLAK 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1165 KEEELQATQARLEEECNQRGAAVKRVRELEVLISELQEDLEAERAARGKVEAARRDLGEELNALRTELEDSLGTTAAQQE 1244
Cdd:pfam01576  241 KEEELQAALARLEEEGAQKNNALKKLRELQAQIAELQEDLESERAARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1245 LRAKREQEVSMLKKAMEDEGRSHEAQVQDLRQKHSQAVEELTEQLEQAKRVRAGLEKAKQALEKESADLSADLRSLASAK 1324
Cdd:pfam01576  321 LRSKREQEVTELKKALEEETRSHEAQLQEMRQKHTQALEELSEQLEQAKRNKANLEKAKQALESENNELQAELKTLQQAK 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1325 QDVEHKKKKVEGQLNELNSRFNESERQRTELGERVSKLTTELDSVTGLLNEAEGKNIKLSKDVSSLSSQLQDAQELLSEE 1404
Cdd:pfam01576  401 QDSEHKRKKLEGQLQELQARLSESERQRAELAEKLSKLQSELESVSGLLSEAEGKSIKLSKDVSSLESQLQDTQELLQEE 480
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1405 TRQKLNLSGRLRQTEEDRNSLMEQLEEETEAKRAVERQVSSLNMQLSDSKKKLDEMSGTVEALEEGKKRLQRELEAANSD 1484
Cdd:pfam01576  481 TRQKLNLSSRLRQLEDERNSLQEQLEEEEEAKRNVERQLSTLQAQLSEMKKKLEEDAGAVEALEEAKKRLQRELEALTQR 560
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1485 YEEKASAYDKLEKSRGRMQQELEDVLMDLDSQRQLVSNLEKKQKKFDQMLAEERAVSCKFAEERDRAEAEAREKETRVLA 1564
Cdd:pfam01576  561 LEEKAAAYDKLEKTKNRLQQELDDLLVDLDHQRQLVSNLEKKQKKFDQMLAEEKAISARYAEERDRAEAEAREKETRALS 640
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1565 LARALEENQGALEEAEKTMKGLRADMEDLISSKDDVGKSVHDLEKAKRGLEAIVDEMRTQMEELEDELQVAEDAKLRLDV 1644
Cdd:pfam01576  641 LSRALEEALEAKEELERQNKQLRAEMEDLVSSKDDVGKNVHELERSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV 720
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1645 NTQALRAQHERELHARDELGEEKRKQLLKQVRELEAELEEERKQRGQASGSKKKLEGELKDMEDQLEATSRGRDEAVKQL 1724
Cdd:pfam01576  721 NMQALKAQFERDLQARDEQGEEKRRQLVKQVRELEAELEDERKQRAQAVAAKKKLELDLKELEAQIDAANKGRDEAVKQL 800
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1725 RKIQGQVKDLQRDLEDSRAAQKEVLASARESERRSKAMEADIVQLHEMLAAVERARKQAEVERDELSEELASNSSGKSLM 1804
Cdd:pfam01576  801 KKLQAQMKELQRELEETRASRDEILAQSKESEKKLKSLEAELLQLQEDLAASERAKRQAQQERDELADEIANGASGKSAL 880
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1805 SDEKRRLDTKISQLEEELEEEQANVESLNDRLRKSQQLVEQLGAELAAERSTSQSREGSRQQLERQNRELKAKMQEMEGQ 1884
Cdd:pfam01576  881 LDEKRRLEARIAQLEEELEEEQSNTELLNDRYRKLTLQVEQLTTELSAERSFSQKSESARQQLERQNKELKAKLQEMEGT 960
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1885 GRSKLKASIAALEAKLREAEEQLEIESRERQANGKNLRQKEKKLKDLTIQMEDERKQAQQYKDQAEKGNVRVKQLKHQLE 1964
Cdd:pfam01576  961 VKSKYKSSIAALEAKIAQLEEQLEQESRERQAANKLVRRTEKKLKEVLLQVEDERRNADQYKDQAEKANSRMKQLKRQLE 1040
                         1050      1060      1070      1080
                   ....*....|....*....|....*....|....*....|.
gi 1593656259 1965 EAEEEAQRMAAARRKLQRELDEATEANDTLSRDMASLRSKL 2005
Cdd:pfam01576 1041 EAEEEASRANAARRKLQRELDDATESAESMNREVSTLRSKL 1081
MYSc_class_II cd01377
class II myosins, motor domain; Myosin motor domain in class II myosins. Class II myosins, ...
169-848 0e+00

class II myosins, motor domain; Myosin motor domain in class II myosins. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. Thus, myosin II has two heads. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


:

Pssm-ID: 276951  Cd Length: 662  Bit Score: 1308.60  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd01377      1 ASVLHNLRERYYSDLIYTYSGLFCVAVNPYKRLPIYTEEVIDKYKGKRREEMPPHIFAIADNAYRNMLQDRENQSILITG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKDATPQpqqagslaYGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLN 328
Cdd:cd01377     81 ESGAGKTENTKKVIQYLASVAASSKKKKESGKK--------KGTLEDQILQANPILEAFGNAKTVRNNNSSRFGKFIRIH 152
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  329 FDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVA-GHVEISGQEDDEMFIE 407
Cdd:cd01377    153 FGSTGKIAGADIETYLLEKSRVVRQAKGERNYHIFYQLLSGADPELKEKLLLTGDPSYYFFLSqGELTIDGVDDAEEFKL 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  408 TLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVV 487
Cdd:cd01377    233 TDEAFDILGFSEEEKMSIFKIVAAILHLGNIKFKQRRREEQAELDGTEEADKAAHLLGVNSSDLLKALLKPRIKVGREWV 312
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  488 QKAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKsKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFN 567
Cdd:cd01377    313 TKGQNKEQVVFSVGALAKALYERLFLWLVKRINKTLDT-KSKRQYFIGVLDIAGFEIFEFNSFEQLCINYTNEKLQQFFN 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  568 HTMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNnpPGILALLDEECWFPKATDVSFVEKLLNTHTGHVK-FSKPK 646
Cdd:cd01377    392 HHMFVLEQEEYKKEGIEWTFIDFGLDLQPTIDLIEKPN--MGILSILDEECVFPKATDKTFVEKLYSNHLGKSKnFKKPK 469
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  647 QHKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRvvgletitkMSESSAPPKSKKGM 726
Cdd:cd01377    470 PKKSEAHFILKHYAGDVEYNIDGWLEKNKDPLNENVVALLKKSSDPLVASLFKDYEE---------SGGGGGKKKKKGGS 540
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  727 FRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYE 806
Cdd:cd01377    541 FRTVSQLHKEQLNKLMTTLRSTHPHFVRCIIPNEEKKPGKIDAPLVLHQLRCNGVLEGIRICRKGFPNRIIFAEFKQRYS 620
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|..
gi 1593656259  807 ILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd01377    621 ILAPNAIPKGFDDGKAACEKILKALQLDPELYRIGNTKVFFK 662
Myosin_N pfam02736
Myosin N-terminal SH3-like domain; This domain has an SH3-like fold. It is found at the ...
104-142 1.32e-12

Myosin N-terminal SH3-like domain; This domain has an SH3-like fold. It is found at the N-terminus of many but not all myosins. The function of this domain is unknown.


:

Pssm-ID: 397036  Cd Length: 39  Bit Score: 63.56  E-value: 1.32e-12
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 1593656259  104 KKMVWIPSEKEGFEAASIKEEKGDEVLVELSNGQKMTVN 142
Cdd:pfam02736    1 KKLVWVPDPKEGFVKGEIKEEEGDKVTVETEDGKTVTVK 39
 
Name Accession Description Interval E-value
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
925-2005 0e+00

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 1421.10  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  925 TRQEEEMGQKDEELKAAKEVAAKVETELKDITQKHTQLMEERAQLEMKLHAETELYAEAEEMRVRLEAKKQELEEVLHEM 1004
Cdd:pfam01576    1 TRQEEEMQAKEEELQKVKEKQQKAESELKELEKKHQQLIEEKNILAEQLQAETELFAEAEEMRARLAARKQELEEILHDL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1005 ESRLEEEEDRSNALHNERKEMEQQLQLMEAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQKERKLLEER 1084
Cdd:pfam01576   81 ESRLEEEEERSQQLQNEKKKMQQHIQDLEEQLEEEEAARQKLQLEKVTTEAKIKKLEEDILLLEDQNSKLSKERKLLEER 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1085 LADMSSNLAEEEEKSKNLSKLKTKHESMISELELRMKKEEKGRLDMEKAKRKVEAELGDLQEQHADLQAQLAELRAQLAA 1164
Cdd:pfam01576  161 ISEFTSNLAEEEEKVKSLNKLKNKHEAMISDLEDRLKKEEKGRQELEKAKRKLDGESTDLQEQIAELQAQIEELRAQLAK 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1165 KEEELQATQARLEEECNQRGAAVKRVRELEVLISELQEDLEAERAARGKVEAARRDLGEELNALRTELEDSLGTTAAQQE 1244
Cdd:pfam01576  241 KEEELQAALARLEEEGAQKNNALKKLRELQAQIAELQEDLESERAARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1245 LRAKREQEVSMLKKAMEDEGRSHEAQVQDLRQKHSQAVEELTEQLEQAKRVRAGLEKAKQALEKESADLSADLRSLASAK 1324
Cdd:pfam01576  321 LRSKREQEVTELKKALEEETRSHEAQLQEMRQKHTQALEELSEQLEQAKRNKANLEKAKQALESENNELQAELKTLQQAK 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1325 QDVEHKKKKVEGQLNELNSRFNESERQRTELGERVSKLTTELDSVTGLLNEAEGKNIKLSKDVSSLSSQLQDAQELLSEE 1404
Cdd:pfam01576  401 QDSEHKRKKLEGQLQELQARLSESERQRAELAEKLSKLQSELESVSGLLSEAEGKSIKLSKDVSSLESQLQDTQELLQEE 480
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1405 TRQKLNLSGRLRQTEEDRNSLMEQLEEETEAKRAVERQVSSLNMQLSDSKKKLDEMSGTVEALEEGKKRLQRELEAANSD 1484
Cdd:pfam01576  481 TRQKLNLSSRLRQLEDERNSLQEQLEEEEEAKRNVERQLSTLQAQLSEMKKKLEEDAGAVEALEEAKKRLQRELEALTQR 560
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1485 YEEKASAYDKLEKSRGRMQQELEDVLMDLDSQRQLVSNLEKKQKKFDQMLAEERAVSCKFAEERDRAEAEAREKETRVLA 1564
Cdd:pfam01576  561 LEEKAAAYDKLEKTKNRLQQELDDLLVDLDHQRQLVSNLEKKQKKFDQMLAEEKAISARYAEERDRAEAEAREKETRALS 640
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1565 LARALEENQGALEEAEKTMKGLRADMEDLISSKDDVGKSVHDLEKAKRGLEAIVDEMRTQMEELEDELQVAEDAKLRLDV 1644
Cdd:pfam01576  641 LSRALEEALEAKEELERQNKQLRAEMEDLVSSKDDVGKNVHELERSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV 720
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1645 NTQALRAQHERELHARDELGEEKRKQLLKQVRELEAELEEERKQRGQASGSKKKLEGELKDMEDQLEATSRGRDEAVKQL 1724
Cdd:pfam01576  721 NMQALKAQFERDLQARDEQGEEKRRQLVKQVRELEAELEDERKQRAQAVAAKKKLELDLKELEAQIDAANKGRDEAVKQL 800
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1725 RKIQGQVKDLQRDLEDSRAAQKEVLASARESERRSKAMEADIVQLHEMLAAVERARKQAEVERDELSEELASNSSGKSLM 1804
Cdd:pfam01576  801 KKLQAQMKELQRELEETRASRDEILAQSKESEKKLKSLEAELLQLQEDLAASERAKRQAQQERDELADEIANGASGKSAL 880
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1805 SDEKRRLDTKISQLEEELEEEQANVESLNDRLRKSQQLVEQLGAELAAERSTSQSREGSRQQLERQNRELKAKMQEMEGQ 1884
Cdd:pfam01576  881 LDEKRRLEARIAQLEEELEEEQSNTELLNDRYRKLTLQVEQLTTELSAERSFSQKSESARQQLERQNKELKAKLQEMEGT 960
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1885 GRSKLKASIAALEAKLREAEEQLEIESRERQANGKNLRQKEKKLKDLTIQMEDERKQAQQYKDQAEKGNVRVKQLKHQLE 1964
Cdd:pfam01576  961 VKSKYKSSIAALEAKIAQLEEQLEQESRERQAANKLVRRTEKKLKEVLLQVEDERRNADQYKDQAEKANSRMKQLKRQLE 1040
                         1050      1060      1070      1080
                   ....*....|....*....|....*....|....*....|.
gi 1593656259 1965 EAEEEAQRMAAARRKLQRELDEATEANDTLSRDMASLRSKL 2005
Cdd:pfam01576 1041 EAEEEASRANAARRKLQRELDDATESAESMNREVSTLRSKL 1081
MYSc_class_II cd01377
class II myosins, motor domain; Myosin motor domain in class II myosins. Class II myosins, ...
169-848 0e+00

class II myosins, motor domain; Myosin motor domain in class II myosins. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. Thus, myosin II has two heads. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


Pssm-ID: 276951  Cd Length: 662  Bit Score: 1308.60  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd01377      1 ASVLHNLRERYYSDLIYTYSGLFCVAVNPYKRLPIYTEEVIDKYKGKRREEMPPHIFAIADNAYRNMLQDRENQSILITG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKDATPQpqqagslaYGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLN 328
Cdd:cd01377     81 ESGAGKTENTKKVIQYLASVAASSKKKKESGKK--------KGTLEDQILQANPILEAFGNAKTVRNNNSSRFGKFIRIH 152
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  329 FDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVA-GHVEISGQEDDEMFIE 407
Cdd:cd01377    153 FGSTGKIAGADIETYLLEKSRVVRQAKGERNYHIFYQLLSGADPELKEKLLLTGDPSYYFFLSqGELTIDGVDDAEEFKL 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  408 TLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVV 487
Cdd:cd01377    233 TDEAFDILGFSEEEKMSIFKIVAAILHLGNIKFKQRRREEQAELDGTEEADKAAHLLGVNSSDLLKALLKPRIKVGREWV 312
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  488 QKAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKsKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFN 567
Cdd:cd01377    313 TKGQNKEQVVFSVGALAKALYERLFLWLVKRINKTLDT-KSKRQYFIGVLDIAGFEIFEFNSFEQLCINYTNEKLQQFFN 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  568 HTMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNnpPGILALLDEECWFPKATDVSFVEKLLNTHTGHVK-FSKPK 646
Cdd:cd01377    392 HHMFVLEQEEYKKEGIEWTFIDFGLDLQPTIDLIEKPN--MGILSILDEECVFPKATDKTFVEKLYSNHLGKSKnFKKPK 469
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  647 QHKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRvvgletitkMSESSAPPKSKKGM 726
Cdd:cd01377    470 PKKSEAHFILKHYAGDVEYNIDGWLEKNKDPLNENVVALLKKSSDPLVASLFKDYEE---------SGGGGGKKKKKGGS 540
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  727 FRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYE 806
Cdd:cd01377    541 FRTVSQLHKEQLNKLMTTLRSTHPHFVRCIIPNEEKKPGKIDAPLVLHQLRCNGVLEGIRICRKGFPNRIIFAEFKQRYS 620
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|..
gi 1593656259  807 ILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd01377    621 ILAPNAIPKGFDDGKAACEKILKALQLDPELYRIGNTKVFFK 662
Myosin_head pfam00063
Myosin head (motor domain);
157-848 0e+00

Myosin head (motor domain);


Pssm-ID: 395017  Cd Length: 674  Bit Score: 1073.45  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  157 VEDMAALTFLNEASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMM 236
Cdd:pfam00063    1 VEDMVELSYLNEPSVLHNLKKRYKSDLIYTYSGLVLVAVNPYKQLPIYSEDMIKAYRGKRRGELPPHIFAIADEAYRSML 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  237 QDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKdatpqpqqagslaYGELEKQLLQANPILEAFGNAKTIKND 316
Cdd:pfam00063   81 QDKENQSILISGESGAGKTENTKKIMQYLASVSGSGSAGN-------------VGRLEEQILQSNPILEAFGNAKTVRNN 147
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  317 NSSRFGKFIKLNFDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVA-GHVE 395
Cdd:pfam00063  148 NSSRFGKYIEIQFDAKGDIVGGKIETYLLEKSRVVYQAEGERNYHIFYQLLAGASAQLKKELRLTNPKDYHYLSQsGCYT 227
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  396 ISGQEDDEMFIETLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAI 475
Cdd:pfam00063  228 IDGIDDSEEFKITDKAMDILGFSDEEQMGIFRIVAAILHLGNIEFKKERNDEQAVPDDTENLQKAASLLGIDSTELEKAL 307
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  476 LTPRIKVGREVVQKAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKSKRQSSSFLGILDIAGFEIFEDNSFEQLCI 555
Cdd:pfam00063  308 CKRRIKTGRETVSKPQNVEQANYARDALAKAIYSRLFDWLVDRINKSLDVKTIEKASFIGVLDIYGFEIFEKNSFEQLCI 387
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  556 NYTNERLQQLFNHTMFVLEQEEYKREGIQWSFIDFGlDLQPCIELIERPnnPPGILALLDEECWFPKATDVSFVEKLLNT 635
Cdd:pfam00063  388 NYVNEKLQQFFNHHMFKLEQEEYVREGIEWTFIDFG-DNQPCIDLIEKK--PLGILSLLDEECLFPKATDQTFLDKLYST 464
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  636 HTGHVKFSKPKQhKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRVVglETITKMSE 715
Cdd:pfam00063  465 FSKHPHFQKPRL-QGETHFIIKHYAGDVEYNVEGFLEKNKDPLNDDLVSLLKSSSDPLLAELFPDYETAE--SAAANESG 541
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  716 SSAPPKSKKGMFRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNR 795
Cdd:pfam00063  542 KSTPKRTKKKRFITVGSQFKESLGELMKTLNSTNPHYIRCIKPNEKKRAGVFDNSLVLHQLRCNGVLEGIRIRRAGFPNR 621
                          650       660       670       680       690
                   ....*....|....*....|....*....|....*....|....*....|...
gi 1593656259  796 IVFQEFRQRYEILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:pfam00063  622 ITFQEFVQRYRILAPKTWPKWKGDAKKGCEAILQSLNLDKEEYQFGKTKIFFR 674
MYSc smart00242
Myosin. Large ATPases; ATPase; molecular motor. Muscle contraction consists of a cyclical ...
150-860 0e+00

Myosin. Large ATPases; ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.


Pssm-ID: 214580  Cd Length: 677  Bit Score: 990.51  E-value: 0e+00
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   150 NPPKFSKVEDMAALTFLNEASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITD 229
Cdd:smart00242    1 NPPKFEGVEDLVLLTYLNEPAVLHNLKKRYLKDLIYTYIGLVLVAVNPYKQLPIYTDEVIKKYRGKSRGELPPHVFAIAD 80
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   230 NAYRNMMQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKkdatpqpqqagslayGELEKQLLQANPILEAFGN 309
Cdd:smart00242   81 NAYRNMLNDKENQSIIISGESGAGKTENTKKIMQYLASVSGSNTEV---------------GSVEDQILESNPILEAFGN 145
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   310 AKTIKNDNSSRFGKFIKLNFDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFL 389
Cdd:smart00242  146 AKTLRNNNSSRFGKFIEIHFDAKGKIIGAKIETYLLEKSRVVSQAKGERNYHIFYQLLAGASEELKKELGLKSPEDYRYL 225
                           250       260       270       280       290       300       310       320
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   390 -VAGHVEISGQEDDEMFIETLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDT-AAQKVCHLQGIN 467
Cdd:smart00242  226 nQGGCLTVDGIDDAEEFKETLNAMRVLGFSEEEQESIFKILAAILHLGNIEFEEGRNDNAASTVKDKeELSNAAELLGVD 305
                           330       340       350       360       370       380       390       400
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   468 ITDFIRAILTPRIKVGREVVQKAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKsKRQSSSFLGILDIAGFEIFED 547
Cdd:smart00242  306 PEELEKALTKRKIKTGGEVITKPLNVEQALDARDALAKALYSRLFDWLVKRINQSLSF-KDGSTYFIGVLDIYGFEIFEV 384
                           410       420       430       440       450       460       470       480
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   548 NSFEQLCINYTNERLQQLFNHTMFVLEQEEYKREGIQWSFIDFGlDLQPCIELIErpNNPPGILALLDEECWFPKATDVS 627
Cdd:smart00242  385 NSFEQLCINYANEKLQQFFNQHVFKLEQEEYEREGIDWTFIDFF-DNQDCIDLIE--KKPPGILSLLDEECRFPKGTDQT 461
                           490       500       510       520       530       540       550       560
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   628 FVEKLLNTHTGHVKFSKPKQhKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWkdadrvvgl 707
Cdd:smart00242  462 FLEKLNQHHKKHPHFSKPKK-KGRTEFIIKHYAGDVTYDVTGFLEKNKDTLSDDLIELLQSSKNPLIASLF--------- 531
                           570       580       590       600       610       620       630       640
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   708 etitkmsESSAPPKSKKGMFRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRI 787
Cdd:smart00242  532 -------PSGVSNAGSKKRFQTVGSQFKEQLNELMDTLNSTNPHFIRCIKPNEEKKPGDFDSSLVLHQLRYLGVLENIRI 604
                           650       660       670       680       690       700       710
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1593656259   788 CRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFRTGVLAQLEEERD 860
Cdd:smart00242  605 RRAGFPYRLPFDEFLQRYRVLLPDTWPPWGGDAKKACEALLQSLGLDEDEYQLGKTKVFLRPGQLAELEELRE 677
COG5022 COG5022
Myosin heavy chain [General function prediction only];
107-1702 0e+00

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 888.66  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  107 VWIPSEKEGFEAASIKEE---KGD-EVLVELSNGQKMTVNKDDIQ--KMNPPKFSKVEDMAALTFLNEASVLQNLRERYF 180
Cdd:COG5022     12 CWIPDEEKGWIWAEIIKEafnKGKvTEEGKKEDGESVSVKKKVLGndRIKLPKFDGVDDLTELSYLNEPAVLHNLEKRYN 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  181 SSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTGESGAGKTENTKK 260
Cdd:COG5022     92 NGQIYTYSGLVLIAVNPYRDLGIYTDDIIQSYSGKNRLELEPHVFAIAEEAYRNLLSEKENQTIIISGESGAGKTENAKR 171
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  261 VIQYLAVVASSHkgkkdaTPQPQQagslaygeLEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLNFDVTGYIVGANI 340
Cdd:COG5022    172 IMQYLASVTSSS------TVEISS--------IEKQILATNPILEAFGNAKTVRNDNSSRFGKYIKIEFDENGEICGAKI 237
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  341 DTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVAGHV-EISGQEDDEMFIETLEAMEIMGFTE 419
Cdd:COG5022    238 ETYLLEKSRVVHQNKNERNYHIFYQLLAGDPEELKKLLLLQNPKDYIYLSQGGCdKIDGIDDAKEFKITLDALKTIGIDE 317
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  420 EERMGMMKVVSTVLQLGNIKFEKERNsEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVVQKAQTKQQADFA 499
Cdd:COG5022    318 EEQDQIFKILAAILHIGNIEFKEDRN-GAAIFSDNSVLDKACYLLGIDPSLFVKWLVKRQIKTGGEWIVVPLNLEQALAI 396
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  500 VEALAKAMYERLFRWILARVNKTLDKSKRQsSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFNHTMFVLEQEEYK 579
Cdd:COG5022    397 RDSLAKALYSNLFDWIVDRINKSLDHSAAA-SNFIGVLDIYGFEIFEKNSFEQLCINYTNEKLQQFFNQHMFKLEQEEYV 475
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  580 REGIQWSFIDFgLDLQPCIELIERpNNPPGILALLDEECWFPKATDVSFVEKL---LNTHTGHvKFSKPKQHKDKlmFTV 656
Cdd:COG5022    476 KEGIEWSFIDY-FDNQPCIDLIEK-KNPLGILSLLDEECVMPHATDESFTSKLaqrLNKNSNP-KFKKSRFRDNK--FVV 550
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  657 LHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRvvgletitkmsessappKSKKGMFRTVGQLYKE 736
Cdd:COG5022    551 KHYAGDVEYDVEGFLDKNKDPLNDDLLELLKASTNEFVSTLFDDEEN-----------------IESKGRFPTLGSRFKE 613
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  737 SLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANA---- 812
Cdd:COG5022    614 SLNSLMSTLNSTQPHYIRCIKPNEEKSPWTFDNQMVLSQLRCCGVLETIRISRAGFPSRWTFDEFVQRYRILSPSKswtg 693
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  813 IPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFRTGVLAQLEEERDLKLTVVIIAFQAQARGFLARKAFSKRQQQLTA 892
Cdd:COG5022    694 EYTWKEDTKNAVKSILEELVIDSSKYQIGNTKVFFKAGVLAALEDMRDAKLDNIATRIQRAIRGRYLRRRYLQALKRIKK 773
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  893 MKVIQRNCACYLKLKNWQWWRLFTKVKPLLQVTRQEEEMGQKDEELKaakevaaKVETELKDITQKHTQLMEERAQLEMK 972
Cdd:COG5022    774 IQVIQHGFRLRRLVDYELKWRLFIKLQPLLSLLGSRKEYRSYLACII-------KLQKTIKREKKLRETEEVEFSLKAEV 846
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  973 LHAETELYAEAEEmRVRLEAKKQELEEVLhemesrleeeedrsnalhnerkemeqqlqlmeahiAEEEDARQKLQMEKVS 1052
Cdd:COG5022    847 LIQKFGRSLKAKK-RFSLLKKETIYLQSA-----------------------------------QRVELAERQLQELKID 890
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1053 VEgKVKKLEEdilmmedQNNKLQKErkLLEERLADMSSNLAEEEEKSKNLSKLK-TKHESMISELELRM--KKEEKGRLD 1129
Cdd:COG5022    891 VK-SISSLKL-------VNLELESE--IIELKKSLSSDLIENLEFKTELIARLKkLLNNIDLEEGPSIEyvKLPELNKLH 960
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1130 MEKAKrkveaeLGDLQEQHADLQAQLAELRAQLAAKEEELQATQARLEEECNQRGAAVKRVRELEVLISELQEDLEAERa 1209
Cdd:COG5022    961 EVESK------LKETSEEYEDLLKKSTILVREGNKANSELKNFKKELAELSKQYGALQESTKQLKELPVEVAELQSASK- 1033
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1210 argkveaarrdlgeELNALRTELedslgttaaqqelraKREQEVSMLKKAMEDEGRSHEAQVQDLRQKHSQAVEELTeQL 1289
Cdd:COG5022   1034 --------------IISSESTEL---------------SILKPLQKLKGLLLLENNQLQARYKALKLRRENSLLDDK-QL 1083
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1290 EQAKRVRaGLEKAKQALEKESADLSADLRSLASAKQDVEHKKKKVEGQLNELNSRFNESERQRTelgERVSKLTTELDSV 1369
Cdd:COG5022   1084 YQLESTE-NLLKTINVKDLEVTNRNLVKPANVLQFIVAQMIKLNLLQEISKFLSQLVNTLEPVF---QKLSVLQLELDGL 1159
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1370 TGLLNEAEgkniKLSKDVSSLSSqlqdaQELLSEETRQKLNLSGRLrqteedrnSLMEQLEEETEAKRAVERQVSSLNMQ 1449
Cdd:COG5022   1160 FWEANLEA----LPSPPPFAALS-----EKRLYQSALYDEKSKLSS--------SEVNDLKNELIALFSKIFSGWPRGDK 1222
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1450 LSDSKKKLDEMSGTVEALEEGKKRLQRELEAANSDYEEKASAYDKLEKSrgRMQQELEDVLMDLdSQRQLVSNLekKQKK 1529
Cdd:COG5022   1223 LKKLISEGWVPTEYSTSLKGFNNLNKKFDTPASMSNEKLLSLLNSIDNL--LSSYKLEEEVLPA-TINSLLQYI--NVGL 1297
                         1450      1460      1470      1480      1490      1500      1510      1520
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1530 FDQMLAEERAVSCKFAEE--RDRAEAEAREKETRVLALARALEEnqgaLEEAEKTMKGLRADMEDLiSSKDDVGKSVHDL 1607
Cdd:COG5022   1298 FNALRTKASSLRWKSATEvnYNSEELDDWCREFEISDVDEELEE----LIQAVKVLQLLKDDLNKL-DELLDACYSLNPA 1372
                         1530      1540      1550      1560      1570      1580      1590      1600
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1608 EKAKRGLEaivDEMRTQMEELEDELQVAEDAKLRLDVNTQALRAQHERELHARDELGEEKRKQLLKqvreLEAELEEERK 1687
Cdd:COG5022   1373 EIQNLKSR---YDPADKENNLPKEILKKIEALLIKQELQLSLEGKDETEVHLSEIFSEEKSLISLD----RNSIYKEEVL 1445
                         1610
                   ....*....|....*
gi 1593656259 1688 QRGQASGSKKKLEGE 1702
Cdd:COG5022   1446 SSLSALLTKEKIALL 1460
PTZ00014 PTZ00014
myosin-A; Provisional
131-891 1.10e-128

myosin-A; Provisional


Pssm-ID: 240229 [Multi-domain]  Cd Length: 821  Bit Score: 425.98  E-value: 1.10e-128
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  131 VELSNGQKMTVNKDDIQKMNPP-KFSKVEDMAALTFLNEASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKII 209
Cdd:PTZ00014    71 IDPPTNSTFEVKPEHAFNANSQiDPMTYGDIGLLPHTNIPCVLDFLKHRYLKNQIYTTADPLLVAINPFKDLGNTTNDWI 150
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  210 EMYKGKKRHE-VPPHIYSITDNAYRNMMQDREDQSILCTGESGAGKTENTKKVIQYLAvvaSSHKGKKDATPQpqqagsl 288
Cdd:PTZ00014   151 RRYRDAKDSDkLPPHVFTTARRALENLHGVKKSQTIIVSGESGAGKTEATKQIMRYFA---SSKSGNMDLKIQ------- 220
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  289 aygeleKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLNFDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVA 368
Cdd:PTZ00014   221 ------NAIMAANPVLEAFGNAKTIRNNNSSRFGRFMQLQLGEEGGIRYGSIVAFLLEKSRVVTQEDDERSYHIFYQLLK 294
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  369 GAKDKLREELLLEDFSCYRFLVAGHVEISGQEDDEMFIETLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFE-KERN-- 445
Cdd:PTZ00014   295 GANDEMKEKYKLKSLEEYKYINPKCLDVPGIDDVKDFEEVMESFDSMGLSESQIEDIFSILSGVLLLGNVEIEgKEEGgl 374
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  446 SEQATMPDDTAA--QKVCHLQGINITDFIRAILTPRIKVGREVVQKAQTKQQADFAVEALAKAMYERLFRWILARVNKTL 523
Cdd:PTZ00014   375 TDAAAISDESLEvfNEACELLFLDYESLKKELTVKVTYAGNQKIEGPWSKDESEMLKDSLSKAVYEKLFLWIIRNLNATI 454
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  524 DKSKrQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFNHTMFVLEQEEYKREGIQWSFIDFgLDLQPCIELIER 603
Cdd:PTZ00014   455 EPPG-GFKVFIGMLDIFGFEVFKNNSLEQLFINITNEMLQKNFVDIVFERESKLYKDEGISTEELEY-TSNESVIDLLCG 532
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  604 PNNppGILALLDEECWFPKATDVSFVEKLLNTHTGHVKFSKPKQHKDKlMFTVLHYAGKVDYNAANWLTKNMDPLNDNVT 683
Cdd:PTZ00014   533 KGK--SVLSILEDQCLAPGGTDEKFVSSCNTNLKNNPKYKPAKVDSNK-NFVIKHTIGDIQYCASGFLFKNKDVLRPELV 609
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  684 ALLNNSSSNFIQDLWKDADRVVGletitkmsessappKSKKGMFrtVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKR 763
Cdd:PTZ00014   610 EVVKASPNPLVRDLFEGVEVEKG--------------KLAKGQL--IGSQFLNQLDSLMSLINSTEPHFIRCIKPNENKK 673
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  764 AGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQS 843
Cdd:PTZ00014   674 PLDWNSSKVLIQLHSLSILEALQLRQLGFSYRRTFAEFLSQFKYLDLAVSNDSSLDPKEKAEKLLERSGLPKDSYAIGKT 753
                          730       740       750       760       770
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1593656259  844 KMFF-RTGV--LAQLEEERDLKLTVVIIAFQAQARGFLARKAFSKRQQQLT 891
Cdd:PTZ00014   754 MVFLkKDAAkeLTQIQREKLAAWEPLVSVLEALILKIKKKRKVRKNIKSLV 804
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
934-1805 1.05e-33

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 142.50  E-value: 1.05e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  934 KDEELKAAKEVAA--------KVETELK-DITQKHTQ-----LMEERAQLEmKLHAETELYAEAEEMRVRLEAKK----- 994
Cdd:TIGR02168  153 KPEERRAIFEEAAgiskykerRKETERKlERTRENLDrlediLNELERQLK-SLERQAEKAERYKELKAELRELElallv 231
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  995 ---QELEEVLHEMESRLEEEEDRSNALHNERKEMEQQLQLMEAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQN 1071
Cdd:TIGR02168  232 lrlEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRERL 311
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1072 NKLQKERKLLEERLADMSSNLAEEEEKSKNLSKLKTKHESMISELELRMKKEEKGRLDMEKAKRKVEAELGDLQEQHADL 1151
Cdd:TIGR02168  312 ANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQL 391
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1152 QAQLAELRAQLAAKEEELQATQARLEEECNQRGAAVKRVRELEVliSELQEDLEAERAARGKVEAARRDLGEELNALRTE 1231
Cdd:TIGR02168  392 ELQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAEL--KELQAELEELEEELEELQEELERLEEALEELREE 469
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1232 LEdslgttAAQQELRAKR--EQEVSMLKKAMEDEGRSHEAQVQDLRQ--KHSQAVEELTEQLEQAKRVRAGLEKAKQALE 1307
Cdd:TIGR02168  470 LE------EAEQALDAAEreLAQLQARLDSLERLQENLEGFSEGVKAllKNQSGLSGILGVLSELISVDEGYEAAIEAAL 543
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1308 KESADLSADlRSLASAKQDVEHKKKKVEGQLNELnsrfneserqrtelgervsklttELDSVTGLLNEAEGKNIKLSKDv 1387
Cdd:TIGR02168  544 GGRLQAVVV-ENLNAAKKAIAFLKQNELGRVTFL-----------------------PLDSIKGTEIQGNDREILKNIE- 598
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1388 sslsSQLQDAQELLSEETRQKLNLSGRLRQTE--EDRNSLMEQLEEETEAKRAVERQVSSLNMQLSDSKKKLDEMSGTVE 1465
Cdd:TIGR02168  599 ----GFLGVAKDLVKFDPKLRKALSYLLGGVLvvDDLDNALELAKKLRPGYRIVTLDGDLVRPGGVITGGSAKTNSSILE 674
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1466 ALEEgKKRLQRELEAANSDYEEKASAYDKLEKSRGRMQQELEDVLMDLDSQRQLVSNLEKKqkkfdqmLAEERAVSCKFA 1545
Cdd:TIGR02168  675 RRRE-IEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKD-------LARLEAEVEQLE 746
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1546 EERDRAEAEAREKETRVLALARALEENQGALEEAEKTMKGLRADMED-------LISSKDDVGKSVHDLEKAKRGLEAIV 1618
Cdd:TIGR02168  747 ERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQlkeelkaLREALDELRAELTLLNEEAANLRERL 826
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1619 DEMRTQMEELEDELQVAEDAKLRLDVNTQALRAQHERELHARDELgEEKRKQLLKQVRELEAELEEERKQRGQASGSKKK 1698
Cdd:TIGR02168  827 ESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEEL-ESELEALLNERASLEEALALLRSELEELSEELRE 905
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1699 LEGELKDMEDQLEATSRGRDEAVKQLRKIQGQVKDLQ--------RDLEDSRAAQKEVLASARESERRSKAMEADIVQLH 1770
Cdd:TIGR02168  906 LESKRSELRRELEELREKLAQLELRLEGLEVRIDNLQerlseeysLTLEEAEALENKIEDDEEEARRRLKRLENKIKELG 985
                          890       900       910
                   ....*....|....*....|....*....|....*..
gi 1593656259 1771 EM-LAAVERARKQAEvERDELSEELAS-NSSGKSLMS 1805
Cdd:TIGR02168  986 PVnLAAIEEYEELKE-RYDFLTAQKEDlTEAKETLEE 1021
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
962-1622 2.76e-20

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 98.21  E-value: 2.76e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  962 LMEERAQLEMKLHAETELYAEAEEMRVRLEAKKQELEEVLHEMESRLEEEEDRSNALHNERKEMEQqlqlMEAHIAEEEd 1041
Cdd:PRK03918   167 LGEVIKEIKRRIERLEKFIKRTENIEELIKEKEKELEEVLREINEISSELPELREELEKLEKEVKE----LEELKEEIE- 241
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1042 arqKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQKERKLLEERLADMSSnLAEEEEKSKNLSKLKTKHesmiselelrmk 1121
Cdd:PRK03918   242 ---ELEKELESLEGSKRKLEEKIRELEERIEELKKEIEELEEKVKELKE-LKEKAEEYIKLSEFYEEY------------ 305
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1122 keekgrldmEKAKRKVEAELGDLQEQHADLQAQLAElraqLAAKEEELQATQARLEEECNQRGAAVKRVRELEvLISELQ 1201
Cdd:PRK03918   306 ---------LDELREIEKRLSRLEEEINGIEERIKE----LEEKEERLEELKKKLKELEKRLEELEERHELYE-EAKAKK 371
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1202 EDLEAERAARG--KVEAARRDLgEELNALRTELEDSLGTTAAQqelRAKREQEVSMLKKAMEdegrsheaQVQDLRQKHS 1279
Cdd:PRK03918   372 EELERLKKRLTglTPEKLEKEL-EELEKAKEEIEEEISKITAR---IGELKKEIKELKKAIE--------ELKKAKGKCP 439
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1280 QAVEELTEqleqakrvraglEKAKQALEKESADLSadlrslasakqDVEHKKKKVEGQLNELNSRFNESERQRTElGERV 1359
Cdd:PRK03918   440 VCGRELTE------------EHRKELLEEYTAELK-----------RIEKELKEIEEKERKLRKELRELEKVLKK-ESEL 495
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1360 SKLTTELDSVTGLLNEAEGKNIKLSKdvsslssqlQDAQELlsEETRQKLN-LSGRLRQTEEDrnslMEQLEEETEAKRA 1438
Cdd:PRK03918   496 IKLKELAEQLKELEEKLKKYNLEELE---------KKAEEY--EKLKEKLIkLKGEIKSLKKE----LEKLEELKKKLAE 560
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1439 VERQVSSLNMQLSDSKKKLDEMSgtVEALEEGKKRLQrELEAANSDYEEKASAYDKLEksrgRMQQELEDVLMDLDSQRQ 1518
Cdd:PRK03918   561 LEKKLDELEEELAELLKELEELG--FESVEELEERLK-ELEPFYNEYLELKDAEKELE----REEKELKKLEEELDKAFE 633
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1519 lvsNLEKKQKKFDQMLAEERAVSCKFAEER-DRAEAEAREKETRVLALARALEENQGALEEAEKTMKGLRADMEDLISSK 1597
Cdd:PRK03918   634 ---ELAETEKRLEELRKELEELEKKYSEEEyEELREEYLELSRELAGLRAELEELEKRREEIKKTLEKLKEELEEREKAK 710
                          650       660
                   ....*....|....*....|....*
gi 1593656259 1598 ddvgKSVHDLEKAKRGLEAIVDEMR 1622
Cdd:PRK03918   711 ----KELEKLEKALERVEELREKVK 731
Myosin_N pfam02736
Myosin N-terminal SH3-like domain; This domain has an SH3-like fold. It is found at the ...
104-142 1.32e-12

Myosin N-terminal SH3-like domain; This domain has an SH3-like fold. It is found at the N-terminus of many but not all myosins. The function of this domain is unknown.


Pssm-ID: 397036  Cd Length: 39  Bit Score: 63.56  E-value: 1.32e-12
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 1593656259  104 KKMVWIPSEKEGFEAASIKEEKGDEVLVELSNGQKMTVN 142
Cdd:pfam02736    1 KKLVWVPDPKEGFVKGEIKEEEGDKVTVETEDGKTVTVK 39
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
1033-1349 1.16e-11

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 69.94  E-value: 1.16e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1033 EAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQKERKLLEERLAdmssnlaEEEEKSKNLSKLKTKHESM 1112
Cdd:NF033930    33 EAPVASQSKAEKDYDAAVKKSEAAKKAYEEAKKKAEDAQKKYDEDQKKTEEKAK-------KEKKASEEEQKANLAVQKA 105
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1113 IseLELRMKKEEKGRlDMEKAKRKVEAELGDLQEQHADLQAQLAELRAQLAAKEEELQATQARLEEECNQRGAAVKRVRE 1192
Cdd:NF033930   106 Y--VKYRKAQRRKKS-DYKKKLAEADKKIDEAKKKQKEAKAEFNKVRAKVVPEAEELAETKKKAEEAKAEEPVAKKKVDE 182
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1193 LEVLISELQEDLEAERAARGKVEAARRDLGEE----------LNALRTELEDSLGTTAAQQELRAKREQEVS-----MLK 1257
Cdd:NF033930   183 AKKKVEEAKKKVEAEEAEIEKLQNEEVALEAKiaelenqvdnLEKELAEIDESDSEDYIKEGLRAPLESELDakqakLAK 262
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1258 KAMEDE----GRSHEAQVQDLRQKHSqAVEELTEQLEQAKRVRAGLEKAKQALEKESADLSADLrsLASAKQDVEHKKKK 1333
Cdd:NF033930   263 KQTELEklldSLDPEGKTQDELDKEA-AEEELSKKIDELDNEVAKLEKEVSDLENSDNNVADYY--KEALEKDLATKKAE 339
                          330
                   ....*....|....*.
gi 1593656259 1334 VEGQLNELNSRFNESE 1349
Cdd:NF033930   340 LEKTQKDLDKALNELG 355
Streccoc_I_II NF033804
antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins ...
935-1347 1.59e-11

antigen I/II family LPXTG-anchored adhesin; Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.


Pssm-ID: 411384 [Multi-domain]  Cd Length: 1552  Bit Score: 69.97  E-value: 1.59e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  935 DEELKAAKEVAAKVETElKDITQKHTQLMEERAQLEMKLHAEtelYA-EAEEMRVRLEAKKQELEevlhemesRLEEEED 1013
Cdd:NF033804    95 DKAVKDAKSAGVNVVQD-ETVDKGTATTATENAQKQTEIKSD---YAkQAEEIKKTTEAYKKEVA--------AHQAETD 162
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1014 RSNAlhnERKEMEQQLQL-MEAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQK--ERKL--LEERLADM 1088
Cdd:NF033804   163 KINA---ENKAAKDKYQKdLKAHQAEVEKINTANATAKAEYEAKLAQYQKDLAAVQKANEDSQAdyQNKLsaYQTELARV 239
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1089 -SSNLAEEEEKSKNLSKLKTKHESMISELELRMKKEEKGRLDMEKAKRKVEAELGDLQEQHADLQAqlaELRAQLAAKEE 1167
Cdd:NF033804   240 qKANAEAKEAYDKAVKENTAKNAALQAENEAIKQRNETAKANYEAAMKQYEADLAAIKKAKEDNDA---DYQAKLAAYQT 316
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1168 ELQATQArleEECNQRGAAVKRVRELEVLISELQEDLEAER----AARGKVEAARRDLGEELNALRTELEDSLgttAAQQ 1243
Cdd:NF033804   317 ELARVQK---ANADAKAAYEKAVEENTAKNTAIQAENEAIKqrnaAAKATYEAALKQYEADLAAVKKANAANE---ADYQ 390
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1244 ELRAKREQEVSMLKKAMEDEGRSHEAQVQDLRQKHSqaveELTEQLEQAKRVRAGLEKAKQA-LEKESADLS---ADLRS 1319
Cdd:NF033804   391 AKLAAYQTELARVQKANADAKAAYEKAVEDNKAKNA----ALQAENEAIKQRNAAAKADYEAkLAKYQADLAkykKDLAE 466
                          410       420
                   ....*....|....*....|....*...
gi 1593656259 1320 LASAKQDVEHKKKKVEGQLNELNSRFNE 1347
Cdd:NF033804   467 YPAKLKAYEDEQAKIKAALAELEKKKNE 494
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
1417-1764 1.68e-10

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 66.09  E-value: 1.68e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1417 QTEEDRNSLMEQLEEeteAKRAVErqvsSLNMQLSDSKKKLDEMSGTVEALEEGKKRLQRELEAANSDYEEKASAYDKLE 1496
Cdd:NF033930    41 KAEKDYDAAVKKSEA---AKKAYE----EAKKKAEDAQKKYDEDQKKTEEKAKKEKKASEEEQKANLAVQKAYVKYRKAQ 113
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1497 KSRGRM-QQELEDVLMDLDSQRQlvsNLEKKQKKFDQMLAEERAVSCKFAEERDRAE-AEAREKEtrvlaLARALEENQG 1574
Cdd:NF033930   114 RRKKSDyKKKLAEADKKIDEAKK---KQKEAKAEFNKVRAKVVPEAEELAETKKKAEeAKAEEPV-----AKKKVDEAKK 185
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1575 ALEEAEKTMKGLRADMEDLISSKDDVGKSVHDLEKAKRGLEAIVDEmrtqMEELEDElqvaedaklrlDVNTQALRAQHE 1654
Cdd:NF033930   186 KVEEAKKKVEAEEAEIEKLQNEEVALEAKIAELENQVDNLEKELAE----IDESDSE-----------DYIKEGLRAPLE 250
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1655 RELHARdelgeeKRKQLLKQVRELEAELEEERKQRGQASGSKKKLEGELKDMEDQLEATSRGRDEAVKQLRKIQGQVKDL 1734
Cdd:NF033930   251 SELDAK------QAKLAKKQTELEKLLDSLDPEGKTQDELDKEAAEEELSKKIDELDNEVAKLEKEVSDLENSDNNVADY 324
                          330       340       350
                   ....*....|....*....|....*....|
gi 1593656259 1735 QRDledsrAAQKEVLASARESERRSKAMEA 1764
Cdd:NF033930   325 YKE-----ALEKDLATKKAELEKTQKDLDK 349
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
903-1184 2.14e-07

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 56.07  E-value: 2.14e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  903 YLKLKNWQWWRLFTKVKPLLQVTRQEEEMGQKDEELKAA-KEVAAKV---ETELKDITQKHTQLMEERAQLEMKLHaetE 978
Cdd:NF033930   106 YVKYRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEfNKVRAKVvpeAEELAETKKKAEEAKAEEPVAKKKVD---E 182
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  979 LYAEAEEMRVRLEAKKQELEevlhemesrleeeedrsnALHNERKEMEQQlqlmeahIAEEEDARQKLqmekvsvEGKVK 1058
Cdd:NF033930   183 AKKKVEEAKKKVEAEEAEIE------------------KLQNEEVALEAK-------IAELENQVDNL-------EKELA 230
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1059 KLEEDilmmEDQNNKLQKERKLLEERLADMSSNLAEEEEKSKNL-------SKLKTKHESMISELELRMKKEEkgrLDME 1131
Cdd:NF033930   231 EIDES----DSEDYIKEGLRAPLESELDAKQAKLAKKQTELEKLldsldpeGKTQDELDKEAAEEELSKKIDE---LDNE 303
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....
gi 1593656259 1132 KAkrKVEAELGDLQEQHADLQAQ-LAELRAQLAAKEEELQATQARLEEECNQRG 1184
Cdd:NF033930   304 VA--KLEKEVSDLENSDNNVADYyKEALEKDLATKKAELEKTQKDLDKALNELG 355
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
1022-1320 1.37e-06

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 53.38  E-value: 1.37e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1022 RKEMEQQLQLMEAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQKERKLLEERLADMSSNLAEEEEKSKN 1101
Cdd:NF033930    93 EEEQKANLAVQKAYVKYRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRAKVVPEAEELAETKKKAEEAKAE 172
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1102 LSKLKTKHESMISELELRMKKeekgrldMEKAKRKVEAelgdLQEQHADLQAQLAELRAQLAAKEEELQATQARLEEEcn 1181
Cdd:NF033930   173 EPVAKKKVDEAKKKVEEAKKK-------VEAEEAEIEK----LQNEEVALEAKIAELENQVDNLEKELAEIDESDSED-- 239
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1182 qrgaAVKrvrelEVLISELQEDLEAERAargkveaarrdlgeELNALRTELE---DSLGTTAAQQELRAKREQEVSMLKK 1258
Cdd:NF033930   240 ----YIK-----EGLRAPLESELDAKQA--------------KLAKKQTELEkllDSLDPEGKTQDELDKEAAEEELSKK 296
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1593656259 1259 AMEdegrsHEAQVQDLRQKHSQAVEELTEQLEQAKrvrAGLEK---AKQA-LEKESADLSADLRSL 1320
Cdd:NF033930   297 IDE-----LDNEVAKLEKEVSDLENSDNNVADYYK---EALEKdlaTKKAeLEKTQKDLDKALNEL 354
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
1609-1951 5.86e-05

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 47.98  E-value: 5.86e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1609 KAKRGLEAIVDEMRTQMEELEDELQVAEDAKLRLDVNTQALRAQHERELHARDELGEEKRKQLLKQVRELeaeleeeRKQ 1688
Cdd:NF033930    41 KAEKDYDAAVKKSEAAKKAYEEAKKKAEDAQKKYDEDQKKTEEKAKKEKKASEEEQKANLAVQKAYVKYR-------KAQ 113
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1689 RGQASGSKKKLEGELKDMEdqlEATSRgRDEAVKQLRKIQGQVKDLQRDLEDSRaaQKEVLASARESERRSKAMEADivq 1768
Cdd:NF033930   114 RRKKSDYKKKLAEADKKID---EAKKK-QKEAKAEFNKVRAKVVPEAEELAETK--KKAEEAKAEEPVAKKKVDEAK--- 184
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1769 lhemlAAVERARKQAEVERDELSEElasnssgkslmSDEKRRLDTKIsqleeeleeeqANVESLNDRLrksqqlvEQLGA 1848
Cdd:NF033930   185 -----KKVEEAKKKVEAEEAEIEKL-----------QNEEVALEAKI-----------AELENQVDNL-------EKELA 230
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1849 ELAAERSTSQSREGSRQQLERQ----NRELKAKMQEMEGQGRSKLKASIAALEAKLREAEEQLEIESRERQANGKNLRQK 1924
Cdd:NF033930   231 EIDESDSEDYIKEGLRAPLESEldakQAKLAKKQTELEKLLDSLDPEGKTQDELDKEAAEEELSKKIDELDNEVAKLEKE 310
                          330       340
                   ....*....|....*....|....*..
gi 1593656259 1925 EKKLKDLTIQMEDERKQAQQyKDQAEK 1951
Cdd:NF033930   311 VSDLENSDNNVADYYKEALE-KDLATK 336
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
1198-1514 7.63e-05

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 47.60  E-value: 7.63e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1198 SELQEDLEAeraARGKVEAARRDLGE---ELNALRTELEDSLGTTaaqqELRAKREQEVSM-LKKAMEDEGRSHEAQVQD 1273
Cdd:NF033930    40 SKAEKDYDA---AVKKSEAAKKAYEEakkKAEDAQKKYDEDQKKT----EEKAKKEKKASEeEQKANLAVQKAYVKYRKA 112
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1274 LRQKHSQAVEELTEQLEQAKRVRAGLEKAKQALEKESADLSADLRSLA-------SAKQDVEHKKKKVEgqlnELNSRFN 1346
Cdd:NF033930   113 QRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEFNKVRAKVVPEAEELAetkkkaeEAKAEEPVAKKKVD----EAKKKVE 188
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1347 ESERQRTELGERVSKLTTELDSVTGLLNEAEGKNIKLSKDVSSL--SSQLQDAQELLSEETRQKLNL-SGRLRQTEEDRN 1423
Cdd:NF033930   189 EAKKKVEAEEAEIEKLQNEEVALEAKIAELENQVDNLEKELAEIdeSDSEDYIKEGLRAPLESELDAkQAKLAKKQTELE 268
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1424 SLMEQLeeETEAKRAVERQVSSLNMQLSDskkKLDEMSGTVEALEEGKKRLQRELEAANSDYEEkasaydKLEKSRGRMQ 1503
Cdd:NF033930   269 KLLDSL--DPEGKTQDELDKEAAEEELSK---KIDELDNEVAKLEKEVSDLENSDNNVADYYKE------ALEKDLATKK 337
                          330
                   ....*....|.
gi 1593656259 1504 QELEDVLMDLD 1514
Cdd:NF033930   338 AELEKTQKDLD 348
antiphage_ZorA_3 NF033916
anti-phage defense ZorAB system ZorA; Proteins of this subfamily are putative H+ channel ...
1149-1396 1.13e-03

anti-phage defense ZorAB system ZorA; Proteins of this subfamily are putative H+ channel proteins, but it has been reported that they are also involved in anti-phage defense.


Pssm-ID: 411477 [Multi-domain]  Cd Length: 509  Bit Score: 43.66  E-value: 1.13e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1149 ADLQAQLAELRAQLAAKEEELQATQARLEEECNQRGAAVKRVRELEVLISELQEDLEAERAaRGKVEAARRDLGEELNAL 1228
Cdd:NF033916   284 SDMQAGQNAMQAGMNEMLASLQASVARIGSEGEGAGERIAGQLEKLFADSEARQQAMAEQM-QAFVEQIQSSVGQGQSET 362
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1229 RTELEDSLGTTAAQQElrakreQEVSMLKKAMEDEGRSHEAQVQDLRQKHSQAVEELTEQLEQakrVRAGLEKAKQALeK 1308
Cdd:NF033916   363 MEKMAASVDALGTQLG------GLFSQLEQQQQQMDESQQEAQQRLHEQTERLIGSLDDQIKQ---LLALVAEQQQAM-Q 432
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1309 ESADLSADL--RSLASAKQDVEHKKKKVEgqlnelnsRFNESerqrtelGERVSKLTtelDSVTGLLNEAEGKNIKLSKD 1386
Cdd:NF033916   433 ETIQLLAGQteRHLQSMQAGADKMRLAAE--------RFDTA-------GSSVSEAN---ESTADVLGSVQSASAELSSA 494
                          250
                   ....*....|
gi 1593656259 1387 VSSLSSQLQD 1396
Cdd:NF033916   495 SRELTSIVAD 504
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
1026-1163 1.98e-03

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 43.08  E-value: 1.98e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1026 EQQLQLMEAhIAEEEDARQ------KLQMEKVSVEGKVKKlEEDILMMEDQNNKLQKERKLLEERLADMSSNL----AEE 1095
Cdd:NF038025    19 EEALDLLEN-MAKEKDEKQikkaadEVTAEKDDLLDELEN-EQEEEPETFTEQKEEEDKEDLEAILDELATEAnkasAEL 96
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1096 EEKSKNLSKLKTKHESMISELELRMKKEEKGRLDMEKAKRK--VEAELGDLQEQHADLQAQLAELRAQLA 1163
Cdd:NF038025    97 DEVNAEIQGVKEEIKEKQEQLMVLDTKEELDELSEEELAERqeLEAEIKQLEAQLDELEEEKEELEEELK 166
M_group_A_cterm NF033777
M protein C-terminal domain; M protein (emm) is an important virulence protein and ...
1026-1174 2.02e-03

M protein C-terminal domain; M protein (emm) is an important virulence protein and serology-defining surface antigen of Streptococcus pyogenes (group A Streptococcus). M protein has an amino-terminal YSIRK-type signal sequence (associated with cross-wall targeting in dividing cells), and a C-terminal LPXTG domain for processing by sortase and covalent attachment to the Gram-positive cell wall. Past the signal peptide, M protein has a hypervariable region, but this HMM describes only the well-conserved region C-terminal to the hypervariable region. It discriminates M protein from two related proteins, Enn and Mrp.


Pssm-ID: 411361 [Multi-domain]  Cd Length: 218  Bit Score: 41.74  E-value: 2.02e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1026 EQQLQLMEAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQKERKLLEERLADMSSNLAEEEEKSKNLSKL 1105
Cdd:NF033777     1 EAELQKLEEQNKISEASRKGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKA 80
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1593656259 1106 KTKHESMISELElRMKKEekgrldMEKAKRKVEAELGDLQeqhADLQAQLAELRAQLAAKEEELQATQA 1174
Cdd:NF033777    81 LEEANSKLAALE-KLNKE------LEESKKLTEKEKAELQ---AKLEAEAKALKEQLAKQAEELAKLRA 139
PspC_subgroup_1 NF033838
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ...
1221-1559 8.75e-03

pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.


Pssm-ID: 411407 [Multi-domain]  Cd Length: 684  Bit Score: 41.15  E-value: 8.75e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1221 LGEELNALRTELEDSLGTTAAQQELRAKREQEV-----SMLKKAMEDEGRSHEAQVQDLRQKHS----------QAVEEL 1285
Cdd:NF033838    31 LGGVVHAEEVRGGNNPTVTSSGNESQKEHAKEVeshleKILSEIQKSLDKRKHTQNVALNKKLSdikteylyelNVLKEK 110
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1286 TEQlEQAKRVRAGLEKAKQALEKESADLSadlRSLASAKQDVEHKKKKVEGQLNE--LNSRFNESERQRTELGE---RVS 1360
Cdd:NF033838   111 SEA-ELTSKTKKELDAAFEQFKKDTLEPG---KKVAEATKKVEEAEKKAKDQKEEdrRNYPTNTYKTLELEIAEsdvEVK 186
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1361 KLTTELDSVTGLLNEAEGKNIKLSKDVSSLSSQLQDAQELLSE----ETRQKLNLSGRLRQTEEDRNSLMEQLEEETEAK 1436
Cdd:NF033838   187 KAELELVKEEAKEPRDEEKIKQAKAKVESKKAEATRLEKIKTDrekaEEEAKRRADAKLKEAVEKNVATSEQDKPKRRAK 266
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1437 RAVERQVSSLNMQLSDSK-------------------KKLDEMSGTVEALEEGKKRLQRE--------------LEAANS 1483
Cdd:NF033838   267 RGVLGEPATPDKKENDAKssdssvgeetlpspslkpeKKVAEAEKKVEEAKKKAKDQKEEdrrnyptntyktleLEIAES 346
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1593656259 1484 DYEEKASAYD--KLEKSRGRMQQELEDVLMDLDSQRQLVSNLEKkqKKFDQMLAEERAVScKFAEERDRAEAEAREKE 1559
Cdd:NF033838   347 DVKVKEAELElvKEEAKEPRNEEKIKQAKAKVESKKAEATRLEK--IKTDRKKAEEEAKR-KAAEEDKVKEKPAEQPQ 421
 
Name Accession Description Interval E-value
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
925-2005 0e+00

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 1421.10  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  925 TRQEEEMGQKDEELKAAKEVAAKVETELKDITQKHTQLMEERAQLEMKLHAETELYAEAEEMRVRLEAKKQELEEVLHEM 1004
Cdd:pfam01576    1 TRQEEEMQAKEEELQKVKEKQQKAESELKELEKKHQQLIEEKNILAEQLQAETELFAEAEEMRARLAARKQELEEILHDL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1005 ESRLEEEEDRSNALHNERKEMEQQLQLMEAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQKERKLLEER 1084
Cdd:pfam01576   81 ESRLEEEEERSQQLQNEKKKMQQHIQDLEEQLEEEEAARQKLQLEKVTTEAKIKKLEEDILLLEDQNSKLSKERKLLEER 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1085 LADMSSNLAEEEEKSKNLSKLKTKHESMISELELRMKKEEKGRLDMEKAKRKVEAELGDLQEQHADLQAQLAELRAQLAA 1164
Cdd:pfam01576  161 ISEFTSNLAEEEEKVKSLNKLKNKHEAMISDLEDRLKKEEKGRQELEKAKRKLDGESTDLQEQIAELQAQIEELRAQLAK 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1165 KEEELQATQARLEEECNQRGAAVKRVRELEVLISELQEDLEAERAARGKVEAARRDLGEELNALRTELEDSLGTTAAQQE 1244
Cdd:pfam01576  241 KEEELQAALARLEEEGAQKNNALKKLRELQAQIAELQEDLESERAARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1245 LRAKREQEVSMLKKAMEDEGRSHEAQVQDLRQKHSQAVEELTEQLEQAKRVRAGLEKAKQALEKESADLSADLRSLASAK 1324
Cdd:pfam01576  321 LRSKREQEVTELKKALEEETRSHEAQLQEMRQKHTQALEELSEQLEQAKRNKANLEKAKQALESENNELQAELKTLQQAK 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1325 QDVEHKKKKVEGQLNELNSRFNESERQRTELGERVSKLTTELDSVTGLLNEAEGKNIKLSKDVSSLSSQLQDAQELLSEE 1404
Cdd:pfam01576  401 QDSEHKRKKLEGQLQELQARLSESERQRAELAEKLSKLQSELESVSGLLSEAEGKSIKLSKDVSSLESQLQDTQELLQEE 480
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1405 TRQKLNLSGRLRQTEEDRNSLMEQLEEETEAKRAVERQVSSLNMQLSDSKKKLDEMSGTVEALEEGKKRLQRELEAANSD 1484
Cdd:pfam01576  481 TRQKLNLSSRLRQLEDERNSLQEQLEEEEEAKRNVERQLSTLQAQLSEMKKKLEEDAGAVEALEEAKKRLQRELEALTQR 560
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1485 YEEKASAYDKLEKSRGRMQQELEDVLMDLDSQRQLVSNLEKKQKKFDQMLAEERAVSCKFAEERDRAEAEAREKETRVLA 1564
Cdd:pfam01576  561 LEEKAAAYDKLEKTKNRLQQELDDLLVDLDHQRQLVSNLEKKQKKFDQMLAEEKAISARYAEERDRAEAEAREKETRALS 640
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1565 LARALEENQGALEEAEKTMKGLRADMEDLISSKDDVGKSVHDLEKAKRGLEAIVDEMRTQMEELEDELQVAEDAKLRLDV 1644
Cdd:pfam01576  641 LSRALEEALEAKEELERQNKQLRAEMEDLVSSKDDVGKNVHELERSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV 720
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1645 NTQALRAQHERELHARDELGEEKRKQLLKQVRELEAELEEERKQRGQASGSKKKLEGELKDMEDQLEATSRGRDEAVKQL 1724
Cdd:pfam01576  721 NMQALKAQFERDLQARDEQGEEKRRQLVKQVRELEAELEDERKQRAQAVAAKKKLELDLKELEAQIDAANKGRDEAVKQL 800
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1725 RKIQGQVKDLQRDLEDSRAAQKEVLASARESERRSKAMEADIVQLHEMLAAVERARKQAEVERDELSEELASNSSGKSLM 1804
Cdd:pfam01576  801 KKLQAQMKELQRELEETRASRDEILAQSKESEKKLKSLEAELLQLQEDLAASERAKRQAQQERDELADEIANGASGKSAL 880
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1805 SDEKRRLDTKISQLEEELEEEQANVESLNDRLRKSQQLVEQLGAELAAERSTSQSREGSRQQLERQNRELKAKMQEMEGQ 1884
Cdd:pfam01576  881 LDEKRRLEARIAQLEEELEEEQSNTELLNDRYRKLTLQVEQLTTELSAERSFSQKSESARQQLERQNKELKAKLQEMEGT 960
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1885 GRSKLKASIAALEAKLREAEEQLEIESRERQANGKNLRQKEKKLKDLTIQMEDERKQAQQYKDQAEKGNVRVKQLKHQLE 1964
Cdd:pfam01576  961 VKSKYKSSIAALEAKIAQLEEQLEQESRERQAANKLVRRTEKKLKEVLLQVEDERRNADQYKDQAEKANSRMKQLKRQLE 1040
                         1050      1060      1070      1080
                   ....*....|....*....|....*....|....*....|.
gi 1593656259 1965 EAEEEAQRMAAARRKLQRELDEATEANDTLSRDMASLRSKL 2005
Cdd:pfam01576 1041 EAEEEASRANAARRKLQRELDDATESAESMNREVSTLRSKL 1081
MYSc_class_II cd01377
class II myosins, motor domain; Myosin motor domain in class II myosins. Class II myosins, ...
169-848 0e+00

class II myosins, motor domain; Myosin motor domain in class II myosins. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. Thus, myosin II has two heads. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


Pssm-ID: 276951  Cd Length: 662  Bit Score: 1308.60  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd01377      1 ASVLHNLRERYYSDLIYTYSGLFCVAVNPYKRLPIYTEEVIDKYKGKRREEMPPHIFAIADNAYRNMLQDRENQSILITG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKDATPQpqqagslaYGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLN 328
Cdd:cd01377     81 ESGAGKTENTKKVIQYLASVAASSKKKKESGKK--------KGTLEDQILQANPILEAFGNAKTVRNNNSSRFGKFIRIH 152
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  329 FDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVA-GHVEISGQEDDEMFIE 407
Cdd:cd01377    153 FGSTGKIAGADIETYLLEKSRVVRQAKGERNYHIFYQLLSGADPELKEKLLLTGDPSYYFFLSqGELTIDGVDDAEEFKL 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  408 TLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVV 487
Cdd:cd01377    233 TDEAFDILGFSEEEKMSIFKIVAAILHLGNIKFKQRRREEQAELDGTEEADKAAHLLGVNSSDLLKALLKPRIKVGREWV 312
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  488 QKAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKsKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFN 567
Cdd:cd01377    313 TKGQNKEQVVFSVGALAKALYERLFLWLVKRINKTLDT-KSKRQYFIGVLDIAGFEIFEFNSFEQLCINYTNEKLQQFFN 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  568 HTMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNnpPGILALLDEECWFPKATDVSFVEKLLNTHTGHVK-FSKPK 646
Cdd:cd01377    392 HHMFVLEQEEYKKEGIEWTFIDFGLDLQPTIDLIEKPN--MGILSILDEECVFPKATDKTFVEKLYSNHLGKSKnFKKPK 469
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  647 QHKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRvvgletitkMSESSAPPKSKKGM 726
Cdd:cd01377    470 PKKSEAHFILKHYAGDVEYNIDGWLEKNKDPLNENVVALLKKSSDPLVASLFKDYEE---------SGGGGGKKKKKGGS 540
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  727 FRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYE 806
Cdd:cd01377    541 FRTVSQLHKEQLNKLMTTLRSTHPHFVRCIIPNEEKKPGKIDAPLVLHQLRCNGVLEGIRICRKGFPNRIIFAEFKQRYS 620
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|..
gi 1593656259  807 ILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd01377    621 ILAPNAIPKGFDDGKAACEKILKALQLDPELYRIGNTKVFFK 662
MYSc_Myh10 cd14920
class II myosin heavy chain 10, motor domain; Myosin motor domain of non-muscle myosin heavy ...
169-848 0e+00

class II myosin heavy chain 10, motor domain; Myosin motor domain of non-muscle myosin heavy chain 10 (also called NMMHCB). Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


Pssm-ID: 276952  Cd Length: 673  Bit Score: 1177.87  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd14920      1 ASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKDATpqpqqagslAYGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLN 328
Cdd:cd14920     81 ESGAGKTENTKKVIQYLAHVASSHKGRKDHN---------IPGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRIN 151
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  329 FDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVAGHVEISGQEDDEMFIET 408
Cdd:cd14920    152 FDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQET 231
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  409 LEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVVQ 488
Cdd:cd14920    232 MEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQ 311
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  489 KAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKSKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFNH 568
Cdd:cd14920    312 KAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNH 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  569 TMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDVSFVEKLLNTHTGHVKFSKPKQH 648
Cdd:cd14920    392 TMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQL 471
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  649 KDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRVVGLETITKMSESS--APPKSKKGM 726
Cdd:cd14920    472 KDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAfgSAYKTKKGM 551
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  727 FRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYE 806
Cdd:cd14920    552 FRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYE 631
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|..
gi 1593656259  807 ILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd14920    632 ILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFR 673
MYSc_Myh11 cd14921
class II myosin heavy chain 11, motor domain; Myosin motor domain of smooth muscle myosin ...
169-848 0e+00

class II myosin heavy chain 11, motor domain; Myosin motor domain of smooth muscle myosin heavy chain 11 (also called SMMHC, SMHC). The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. It functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. The gene encoding a human ortholog of rat NUDE1 is transcribed from the reverse strand of this gene, and its 3' end overlaps with that of the latter. Inversion of the MYH11 locus is one of the most frequent chromosomal aberrations found in acute myeloid leukemia. Alternative splicing generates isoforms that are differentially expressed, with ratios changing during muscle cell maturation. Mutations in MYH11 have been described in individuals with thoracic aortic aneurysms leading to acute aortic dissections with patent ductus arteriosus. MYH11 mutations are also thought to contribute to human colorectal cancer and are also associated with Peutz-Jeghers syndrome. The mutations found in human intestinal neoplasia result in unregulated proteins with constitutive motor activity, similar to the mutant myh11 zebrafish. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


Pssm-ID: 276885  Cd Length: 673  Bit Score: 1162.09  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd14921      1 ASVLHNLRERYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKDATpqpqqagslAYGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLN 328
Cdd:cd14921     81 ESGAGKTENTKKVIQYLAVVASSHKGKKDTS---------ITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRIN 151
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  329 FDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVAGHVEISGQEDDEMFIET 408
Cdd:cd14921    152 FDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYLIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQET 231
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  409 LEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVVQ 488
Cdd:cd14921    232 LEAMSIMGFSEEEQLSILKVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQ 311
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  489 KAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKSKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFNH 568
Cdd:cd14921    312 KAQTKEQADFAIEALAKATYERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNH 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  569 TMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDVSFVEKLLNTHTGHVKFSKPKQH 648
Cdd:cd14921    392 TMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPKATDKSFVEKLCTEQGNHPKFQKPKQL 471
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  649 KDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRVVGLETITKMSESSAP--PKSKKGM 726
Cdd:cd14921    472 KDKTEFSIIHYAGKVDYNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPsaSKTKKGM 551
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  727 FRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYE 806
Cdd:cd14921    552 FRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYE 631
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|..
gi 1593656259  807 ILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd14921    632 ILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFR 673
MYSc_Myh18 cd14932
class II myosin heavy chain 18, motor domain; Myosin motor domain of muscle myosin heavy chain ...
169-848 0e+00

class II myosin heavy chain 18, motor domain; Myosin motor domain of muscle myosin heavy chain 18. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


Pssm-ID: 276895  Cd Length: 676  Bit Score: 1139.37  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd14932      1 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKYLPIYSEEIVNMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKDatpqpQQAGSLAYGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLN 328
Cdd:cd14932     81 ESGAGKTENTKKVIQYLAYVASSFKTKKD-----QSSIALSHGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRIN 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  329 FDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVAGHVEISGQEDDEMFIET 408
Cdd:cd14932    156 FDVNGYIVGANIETYLLEKSRAIRQAKDERAFHIFYYLLTGAGDKLRSELCLEDYSKYRFLSNGNVTIPGQQDKELFAET 235
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  409 LEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVVQ 488
Cdd:cd14932    236 MEAFRIMSIPEEEQTGLLKVVSAVLQLGNMSFKKERNSDQASMPDDTAAQKVCHLLGMNVTDFTRAILSPRIKVGRDYVQ 315
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  489 KAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKSKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFNH 568
Cdd:cd14932    316 KAQTQEQAEFAVEALAKASYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNH 395
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  569 TMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDVSFVEKLLNTHTGHVKFSKPKQH 648
Cdd:cd14932    396 TMFILEQEEYQREGIEWSFIDFGLDLQPCIELIEKPNGPPGILALLDEECWFPKATDKSFVEKVVQEQGNNPKFQKPKKL 475
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  649 KDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRVVGLETITKMSES-SAPPKSKKGMF 727
Cdd:cd14932    476 KDDADFCIIHYAGKVDYKANEWLMKNMDPLNENVATLLNQSTDKFVSELWKDVDRIVGLDKVAGMGESlHGAFKTRKGMF 555
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  728 RTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEI 807
Cdd:cd14932    556 RTVGQLYKEQLMNLMTTLRNTNPNFVRCIIPNHEKKAGKLAHHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEI 635
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|.
gi 1593656259  808 LAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd14932    636 LTPNAIPKGFMDGKQACVLMVKALELDPNLYRIGQSKVFFR 676
Myosin_head pfam00063
Myosin head (motor domain);
157-848 0e+00

Myosin head (motor domain);


Pssm-ID: 395017  Cd Length: 674  Bit Score: 1073.45  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  157 VEDMAALTFLNEASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMM 236
Cdd:pfam00063    1 VEDMVELSYLNEPSVLHNLKKRYKSDLIYTYSGLVLVAVNPYKQLPIYSEDMIKAYRGKRRGELPPHIFAIADEAYRSML 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  237 QDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKdatpqpqqagslaYGELEKQLLQANPILEAFGNAKTIKND 316
Cdd:pfam00063   81 QDKENQSILISGESGAGKTENTKKIMQYLASVSGSGSAGN-------------VGRLEEQILQSNPILEAFGNAKTVRNN 147
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  317 NSSRFGKFIKLNFDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVA-GHVE 395
Cdd:pfam00063  148 NSSRFGKYIEIQFDAKGDIVGGKIETYLLEKSRVVYQAEGERNYHIFYQLLAGASAQLKKELRLTNPKDYHYLSQsGCYT 227
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  396 ISGQEDDEMFIETLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAI 475
Cdd:pfam00063  228 IDGIDDSEEFKITDKAMDILGFSDEEQMGIFRIVAAILHLGNIEFKKERNDEQAVPDDTENLQKAASLLGIDSTELEKAL 307
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  476 LTPRIKVGREVVQKAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKSKRQSSSFLGILDIAGFEIFEDNSFEQLCI 555
Cdd:pfam00063  308 CKRRIKTGRETVSKPQNVEQANYARDALAKAIYSRLFDWLVDRINKSLDVKTIEKASFIGVLDIYGFEIFEKNSFEQLCI 387
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  556 NYTNERLQQLFNHTMFVLEQEEYKREGIQWSFIDFGlDLQPCIELIERPnnPPGILALLDEECWFPKATDVSFVEKLLNT 635
Cdd:pfam00063  388 NYVNEKLQQFFNHHMFKLEQEEYVREGIEWTFIDFG-DNQPCIDLIEKK--PLGILSLLDEECLFPKATDQTFLDKLYST 464
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  636 HTGHVKFSKPKQhKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRVVglETITKMSE 715
Cdd:pfam00063  465 FSKHPHFQKPRL-QGETHFIIKHYAGDVEYNVEGFLEKNKDPLNDDLVSLLKSSSDPLLAELFPDYETAE--SAAANESG 541
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  716 SSAPPKSKKGMFRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNR 795
Cdd:pfam00063  542 KSTPKRTKKKRFITVGSQFKESLGELMKTLNSTNPHYIRCIKPNEKKRAGVFDNSLVLHQLRCNGVLEGIRIRRAGFPNR 621
                          650       660       670       680       690
                   ....*....|....*....|....*....|....*....|....*....|...
gi 1593656259  796 IVFQEFRQRYEILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:pfam00063  622 ITFQEFVQRYRILAPKTWPKWKGDAKKGCEAILQSLNLDKEEYQFGKTKIFFR 674
MYSc_Myh2_insects_mollusks cd14911
class II myosin heavy chain 2, motor domain; Myosin motor domain of type IIa skeletal muscle ...
169-848 0e+00

class II myosin heavy chain 2, motor domain; Myosin motor domain of type IIa skeletal muscle myosin heavy chain 2 (also called MYH2A, MYHSA2, MyHC-IIa, MYHas8, MyHC-2A) in insects and mollusks. This gene encodes a member of the class II or conventional myosin heavy chains, and functions in skeletal muscle contraction. Mutations in this gene results in inclusion body myopathy-3 and familial congenital myopathy. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


Pssm-ID: 276876  Cd Length: 674  Bit Score: 1069.60  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd14911      1 ASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKDATPQPQQAGSLAYGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLN 328
Cdd:cd14911     81 ESGAGKTENTKKVIQFLAYVAASKPKGSGAVPHPAVNPAVLIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRIN 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  329 FDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVAGHVEISGQEDDEMFIET 408
Cdd:cd14911    161 FDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQAT 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  409 LEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVVQ 488
Cdd:cd14911    241 VKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVT 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  489 KAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKSKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFNH 568
Cdd:cd14911    321 KAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNH 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  569 TMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNnppGILALLDEECWFPKATDVSFVEKLLNTHTGHVKFSKpKQH 648
Cdd:cd14911    401 TMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPG---GIMALLDEECWFPKATDKTFVDKLVSAHSMHPKFMK-TDF 476
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  649 KDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADrVVGLETITkMSESSAPPKSKKGMFR 728
Cdd:cd14911    477 RGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKDAE-IVGMAQQA-LTDTQFGARTRKGMFR 554
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  729 TVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEIL 808
Cdd:cd14911    555 TVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELL 634
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|
gi 1593656259  809 AANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd14911    635 TPNVIPKGFMDGKKACEKMIQALELDSNLYRVGQSKIFFR 674
MYSc_Myh19 cd15896
class II myosin heavy chain19, motor domain; Myosin motor domain of muscle myosin heavy chain ...
169-848 0e+00

class II myosin heavy chain19, motor domain; Myosin motor domain of muscle myosin heavy chain 19. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


Pssm-ID: 276899  Cd Length: 675  Bit Score: 1068.92  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd15896      1 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKDatpqpQQAGSLAYGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLN 328
Cdd:cd15896     81 ESGAGKTENTKKVIQYLAHVASSHKTKKD-----QNSLALSHGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRIN 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  329 FDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVAGHVEISGQEDDEMFIET 408
Cdd:cd15896    156 FDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLTGAGDKLRSELLLENYNNYRFLSNGNVTIPGQQDKDLFTET 235
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  409 LEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVVQ 488
Cdd:cd15896    236 MEAFRIMGIPEDEQIGMLKVVASVLQLGNMSFKKERHTDQASMPDNTAAQKVCHLMGMNVTDFTRAILSPRIKVGRDYVQ 315
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  489 KAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKSKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFNH 568
Cdd:cd15896    316 KAQTQEQAEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNH 395
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  569 TMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDVSFVEKLLNTHTGHVKFSKPKQH 648
Cdd:cd15896    396 TMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIEKPASPPGILALLDEECWFPKATDKSFVEKVLQEQGTHPKFFKPKKL 475
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  649 KDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRVVGLETITKMSESSAPPKSKKGMFR 728
Cdd:cd15896    476 KDEADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLNQSTDKFVSELWKDVDRIVGLDKVSGMSEMPGAFKTRKGMFR 555
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  729 TVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEIL 808
Cdd:cd15896    556 TVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEIL 635
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|
gi 1593656259  809 AANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd15896    636 TPNAIPKGFMDGKQACVLMIKSLELDPNLYRIGQSKVFFR 675
MYSc_Myh9 cd14919
class II myosin heavy chain 9, motor domain; Myosin motor domain of non-muscle myosin heavy ...
169-848 0e+00

class II myosin heavy chain 9, motor domain; Myosin motor domain of non-muscle myosin heavy chain 9 (also called NMMHCA, NMHC-II-A, MHA, FTNS, EPSTS, and DFNA17). Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


Pssm-ID: 276883  Cd Length: 670  Bit Score: 1060.85  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd14919      1 ASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKDAtpqpqqagslayGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLN 328
Cdd:cd14919     81 ESGAGKTENTKKVIQYLAHVASSHKSKKDQ------------GELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRIN 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  329 FDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVAGHVEISGQEDDEMFIET 408
Cdd:cd14919    149 FDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQET 228
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  409 LEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVVQ 488
Cdd:cd14919    229 MEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQ 308
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  489 KAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKSKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFNH 568
Cdd:cd14919    309 KAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNH 388
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  569 TMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDVSFVEKLLNTHTGHVKFSKPKQH 648
Cdd:cd14919    389 TMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGTHPKFQKPKQL 468
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  649 KDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRVVGLETITKMSESSAPP--KSKKGM 726
Cdd:cd14919    469 KDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGafKTRKGM 548
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  727 FRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYE 806
Cdd:cd14919    549 FRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYE 628
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|..
gi 1593656259  807 ILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd14919    629 ILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFR 670
MYSc_Myh14_mammals cd14930
class II myosin heavy chain 14 motor domain; Myosin motor domain of non-muscle myosin heavy ...
169-848 0e+00

class II myosin heavy chain 14 motor domain; Myosin motor domain of non-muscle myosin heavy chain 14 (also called FLJ13881, KIAA2034, MHC16, MYH17). Its members include mammals, chickens, and turtles. Class II myosins, also called conventional myosins, are the myosin type responsible for producing actomyosin contraction in metazoan muscle and non-muscle cells. Myosin II contains two heavy chains made up of the head (N-terminal) and tail (C-terminal) domains with a coiled-coil morphology that holds the two heavy chains together. The intermediate neck domain is the region creating the angle between the head and tail. It also contains 4 light chains which bind the heavy chains in the "neck" region between the head and tail. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. Class-II myosins are regulated by phosphorylation of the myosin light chain or by binding of Ca2+. A cyclical interaction between myosin and actin provides the driving force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Some of the data used for this classification were produced by the CyMoBase team at the Max-Planck-Institute for Biophysical Chemistry. The sequence names are composed of the species abbreviation followed by the protein abbreviation and optional protein classifier and variant designations.


Pssm-ID: 276893  Cd Length: 670  Bit Score: 1003.46  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTG 248
Cdd:cd14930      1 ASVLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  249 ESGAGKTENTKKVIQYLAVVASSHKGKKD-ATPqpqqagslayGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKL 327
Cdd:cd14930     81 ESGAGKTENTKKVIQYLAHVASSPKGRKEpGVP----------GELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRI 150
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  328 NFDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVAGHVEISGQEDdEMFIE 407
Cdd:cd14930    151 NFDVAGYIVGANIETYLLEKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQER-ELFQE 229
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  408 TLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVV 487
Cdd:cd14930    230 TLESLRVLGFSHEEITSMLRMVSAVLQFGNIVLKRERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALLTPRIKVGRDYV 309
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  488 QKAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKSKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFN 567
Cdd:cd14930    310 QKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFN 389
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  568 HTMFVLEQEEYKREGIQWSFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDVSFVEKLLNTHTGHVKFSKPKQ 647
Cdd:cd14930    390 HTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRH 469
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  648 HKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRVVGLETITKMSESSAPPKSKKGMF 727
Cdd:cd14930    470 LRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMF 549
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  728 RTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEI 807
Cdd:cd14930    550 RTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEI 629
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|.
gi 1593656259  808 LAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFR 848
Cdd:cd14930    630 LTPNAIPKGFMDGKQACEKMIQALELDPNLYRVGQSKIFFR 670
MYSc smart00242
Myosin. Large ATPases; ATPase; molecular motor. Muscle contraction consists of a cyclical ...
150-860 0e+00

Myosin. Large ATPases; ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.


Pssm-ID: 214580  Cd Length: 677  Bit Score: 990.51  E-value: 0e+00
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   150 NPPKFSKVEDMAALTFLNEASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITD 229
Cdd:smart00242    1 NPPKFEGVEDLVLLTYLNEPAVLHNLKKRYLKDLIYTYIGLVLVAVNPYKQLPIYTDEVIKKYRGKSRGELPPHVFAIAD 80
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   230 NAYRNMMQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKkdatpqpqqagslayGELEKQLLQANPILEAFGN 309
Cdd:smart00242   81 NAYRNMLNDKENQSIIISGESGAGKTENTKKIMQYLASVSGSNTEV---------------GSVEDQILESNPILEAFGN 145
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   310 AKTIKNDNSSRFGKFIKLNFDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFL 389
Cdd:smart00242  146 AKTLRNNNSSRFGKFIEIHFDAKGKIIGAKIETYLLEKSRVVSQAKGERNYHIFYQLLAGASEELKKELGLKSPEDYRYL 225
                           250       260       270       280       290       300       310       320
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   390 -VAGHVEISGQEDDEMFIETLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSEQATMPDDT-AAQKVCHLQGIN 467
Cdd:smart00242  226 nQGGCLTVDGIDDAEEFKETLNAMRVLGFSEEEQESIFKILAAILHLGNIEFEEGRNDNAASTVKDKeELSNAAELLGVD 305
                           330       340       350       360       370       380       390       400
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   468 ITDFIRAILTPRIKVGREVVQKAQTKQQADFAVEALAKAMYERLFRWILARVNKTLDKsKRQSSSFLGILDIAGFEIFED 547
Cdd:smart00242  306 PEELEKALTKRKIKTGGEVITKPLNVEQALDARDALAKALYSRLFDWLVKRINQSLSF-KDGSTYFIGVLDIYGFEIFEV 384
                           410       420       430       440       450       460       470       480
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   548 NSFEQLCINYTNERLQQLFNHTMFVLEQEEYKREGIQWSFIDFGlDLQPCIELIErpNNPPGILALLDEECWFPKATDVS 627
Cdd:smart00242  385 NSFEQLCINYANEKLQQFFNQHVFKLEQEEYEREGIDWTFIDFF-DNQDCIDLIE--KKPPGILSLLDEECRFPKGTDQT 461
                           490       500       510       520       530       540       550       560
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   628 FVEKLLNTHTGHVKFSKPKQhKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWkdadrvvgl 707
Cdd:smart00242  462 FLEKLNQHHKKHPHFSKPKK-KGRTEFIIKHYAGDVTYDVTGFLEKNKDTLSDDLIELLQSSKNPLIASLF--------- 531
                           570       580       590       600       610       620       630       640
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259   708 etitkmsESSAPPKSKKGMFRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRI 787
Cdd:smart00242  532 -------PSGVSNAGSKKRFQTVGSQFKEQLNELMDTLNSTNPHFIRCIKPNEEKKPGDFDSSLVLHQLRYLGVLENIRI 604
                           650       660       670       680       690       700       710
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1593656259   788 CRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFRTGVLAQLEEERD 860
Cdd:smart00242  605 RRAGFPYRLPFDEFLQRYRVLLPDTWPPWGGDAKKACEALLQSLGLDEDEYQLGKTKVFLRPGQLAELEELRE 677
COG5022 COG5022
Myosin heavy chain [General function prediction only];
107-1702 0e+00

Myosin heavy chain [General function prediction only];


Pssm-ID: 227355 [Multi-domain]  Cd Length: 1463  Bit Score: 888.66  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  107 VWIPSEKEGFEAASIKEE---KGD-EVLVELSNGQKMTVNKDDIQ--KMNPPKFSKVEDMAALTFLNEASVLQNLRERYF 180
Cdd:COG5022     12 CWIPDEEKGWIWAEIIKEafnKGKvTEEGKKEDGESVSVKKKVLGndRIKLPKFDGVDDLTELSYLNEPAVLHNLEKRYN 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  181 SSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTGESGAGKTENTKK 260
Cdd:COG5022     92 NGQIYTYSGLVLIAVNPYRDLGIYTDDIIQSYSGKNRLELEPHVFAIAEEAYRNLLSEKENQTIIISGESGAGKTENAKR 171
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  261 VIQYLAVVASSHkgkkdaTPQPQQagslaygeLEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKLNFDVTGYIVGANI 340
Cdd:COG5022    172 IMQYLASVTSSS------TVEISS--------IEKQILATNPILEAFGNAKTVRNDNSSRFGKYIKIEFDENGEICGAKI 237
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  341 DTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLVAGHV-EISGQEDDEMFIETLEAMEIMGFTE 419
Cdd:COG5022    238 ETYLLEKSRVVHQNKNERNYHIFYQLLAGDPEELKKLLLLQNPKDYIYLSQGGCdKIDGIDDAKEFKITLDALKTIGIDE 317
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  420 EERMGMMKVVSTVLQLGNIKFEKERNsEQATMPDDTAAQKVCHLQGINITDFIRAILTPRIKVGREVVQKAQTKQQADFA 499
Cdd:COG5022    318 EEQDQIFKILAAILHIGNIEFKEDRN-GAAIFSDNSVLDKACYLLGIDPSLFVKWLVKRQIKTGGEWIVVPLNLEQALAI 396
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  500 VEALAKAMYERLFRWILARVNKTLDKSKRQsSSFLGILDIAGFEIFEDNSFEQLCINYTNERLQQLFNHTMFVLEQEEYK 579
Cdd:COG5022    397 RDSLAKALYSNLFDWIVDRINKSLDHSAAA-SNFIGVLDIYGFEIFEKNSFEQLCINYTNEKLQQFFNQHMFKLEQEEYV 475
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  580 REGIQWSFIDFgLDLQPCIELIERpNNPPGILALLDEECWFPKATDVSFVEKL---LNTHTGHvKFSKPKQHKDKlmFTV 656
Cdd:COG5022    476 KEGIEWSFIDY-FDNQPCIDLIEK-KNPLGILSLLDEECVMPHATDESFTSKLaqrLNKNSNP-KFKKSRFRDNK--FVV 550
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  657 LHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSNFIQDLWKDADRvvgletitkmsessappKSKKGMFRTVGQLYKE 736
Cdd:COG5022    551 KHYAGDVEYDVEGFLDKNKDPLNDDLLELLKASTNEFVSTLFDDEEN-----------------IESKGRFPTLGSRFKE 613
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  737 SLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANA---- 812
Cdd:COG5022    614 SLNSLMSTLNSTQPHYIRCIKPNEEKSPWTFDNQMVLSQLRCCGVLETIRISRAGFPSRWTFDEFVQRYRILSPSKswtg 693
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  813 IPKGFMDGKQACCLMVKHLDLDPNLYRIGQSKMFFRTGVLAQLEEERDLKLTVVIIAFQAQARGFLARKAFSKRQQQLTA 892
Cdd:COG5022    694 EYTWKEDTKNAVKSILEELVIDSSKYQIGNTKVFFKAGVLAALEDMRDAKLDNIATRIQRAIRGRYLRRRYLQALKRIKK 773
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  893 MKVIQRNCACYLKLKNWQWWRLFTKVKPLLQVTRQEEEMGQKDEELKaakevaaKVETELKDITQKHTQLMEERAQLEMK 972
Cdd:COG5022    774 IQVIQHGFRLRRLVDYELKWRLFIKLQPLLSLLGSRKEYRSYLACII-------KLQKTIKREKKLRETEEVEFSLKAEV 846
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  973 LHAETELYAEAEEmRVRLEAKKQELEEVLhemesrleeeedrsnalhnerkemeqqlqlmeahiAEEEDARQKLQMEKVS 1052
Cdd:COG5022    847 LIQKFGRSLKAKK-RFSLLKKETIYLQSA-----------------------------------QRVELAERQLQELKID 890
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1053 VEgKVKKLEEdilmmedQNNKLQKErkLLEERLADMSSNLAEEEEKSKNLSKLK-TKHESMISELELRM--KKEEKGRLD 1129
Cdd:COG5022    891 VK-SISSLKL-------VNLELESE--IIELKKSLSSDLIENLEFKTELIARLKkLLNNIDLEEGPSIEyvKLPELNKLH 960
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1130 MEKAKrkveaeLGDLQEQHADLQAQLAELRAQLAAKEEELQATQARLEEECNQRGAAVKRVRELEVLISELQEDLEAERa 1209
Cdd:COG5022    961 EVESK------LKETSEEYEDLLKKSTILVREGNKANSELKNFKKELAELSKQYGALQESTKQLKELPVEVAELQSASK- 1033
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1210 argkveaarrdlgeELNALRTELedslgttaaqqelraKREQEVSMLKKAMEDEGRSHEAQVQDLRQKHSQAVEELTeQL 1289
Cdd:COG5022   1034 --------------IISSESTEL---------------SILKPLQKLKGLLLLENNQLQARYKALKLRRENSLLDDK-QL 1083
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1290 EQAKRVRaGLEKAKQALEKESADLSADLRSLASAKQDVEHKKKKVEGQLNELNSRFNESERQRTelgERVSKLTTELDSV 1369
Cdd:COG5022   1084 YQLESTE-NLLKTINVKDLEVTNRNLVKPANVLQFIVAQMIKLNLLQEISKFLSQLVNTLEPVF---QKLSVLQLELDGL 1159
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1370 TGLLNEAEgkniKLSKDVSSLSSqlqdaQELLSEETRQKLNLSGRLrqteedrnSLMEQLEEETEAKRAVERQVSSLNMQ 1449
Cdd:COG5022   1160 FWEANLEA----LPSPPPFAALS-----EKRLYQSALYDEKSKLSS--------SEVNDLKNELIALFSKIFSGWPRGDK 1222
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1450 LSDSKKKLDEMSGTVEALEEGKKRLQRELEAANSDYEEKASAYDKLEKSrgRMQQELEDVLMDLdSQRQLVSNLekKQKK 1529
Cdd:COG5022   1223 LKKLISEGWVPTEYSTSLKGFNNLNKKFDTPASMSNEKLLSLLNSIDNL--LSSYKLEEEVLPA-TINSLLQYI--NVGL 1297
                         1450      1460      1470      1480      1490      1500      1510      1520
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1530 FDQMLAEERAVSCKFAEE--RDRAEAEAREKETRVLALARALEEnqgaLEEAEKTMKGLRADMEDLiSSKDDVGKSVHDL 1607
Cdd:COG5022   1298 FNALRTKASSLRWKSATEvnYNSEELDDWCREFEISDVDEELEE----LIQAVKVLQLLKDDLNKL-DELLDACYSLNPA 1372
                         1530      1540      1550      1560      1570      1580      1590      1600
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259 1608 EKAKRGLEaivDEMRTQMEELEDELQVAEDAKLRLDVNTQALRAQHERELHARDELGEEKRKQLLKqvreLEAELEEERK 1687
Cdd:COG5022   1373 EIQNLKSR---YDPADKENNLPKEILKKIEALLIKQELQLSLEGKDETEVHLSEIFSEEKSLISLD----RNSIYKEEVL 1445
                         1610
                   ....*....|....*
gi 1593656259 1688 QRGQASGSKKKLEGE 1702
Cdd:COG5022   1446 SSLSALLTKEKIALL 1460
MYSc cd00124
Myosin motor domain superfamily; Myosin motor domain. The catalytic (head) domain has ATPase ...
169-848 0e+00

Myosin motor domain superfamily; Myosin motor domain. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.


Pssm-ID: 276950  Cd Length: 633  Bit Score: 885.39  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  169 ASVLQNLRERYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRH-EVPPHIYSITDNAYRNMMQDREDQSILCT 247
Cdd:cd00124      1 AAILHNLRERYARDLIYTYVGDILVAVNPFKWLPLYSEEVMEKYRGKGRSaDLPPHVFAVADAAYRAMLRDGQNQSILIS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  248 GESGAGKTENTKKVIQYLAVVASSHKGKKDATpqpqqagslaYGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKL 327
Cdd:cd00124     81 GESGAGKTETTKLVLKYLAALSGSGSSKSSSS----------ASSIEQQILQSNPILEAFGNAKTVRNDNSSRFGKFIEL 150
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  328 NFDVTGYIVGANIDTYLLEKSRCIRQSMTERAFHIFYYMVAGAKDKLREELLLEDFSCYRFLV-----AGHVEISGQEDD 402
Cdd:cd00124    151 QFDPTGRLVGASIETYLLEKSRVVSQAPGERNFHIFYQLLAGLSDGAREELKLELLLSYYYLNdylnsSGCDRIDGVDDA 230
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  403 EMFIETLEAMEIMGFTEEERMGMMKVVSTVLQLGNIKFEKERNSE--QATMPDDTAAQKVCHLQGINITDFIRAILTPRI 480
Cdd:cd00124    231 EEFQELLDALDVLGFSDEEQDSIFRILAAILHLGNIEFEEDEEDEdsSAEVADDESLKAAAKLLGVDAEDLEEALTTRTI 310
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  481 KVGREVVQKAQTKQQADFAVEALAKAMYERLFRWILARVNKTLD-KSKRQSSSFLGILDIAGFEIFEDNSFEQLCINYTN 559
Cdd:cd00124    311 KVGGETITKPLTVEQAEDARDALAKALYSRLFDWLVNRINAALSpTDAAESTSFIGILDIFGFENFEVNSFEQLCINYAN 390
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  560 ERLQQLFNHTMFVLEQEEYKREGIQWSFIDFgLDLQPCIELIERPnnPPGILALLDEECWFPKATDVSFVEKLLNTHTGH 639
Cdd:cd00124    391 EKLQQFFNQHVFKLEQEEYEEEGIDWSFIDF-PDNQDCLDLIEGK--PLGILSLLDEECLFPKGTDATFLEKLYSAHGSH 467
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  640 VKFSKPKQhKDKLMFTVLHYAGKVDYNAANWLTKNMDPLNDNVTALLNNSSSnfiqdlwkdadrvvgletitkmsessap 719
Cdd:cd00124    468 PRFFSKKR-KAKLEFGIKHYAGDVTYDADGFLEKNKDTLPPDLVDLLRSGSQ---------------------------- 518
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1593656259  720 pkskkgmfrtvgqlYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKMDSNLVLEQLRCNGVLEGIRICR