NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1023019498|ref|XP_016278912|]
View 

PREDICTED: serum amyloid A protein-like [Monodelphis domestica]

Protein Classification

SAA domain-containing protein (domain architecture ID 10447209)

SAA domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SAA pfam00277
Serum amyloid A protein;
110-210 8.97e-67

Serum amyloid A protein;


:

Pssm-ID: 395215  Cd Length: 101  Bit Score: 200.21  E-value: 8.97e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023019498 110 RFVKEAGQGAGDMWRAYRDMREANYKNSDKYFHARGNYDAARRGPGGAWAARVISDGREFFQGGSSGRGVEDSRADQFAN 189
Cdd:pfam00277   1 SFFKEAAQGAGDMWRAYWDMREANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDAREYLQGHVSGRGLEDSAADQEAN 80
                          90       100
                  ....*....|....*....|.
gi 1023019498 190 RWGRSGKDPNFFRPPGLPSKY 210
Cdd:pfam00277  81 RWGRSGKDPNHFRPRGLPDKY 101
 
Name Accession Description Interval E-value
SAA pfam00277
Serum amyloid A protein;
110-210 8.97e-67

Serum amyloid A protein;


Pssm-ID: 395215  Cd Length: 101  Bit Score: 200.21  E-value: 8.97e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023019498 110 RFVKEAGQGAGDMWRAYRDMREANYKNSDKYFHARGNYDAARRGPGGAWAARVISDGREFFQGGSSGRGVEDSRADQFAN 189
Cdd:pfam00277   1 SFFKEAAQGAGDMWRAYWDMREANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDAREYLQGHVSGRGLEDSAADQEAN 80
                          90       100
                  ....*....|....*....|.
gi 1023019498 190 RWGRSGKDPNFFRPPGLPSKY 210
Cdd:pfam00277  81 RWGRSGKDPNHFRPRGLPDKY 101
SAA smart00197
Serum amyloid A proteins; Serum amyloid A proteins are induced during the acute-phase response. ...
110-210 4.02e-61

Serum amyloid A proteins; Serum amyloid A proteins are induced during the acute-phase response. Secondary amyloidosis is characterised by the extracellular accumulation in tissues of SAA proteins. SAA proteins are apolipoproteins.


Pssm-ID: 214552  Cd Length: 103  Bit Score: 185.80  E-value: 4.02e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023019498  110 RFVKEAGQGAGDMWRAYRDMREANYKNSDKYFHARGNYDAARRGPGGAWAARVISDGREFFQGGSSGRGVEDSRADQFAN 189
Cdd:smart00197   3 SFFKEALQGAWDMWRAYRDMKEANHQNADKYFHARGNYDAAQRGPGGVWAAKVISDAREYFQGLISGRGLEDSKADQKAN 82
                           90       100
                   ....*....|....*....|.
gi 1023019498  190 RWGRSGKDPNFFRPPGLPSKY 210
Cdd:smart00197  83 EWGRSGKDPNRFRPPGLPEKY 103
 
Name Accession Description Interval E-value
SAA pfam00277
Serum amyloid A protein;
110-210 8.97e-67

Serum amyloid A protein;


Pssm-ID: 395215  Cd Length: 101  Bit Score: 200.21  E-value: 8.97e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023019498 110 RFVKEAGQGAGDMWRAYRDMREANYKNSDKYFHARGNYDAARRGPGGAWAARVISDGREFFQGGSSGRGVEDSRADQFAN 189
Cdd:pfam00277   1 SFFKEAAQGAGDMWRAYWDMREANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDAREYLQGHVSGRGLEDSAADQEAN 80
                          90       100
                  ....*....|....*....|.
gi 1023019498 190 RWGRSGKDPNFFRPPGLPSKY 210
Cdd:pfam00277  81 RWGRSGKDPNHFRPRGLPDKY 101
SAA smart00197
Serum amyloid A proteins; Serum amyloid A proteins are induced during the acute-phase response. ...
110-210 4.02e-61

Serum amyloid A proteins; Serum amyloid A proteins are induced during the acute-phase response. Secondary amyloidosis is characterised by the extracellular accumulation in tissues of SAA proteins. SAA proteins are apolipoproteins.


Pssm-ID: 214552  Cd Length: 103  Bit Score: 185.80  E-value: 4.02e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023019498  110 RFVKEAGQGAGDMWRAYRDMREANYKNSDKYFHARGNYDAARRGPGGAWAARVISDGREFFQGGSSGRGVEDSRADQFAN 189
Cdd:smart00197   3 SFFKEALQGAWDMWRAYRDMKEANHQNADKYFHARGNYDAAQRGPGGVWAAKVISDAREYFQGLISGRGLEDSKADQKAN 82
                           90       100
                   ....*....|....*....|.
gi 1023019498  190 RWGRSGKDPNFFRPPGLPSKY 210
Cdd:smart00197  83 EWGRSGKDPNRFRPPGLPEKY 103
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH