NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|551493006|ref|XP_005798072|]
View 

protein FAM107B-like [Xiphophorus maculatus]

Protein Classification

protein FAM107A/FAM107B (domain architecture ID 10535143)

protein FAM107A/FAM107B may play a role in tumor development

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DUF1151 pfam06625
Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic ...
38-146 2.14e-34

Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic proteins of unknown function.


:

Pssm-ID: 399548  Cd Length: 114  Bit Score: 116.19  E-value: 2.14e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551493006   38 QEEDDLIKPQKLINPILASVQRRALHQELLFCHRRGMLPRTKPELQRVLESKNREQL----KKTELSLQPRSDLEVKLRR 113
Cdd:pfam06625   1 TDDDGLIKPKKLANPVLASPSHQELHRELLFNHKRGLVLEQKPELQRVLEKRKRDQVlkqkKEEEEAKKKRSDLEQELLK 80
                          90       100       110
                  ....*....|....*....|....*....|...
gi 551493006  114 RQQRIQHSELEEKKWREGLKNVPEFVRVRQSLK 146
Cdd:pfam06625  81 RQQRLEELEKEQEKQREEQENNPEFVRVKENLR 113
 
Name Accession Description Interval E-value
DUF1151 pfam06625
Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic ...
38-146 2.14e-34

Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic proteins of unknown function.


Pssm-ID: 399548  Cd Length: 114  Bit Score: 116.19  E-value: 2.14e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551493006   38 QEEDDLIKPQKLINPILASVQRRALHQELLFCHRRGMLPRTKPELQRVLESKNREQL----KKTELSLQPRSDLEVKLRR 113
Cdd:pfam06625   1 TDDDGLIKPKKLANPVLASPSHQELHRELLFNHKRGLVLEQKPELQRVLEKRKRDQVlkqkKEEEEAKKKRSDLEQELLK 80
                          90       100       110
                  ....*....|....*....|....*....|...
gi 551493006  114 RQQRIQHSELEEKKWREGLKNVPEFVRVRQSLK 146
Cdd:pfam06625  81 RQQRLEELEKEQEKQREEQENNPEFVRVKENLR 113
 
Name Accession Description Interval E-value
DUF1151 pfam06625
Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic ...
38-146 2.14e-34

Protein of unknown function (DUF1151); This family consists of several hypothetical eukaryotic proteins of unknown function.


Pssm-ID: 399548  Cd Length: 114  Bit Score: 116.19  E-value: 2.14e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551493006   38 QEEDDLIKPQKLINPILASVQRRALHQELLFCHRRGMLPRTKPELQRVLESKNREQL----KKTELSLQPRSDLEVKLRR 113
Cdd:pfam06625   1 TDDDGLIKPKKLANPVLASPSHQELHRELLFNHKRGLVLEQKPELQRVLEKRKRDQVlkqkKEEEEAKKKRSDLEQELLK 80
                          90       100       110
                  ....*....|....*....|....*....|...
gi 551493006  114 RQQRIQHSELEEKKWREGLKNVPEFVRVRQSLK 146
Cdd:pfam06625  81 RQQRLEELEKEQEKQREEQENNPEFVRVKENLR 113
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH