NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|389632543|ref|XP_003713924|]
View 

fructose-1,6-bisphosphatase [Pyricularia oryzae 70-15]

Protein Classification

fructose-1,6-bisphosphatase (domain architecture ID 10086071)

class 1 fructose-1,6-bisphosphatase I catalyzes the conversion of D-fructose 1,6-bisphosphate to D-fructose 6-phosphate in gluconeogenesis and the Calvin cycle, which are both anabolic pathways

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FBPase cd00354
Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1, ...
26-343 4.26e-164

Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway. The alignment model also includes chloroplastic FBPases and sedoheptulose-1,7-biphosphatases that play a role in pentose phosphate pathway (Calvin cycle).


:

Pssm-ID: 238214  Cd Length: 315  Bit Score: 460.10  E-value: 4.26e-164
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  26 EEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSSGKCALLVSE 105
Cdd:cd00354    2 LEQLRKGAATGDLTDLLSSLALACKEISRAVRRAGLAGLLGLAGSVNVQGDEQKKLDVLANDIFIEALKSSGVVAVLASE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 106 EEEEIIFfTNGNGSARYAVACDPIDGSSNLDAGVSVGTIFGIHKLAEGSTGSKEDILKPGSELLAAGFTMYGASAQLVLT 185
Cdd:cd00354   82 EEEEPVP-VEESKDGKYLVAFDPLDGSSNIDANVSVGTIFSIYPGPSGADATEKDFLQPGRNQVAAGYALYGPSTMLVLT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 186 MKNGgVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEGNSLYWEDHVKEYFSSLKHPqEKSGKPYSARYIGSMVADAYR 265
Cdd:cd00354  161 LGQG-VHGFTLDPSLGEFILTHPNVKIPKKGKIYSINEGNYRYWDEPVKKYIDDCKAG-EDGGKPYNLRYIGSMVADVHR 238
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 389632543 266 TLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGGQAIDSNmKRMLDVVPEHIHDRSGIFMGSWDEVEKVKAYH 343
Cdd:cd00354  239 ILVRGGIFLYPADKKSPKGKLRLLYEANPMAFLVEQAGGKATDGK-ERILDIVPTSLHQRVPVILGSKEEVERVEEYL 315
 
Name Accession Description Interval E-value
FBPase cd00354
Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1, ...
26-343 4.26e-164

Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway. The alignment model also includes chloroplastic FBPases and sedoheptulose-1,7-biphosphatases that play a role in pentose phosphate pathway (Calvin cycle).


Pssm-ID: 238214  Cd Length: 315  Bit Score: 460.10  E-value: 4.26e-164
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  26 EEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSSGKCALLVSE 105
Cdd:cd00354    2 LEQLRKGAATGDLTDLLSSLALACKEISRAVRRAGLAGLLGLAGSVNVQGDEQKKLDVLANDIFIEALKSSGVVAVLASE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 106 EEEEIIFfTNGNGSARYAVACDPIDGSSNLDAGVSVGTIFGIHKLAEGSTGSKEDILKPGSELLAAGFTMYGASAQLVLT 185
Cdd:cd00354   82 EEEEPVP-VEESKDGKYLVAFDPLDGSSNIDANVSVGTIFSIYPGPSGADATEKDFLQPGRNQVAAGYALYGPSTMLVLT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 186 MKNGgVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEGNSLYWEDHVKEYFSSLKHPqEKSGKPYSARYIGSMVADAYR 265
Cdd:cd00354  161 LGQG-VHGFTLDPSLGEFILTHPNVKIPKKGKIYSINEGNYRYWDEPVKKYIDDCKAG-EDGGKPYNLRYIGSMVADVHR 238
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 389632543 266 TLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGGQAIDSNmKRMLDVVPEHIHDRSGIFMGSWDEVEKVKAYH 343
Cdd:cd00354  239 ILVRGGIFLYPADKKSPKGKLRLLYEANPMAFLVEQAGGKATDGK-ERILDIVPTSLHQRVPVILGSKEEVERVEEYL 315
PLN02262 PLN02262
fructose-1,6-bisphosphatase
15-344 9.33e-147

fructose-1,6-bisphosphatase


Pssm-ID: 215147  Cd Length: 340  Bit Score: 417.29  E-value: 9.33e-147
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  15 TNIVTLTRFLTEEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMR 94
Cdd:PLN02262  10 TDLMTITRFVLNEQSKHPEARGDLTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNVQGEEQKKLDVLSNDVFIKALV 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  95 SSGKCALLVSEEEEEIIFFTNGNgSARYAVACDPIDGSSNLDAGVSVGTIFGIHKLAEGSTGSKEDILKPGSELLAAGFT 174
Cdd:PLN02262  90 SSGRTNVLVSEEDEEAIFVEPSK-RGRYCVVFDPLDGSSNIDCGVSIGTIFGIYMLKDGGEGTVEDVLQPGKEMVAAGYC 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 175 MYGASAQLVLTMkNGGVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEGNSLYWEDHVKEYFSSLKHPQEKSgKPYSAR 254
Cdd:PLN02262 169 MYGSSCTLVLST-GGGVNGFTLDPSLGEFILTHPDIKIPKKGKIYSVNEGNAKNWDGPTAKYVEKCKFPKDGS-SPKSLR 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 255 YIGSMVADAYRTLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGGQAIDSNmKRMLDVVPEHIHDRSGIFMGSWD 334
Cdd:PLN02262 247 YIGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMSFLVEQAGGQAFTGK-QRALDLVPTKIHERSPIFLGSYD 325
                        330
                 ....*....|
gi 389632543 335 EVEKVKAYHK 344
Cdd:PLN02262 326 DVEEIKALYA 335
Fbp COG0158
Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism];
17-344 1.68e-141

Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism];


Pssm-ID: 223236  Cd Length: 326  Bit Score: 403.62  E-value: 1.68e-141
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  17 IVTLTRFLTEEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSS 96
Cdd:COG0158    1 MKTLGRFLVEKQKEFKAATAELSAVLSSIALAGKEIAREINKAGLAGVLGYSGAENVQGDTQKKLDVFANEILIEALKAR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  97 GKCALLVSEEEEEIIffTNGNGSARYAVACDPIDGSSNLDAGVSVGTIFGIHKlAEGSTGSKEDILKPGSELLAAGFTMY 176
Cdd:COG0158   81 GNVAGIASEEEDEPV--TFPENNGSYAVAYDPLDGSSNIDVNVSVGTIFSIYR-RPGSPGTEEDFLQPGNKQVAAGYVVY 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 177 GASAQLVLTMKNGgVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEGNSLYWEDHVKEYFSSLKHPQEKSGKPYSARYI 256
Cdd:COG0158  158 GPSTMLVYTLGEG-VHGFTLDPSLGEFILTHENIRIPEKGKIYAINEGNQRHWEEGVKKYIKDCFAEDKGTRRPYNMRYI 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 257 GSMVADAYRTLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGGQAIDSNmKRMLDVVPEHIHDRSGIFMGSWDEV 336
Cdd:COG0158  237 GSMVADVHRILLKGGIFLYPSDKRAPNGKLRLLYEANPMAFLVEQAGGKATDGK-QRILDIVPEKLHQRVPLFLGSKEEV 315

                 ....*...
gi 389632543 337 EKVKAYHK 344
Cdd:COG0158  316 EKLERFIK 323
FBPase pfam00316
Fructose-1-6-bisphosphatase, N-terminal domain; This family represents the N-terminus of this ...
19-208 1.67e-79

Fructose-1-6-bisphosphatase, N-terminal domain; This family represents the N-terminus of this protein family.


Pssm-ID: 395249  Cd Length: 189  Bit Score: 240.77  E-value: 1.67e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543   19 TLTRFLTEEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSSGK 98
Cdd:pfam00316   2 TLTRFIIEEQHEFPNATGELTGLLSALQLAAKFISRDIRKAGLANLLGLAGAENVQGDVQKKLDVLADEILKNALKASGI 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543   99 CALLVSEEEEEIIFFtNGNGSARYAVACDPIDGSSNLDAGVSVGTIFGIHKLAEGSTGSKEDILKPGSELLAAGFTMYGA 178
Cdd:pfam00316  82 VAVLVSEEEEELIVF-EGNKRGKYVVAFDPLDGSSNIDTNVSVGTIFSIYRRVSTDSPTTIDFLQPGNEQVAAGYVVYGS 160
                         170       180       190
                  ....*....|....*....|....*....|
gi 389632543  179 SAQLVLTMKnGGVNGFTLDNAFGEFILTHP 208
Cdd:pfam00316 161 STMLVLTTG-CGVHGFTLDPSLGEFILTHE 189
 
Name Accession Description Interval E-value
FBPase cd00354
Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1, ...
26-343 4.26e-164

Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway. The alignment model also includes chloroplastic FBPases and sedoheptulose-1,7-biphosphatases that play a role in pentose phosphate pathway (Calvin cycle).


Pssm-ID: 238214  Cd Length: 315  Bit Score: 460.10  E-value: 4.26e-164
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  26 EEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSSGKCALLVSE 105
Cdd:cd00354    2 LEQLRKGAATGDLTDLLSSLALACKEISRAVRRAGLAGLLGLAGSVNVQGDEQKKLDVLANDIFIEALKSSGVVAVLASE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 106 EEEEIIFfTNGNGSARYAVACDPIDGSSNLDAGVSVGTIFGIHKLAEGSTGSKEDILKPGSELLAAGFTMYGASAQLVLT 185
Cdd:cd00354   82 EEEEPVP-VEESKDGKYLVAFDPLDGSSNIDANVSVGTIFSIYPGPSGADATEKDFLQPGRNQVAAGYALYGPSTMLVLT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 186 MKNGgVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEGNSLYWEDHVKEYFSSLKHPqEKSGKPYSARYIGSMVADAYR 265
Cdd:cd00354  161 LGQG-VHGFTLDPSLGEFILTHPNVKIPKKGKIYSINEGNYRYWDEPVKKYIDDCKAG-EDGGKPYNLRYIGSMVADVHR 238
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 389632543 266 TLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGGQAIDSNmKRMLDVVPEHIHDRSGIFMGSWDEVEKVKAYH 343
Cdd:cd00354  239 ILVRGGIFLYPADKKSPKGKLRLLYEANPMAFLVEQAGGKATDGK-ERILDIVPTSLHQRVPVILGSKEEVERVEEYL 315
PLN02262 PLN02262
fructose-1,6-bisphosphatase
15-344 9.33e-147

fructose-1,6-bisphosphatase


Pssm-ID: 215147  Cd Length: 340  Bit Score: 417.29  E-value: 9.33e-147
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  15 TNIVTLTRFLTEEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMR 94
Cdd:PLN02262  10 TDLMTITRFVLNEQSKHPEARGDLTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNVQGEEQKKLDVLSNDVFIKALV 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  95 SSGKCALLVSEEEEEIIFFTNGNgSARYAVACDPIDGSSNLDAGVSVGTIFGIHKLAEGSTGSKEDILKPGSELLAAGFT 174
Cdd:PLN02262  90 SSGRTNVLVSEEDEEAIFVEPSK-RGRYCVVFDPLDGSSNIDCGVSIGTIFGIYMLKDGGEGTVEDVLQPGKEMVAAGYC 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 175 MYGASAQLVLTMkNGGVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEGNSLYWEDHVKEYFSSLKHPQEKSgKPYSAR 254
Cdd:PLN02262 169 MYGSSCTLVLST-GGGVNGFTLDPSLGEFILTHPDIKIPKKGKIYSVNEGNAKNWDGPTAKYVEKCKFPKDGS-SPKSLR 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 255 YIGSMVADAYRTLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGGQAIDSNmKRMLDVVPEHIHDRSGIFMGSWD 334
Cdd:PLN02262 247 YIGSMVADVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMSFLVEQAGGQAFTGK-QRALDLVPTKIHERSPIFLGSYD 325
                        330
                 ....*....|
gi 389632543 335 EVEKVKAYHK 344
Cdd:PLN02262 326 DVEEIKALYA 335
Fbp COG0158
Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism];
17-344 1.68e-141

Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism];


Pssm-ID: 223236  Cd Length: 326  Bit Score: 403.62  E-value: 1.68e-141
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  17 IVTLTRFLTEEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSS 96
Cdd:COG0158    1 MKTLGRFLVEKQKEFKAATAELSAVLSSIALAGKEIAREINKAGLAGVLGYSGAENVQGDTQKKLDVFANEILIEALKAR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  97 GKCALLVSEEEEEIIffTNGNGSARYAVACDPIDGSSNLDAGVSVGTIFGIHKlAEGSTGSKEDILKPGSELLAAGFTMY 176
Cdd:COG0158   81 GNVAGIASEEEDEPV--TFPENNGSYAVAYDPLDGSSNIDVNVSVGTIFSIYR-RPGSPGTEEDFLQPGNKQVAAGYVVY 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 177 GASAQLVLTMKNGgVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEGNSLYWEDHVKEYFSSLKHPQEKSGKPYSARYI 256
Cdd:COG0158  158 GPSTMLVYTLGEG-VHGFTLDPSLGEFILTHENIRIPEKGKIYAINEGNQRHWEEGVKKYIKDCFAEDKGTRRPYNMRYI 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 257 GSMVADAYRTLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGGQAIDSNmKRMLDVVPEHIHDRSGIFMGSWDEV 336
Cdd:COG0158  237 GSMVADVHRILLKGGIFLYPSDKRAPNGKLRLLYEANPMAFLVEQAGGKATDGK-QRILDIVPEKLHQRVPLFLGSKEEV 315

                 ....*...
gi 389632543 337 EKVKAYHK 344
Cdd:COG0158  316 EKLERFIK 323
PRK09293 PRK09293
class 1 fructose-bisphosphatase;
18-344 3.64e-139

class 1 fructose-bisphosphatase;


Pssm-ID: 236458  Cd Length: 327  Bit Score: 397.68  E-value: 3.64e-139
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  18 VTLTRFLTEEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSSG 97
Cdd:PRK09293   3 KTLGEFLVEQQREFPHATGELTALISAIALAAKIISRAINKGGLADILGAAGTENVQGETQKKLDVFANEILIEALKARG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  98 KCALLVSEEEEEIIFFTNGNGsaRYAVACDPIDGSSNLDAGVSVGTIFGIHKlAEGSTGSKEDILKPGSELLAAGFTMYG 177
Cdd:PRK09293  83 HVAGLASEEEDEIVPIPENEG--KYLVAYDPLDGSSNIDVNVSVGTIFSIYR-APVGTPTEEDFLQPGNNQVAAGYVLYG 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 178 ASAQLVLTMKNGgVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEGNSLYWEDHVKEYFSSLKHPQEKSGKPYSARYIG 257
Cdd:PRK09293 160 PSTMLVLTTGDG-VHGFTLDPSLGEFVLTHENIRIPEDGKEYAINEGNQRHWEPGVKKYIELLAGKDGPRGRPYNMRYIG 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 258 SMVADAYRTLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGGQAIDSNmKRMLDVVPEHIHDRSGIFMGSWDEVE 337
Cdd:PRK09293 239 SMVADVHRILLKGGIFLYPADEPYPNGKLRLLYEANPMAFLVEQAGGAASDGK-QRILDIEPESLHQRVPLFLGSKEEVE 317

                 ....*..
gi 389632543 338 KVKAYHK 344
Cdd:PRK09293 318 RVEEYHA 324
PLN02542 PLN02542
fructose-1,6-bisphosphatase
1-342 1.88e-104

fructose-1,6-bisphosphatase


Pssm-ID: 215298  Cd Length: 412  Bit Score: 312.58  E-value: 1.88e-104
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543   1 MADSNNGPETEKVNT-NIVTLTRFL-TEEQAKhkEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQ 78
Cdd:PLN02542  59 AAAATASPAATKKSGyEIQTLTTWLlKQEQAG--VIDAELTIVLSSISMACKQIASLVQRAGISNLTGVQGAVNIQGEDQ 136
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  79 KKLDVIGNDLFIEAMRSSGKCALLVSEEEEEIIFFTNGNgSARYAVACDPIDGSSNLDAGVSVGTIFGIHK--------L 150
Cdd:PLN02542 137 KKLDVISNEVFSNCLRSSGRTGIIASEEEDVPVAVEESY-SGNYIVVFDPLDGSSNIDAAVSTGSIFGIYSpndecladI 215
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 151 AEGSTGSKE------DILKPGSELLAAGFTMYGASAQLVLTMKNGgVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEG 224
Cdd:PLN02542 216 GDDSTLDSVeqrcivNVCQPGSNLLAAGYCMYSSSVIFVLTIGTG-VFSFTLDPMYGEFVLTQENIQIPKAGKIYSFNEG 294
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 225 NSLYWEDHVKEYFSSLKHPQeKSGKPYSARYIGSMVADAYRTLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGG 304
Cdd:PLN02542 295 NYQLWDDKLKKYIDDLKDPG-PSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDKKSKNGKLRLLYECAPMSFIVEQAGG 373
                        330       340       350
                 ....*....|....*....|....*....|....*...
gi 389632543 305 QAIDSNmKRMLDVVPEHIHDRSGIFMGSWDEVEKVKAY 342
Cdd:PLN02542 374 KGSDGH-QRILDIQPTEIHQRVPLYIGSVEEVEKLEKY 410
FBPase pfam00316
Fructose-1-6-bisphosphatase, N-terminal domain; This family represents the N-terminus of this ...
19-208 1.67e-79

Fructose-1-6-bisphosphatase, N-terminal domain; This family represents the N-terminus of this protein family.


Pssm-ID: 395249  Cd Length: 189  Bit Score: 240.77  E-value: 1.67e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543   19 TLTRFLTEEQAKHKEATGDFTLLCHALQFSFKAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSSGK 98
Cdd:pfam00316   2 TLTRFIIEEQHEFPNATGELTGLLSALQLAAKFISRDIRKAGLANLLGLAGAENVQGDVQKKLDVLADEILKNALKASGI 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543   99 CALLVSEEEEEIIFFtNGNGSARYAVACDPIDGSSNLDAGVSVGTIFGIHKLAEGSTGSKEDILKPGSELLAAGFTMYGA 178
Cdd:pfam00316  82 VAVLVSEEEEELIVF-EGNKRGKYVVAFDPLDGSSNIDTNVSVGTIFSIYRRVSTDSPTTIDFLQPGNEQVAAGYVVYGS 160
                         170       180       190
                  ....*....|....*....|....*....|
gi 389632543  179 SAQLVLTMKnGGVNGFTLDNAFGEFILTHP 208
Cdd:pfam00316 161 STMLVLTTG-CGVHGFTLDPSLGEFILTHE 189
PLN02628 PLN02628
fructose-1,6-bisphosphatase family protein
19-342 1.61e-69

fructose-1,6-bisphosphatase family protein


Pssm-ID: 215337  Cd Length: 351  Bit Score: 220.82  E-value: 1.61e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  19 TLTRFLTEEQakhKEATGDFTLLCHALQFSFKAIAYYI---RRATLVNLTGLAGSSNTTG-DDQKKLDVIGNDLFIEAMR 94
Cdd:PLN02628  19 TLMEFLGTEG---SNVGDDLVVLMAHIQAACKRIAALLaspFNSELGKTSSGASGASGSGrDAPKPLDIVSNEIILSSLR 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  95 SSGKCALLVSEEEEEIIFFtngNGSARYAVACDPIDGSSNLDAGVSVGTIFGI-HKLAEGSTGSKED-----ILKPGSEL 168
Cdd:PLN02628  96 NSGKVAVMASEEDDAPIWI---GDDGPYVVVFDPLDGSRNIDASIPTGTIFGIyNRLVEADHLPVEEkaqlnVLQRGSRL 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 169 LAAGFTMYGASAQLVLTMKNGgVNGFTLDNAFGEFILTHPDMRMPKSRAIYSVNEGNSLYWEDHVKEYFSSLKHPQEKSG 248
Cdd:PLN02628 173 VAAGYVLYSSATILCISFGSG-THGFTLDHSTGEFVLTHPDIKIPERGQIYSVNDARYFDWPEGLRKYIDTVRQGKGQYP 251
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 249 KPYSARYIGSMVADAYRTLLYGGIfaypadKKSPKGKLRILYECAPMAMVFENAGGQAIDSNmKRMLDVVPEHIHDRSGI 328
Cdd:PLN02628 252 KKYSARYICSLVADLHRTILYGGI------AMNPRSHLRLVYEANPLSFLVEQAGGRGSDGK-RRILSIQPVKLHQRLPL 324
                        330
                 ....*....|....
gi 389632543 329 FMGSWDEVEKVKAY 342
Cdd:PLN02628 325 FLGSSEDVLELESY 338
FBPase_C pfam18913
Fructose-1-6-bisphosphatase, C-terminal domain; This entry represents the C-terminal domain of ...
218-344 1.81e-59

Fructose-1-6-bisphosphatase, C-terminal domain; This entry represents the C-terminal domain of Fructose-1-6-bisphosphatase enzymes. According to ECOD this domain has a Rossmann-like fold.


Pssm-ID: 408683 [Multi-domain]  Cd Length: 125  Bit Score: 187.43  E-value: 1.81e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  218 IYSVNEGNSLYWEDHVKEYFSSLKhpqeKSGKPYSARYIGSMVADAYRTLLYGGIFAYPADKKSPKGKLRILYECAPMAM 297
Cdd:pfam18913   4 IYAINEGNARHWNAPYRAYIDDLK----SGGKGYTLRYVGSMVADVHRILLKGGIFLYPADKRAPNGKLRLLYECAPLAF 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 389632543  298 VFENAGGQAIDSNmKRMLDVVPEHIHDRSGIFMGSWDEVEKVKAYHK 344
Cdd:pfam18913  80 LIEQAGGKASDGK-QRILDIVPDSLHQRTPIFLGSREEVERVEAYLK 125
PLN02462 PLN02462
sedoheptulose-1,7-bisphosphatase
52-342 3.41e-36

sedoheptulose-1,7-bisphosphatase


Pssm-ID: 215256  Cd Length: 304  Bit Score: 132.55  E-value: 3.41e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  52 IAYYIRRAtlvnLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSSGKCALLVSEEEEEIIFFtNGNGSARYAVACDPIDG 131
Cdd:PLN02462  29 IAFKVRTA----SCTGTACVNSFGDEQLAVDMLADKLLFEALKYSHVCKYACSEEVPEVQDM-GGPVEGGFSVAFDPLDG 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 132 SSNLDAGVSVGTIFGIHKlAEGSTGSKedilkpGSELLAAGFTMYGASAQLVLTMKNG-GVNGFTLdnafgefiltHPDM 210
Cdd:PLN02462 104 SSIVDTNFAVGTIFGVWP-GDKLTGVT------GRDQVAAAMGIYGPRTTYVVALKDGpGTHEFLL----------LDDG 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 211 RMPKSRAIYSVNEGN-----SLYWEDHVKEYFSSLKH-PQEKsgkpYSARYIGSMVADAYRTLLY-GGIFAYPADKKSPk 283
Cdd:PLN02462 167 KWQHVKETTEIGEGKifspgNLRATFDNPGYEKLINYyVSEK----YTLRYTGGMVPDVYQIIVKeKGVFTNVTSPKSK- 241
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543 284 GKLRILYECAPMAMVFENAGGQAID-SNMKRMLDVVPEHIHDRSGIFMGSWDEVEKVKAY 342
Cdd:PLN02462 242 AKLRLLFEVAPLGLLVEKAGGKSSDgVQGGSVLDKQINNLDQRTQVAYGSKNEVIRFEET 301
FIG cd01636
FIG, FBPase/IMPase/glpX-like domain. A superfamily of metal-dependent phosphatases with ...
50-185 1.93e-05

FIG, FBPase/IMPase/glpX-like domain. A superfamily of metal-dependent phosphatases with various substrates. Fructose-1,6-bisphospatase (both the major and the glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate to fructose-6-phosphate in gluconeogenesis. Inositol-monophosphatases and inositol polyphosphatases play vital roles in eukaryotic signalling, as they participate in metabolizing the messenger molecule Inositol-1,4,5-triphosphate. Many of these enzymes are inhibited by Li+.


Pssm-ID: 238814 [Multi-domain]  Cd Length: 184  Bit Score: 44.69  E-value: 1.93e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 389632543  50 KAIAYYIRRATLVNLTGLAGSSNTTGDDQKKLDVIGNDLFIEAMRSSGKCALLVSEEEEEIIFFTNGNGSarYAVACDPI 129
Cdd:cd01636    9 KEAGLAILKAFGRELSGKVKITKSDNDPVTTADVAAETLIRNMLKSSFPDVKIVGEESGVAEEVMGRRDE--YTWVIDPI 86
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 389632543 130 DGSSNLDAG-VSVGTIFGIHKLAEGST-GSKEDILKPGSELLAAGFTMY---GASAQLVLT 185
Cdd:cd01636   87 DGTKNFINGlPFVAVVIAVYVILILAEpSHKRVDEKKAELQLLAVYRIRivgSAVAKMCLV 147
PRK12676 PRK12676
bifunctional fructose-bisphosphatase/inositol-phosphate phosphatase;
75-139 4.01e-03

bifunctional fructose-bisphosphatase/inositol-phosphate phosphatase;


Pssm-ID: 183673  Cd Length: 263  Bit Score: 38.35  E-value: 4.01e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 389632543  75 GDDQKKLDVIGNDLFIEAMRSSGKCALLVSEEEEEIIfftnGNGSaRYAVACDPIDGSSNLDAGV 139
Cdd:PRK12676  40 GTPTKLIDKVAEDIILEVLKPLGRCVNIISEELGEIV----GNGP-EYTVVLDPLDGTYNAINGI 99
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH