NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1039753749|ref|XP_017173002|]
View 

RIKEN cDNA 9830107B12 isoform X1 [Mus musculus]

Protein Classification

immunoglobulin domain-containing protein (domain architecture ID 10146027)

immunoglobulin (Ig) domain-containing protein with one or more Ig domains, which adopt a fold comprised of a sandwich of two beta sheets and may function in cell adhesion and/or pattern recognition; similar to polymeric immunoglobulin receptor

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IgV_pIgR_like cd05716
Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The ...
26-105 1.14e-19

Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The members here are composed of the immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins. pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their C-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620-residue extracellular region, a 23-residue transmembrane region, and a 103-residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions. This group also contains the Ig-like extracellular domains of other receptors such as NK cell receptor Nkp44 and myeloid receptors, among others.


:

Pssm-ID: 409381  Cd Length: 100  Bit Score: 79.75  E-value: 1.14e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749  26 PELLRVLEGKTVSVTCMYDPLYNSDEKIWCKQIDNLCYPLV-SKGAEKP-RFSILQSSKFNFFTVTMSKLRMSDSGIYHC 103
Cdd:cd05716     4 PEVVTGVEGGSVTIQCPYPPKYASSRKYWCKWGSEGCQTLVsSEGVVPGgRISLTDDPDNGVFTVTLNQLRKEDAGWYWC 83

                  ..
gi 1039753749 104 GI 105
Cdd:cd05716    84 GV 85
 
Name Accession Description Interval E-value
IgV_pIgR_like cd05716
Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The ...
26-105 1.14e-19

Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The members here are composed of the immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins. pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their C-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620-residue extracellular region, a 23-residue transmembrane region, and a 103-residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions. This group also contains the Ig-like extracellular domains of other receptors such as NK cell receptor Nkp44 and myeloid receptors, among others.


Pssm-ID: 409381  Cd Length: 100  Bit Score: 79.75  E-value: 1.14e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749  26 PELLRVLEGKTVSVTCMYDPLYNSDEKIWCKQIDNLCYPLV-SKGAEKP-RFSILQSSKFNFFTVTMSKLRMSDSGIYHC 103
Cdd:cd05716     4 PEVVTGVEGGSVTIQCPYPPKYASSRKYWCKWGSEGCQTLVsSEGVVPGgRISLTDDPDNGVFTVTLNQLRKEDAGWYWC 83

                  ..
gi 1039753749 104 GI 105
Cdd:cd05716    84 GV 85
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
24-121 1.48e-16

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 400157  Cd Length: 109  Bit Score: 71.72  E-value: 1.48e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749  24 QNPELLRVLEGKTVSVTCMYDPLYNSD--EKIWCKQI-DNLCYPLV-------SKGAEKPRFSILQSSKFNFFTVTMSKL 93
Cdd:pfam07686   1 QTPRSVTVALGGSVTLPCTYSSSMSEAstSVYWYRQPpGKGPTFLIayysngsEEGKKKGRFSLRGDPSNSDGSLTIQNL 80
                          90       100
                  ....*....|....*....|....*...
gi 1039753749  94 RMSDSGIYHCGIAANTRITYLRGIQLVV 121
Cdd:pfam07686  81 TLSDSGTYTCAVIPSGEGVFGKGTRLTV 108
IG smart00409
Immunoglobulin;
26-121 9.12e-09

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 50.58  E-value: 9.12e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749   26 PELLRVLEGKTVSVTCMYDPlYNSDEKIWCKQIDNLcyplvskGAEKPRFSILQSSkfNFFTVTMSKLRMSDSGIYHCgI 105
Cdd:smart00409   1 PPSVTVKEGESVTLSCEASG-SPPPEVTWYKQGGKL-------LAESGRFSVSRSG--STSTLTISNVTPEDSGTYTC-A 69
                           90
                   ....*....|....*.
gi 1039753749  106 AANTRITYLRGIQLVV 121
Cdd:smart00409  70 ATNSSGSASSGTTLTV 85
 
Name Accession Description Interval E-value
IgV_pIgR_like cd05716
Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The ...
26-105 1.14e-19

Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The members here are composed of the immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins. pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their C-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620-residue extracellular region, a 23-residue transmembrane region, and a 103-residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions. This group also contains the Ig-like extracellular domains of other receptors such as NK cell receptor Nkp44 and myeloid receptors, among others.


Pssm-ID: 409381  Cd Length: 100  Bit Score: 79.75  E-value: 1.14e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749  26 PELLRVLEGKTVSVTCMYDPLYNSDEKIWCKQIDNLCYPLV-SKGAEKP-RFSILQSSKFNFFTVTMSKLRMSDSGIYHC 103
Cdd:cd05716     4 PEVVTGVEGGSVTIQCPYPPKYASSRKYWCKWGSEGCQTLVsSEGVVPGgRISLTDDPDNGVFTVTLNQLRKEDAGWYWC 83

                  ..
gi 1039753749 104 GI 105
Cdd:cd05716    84 GV 85
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
24-121 1.48e-16

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 400157  Cd Length: 109  Bit Score: 71.72  E-value: 1.48e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749  24 QNPELLRVLEGKTVSVTCMYDPLYNSD--EKIWCKQI-DNLCYPLV-------SKGAEKPRFSILQSSKFNFFTVTMSKL 93
Cdd:pfam07686   1 QTPRSVTVALGGSVTLPCTYSSSMSEAstSVYWYRQPpGKGPTFLIayysngsEEGKKKGRFSLRGDPSNSDGSLTIQNL 80
                          90       100
                  ....*....|....*....|....*...
gi 1039753749  94 RMSDSGIYHCGIAANTRITYLRGIQLVV 121
Cdd:pfam07686  81 TLSDSGTYTCAVIPSGEGVFGKGTRLTV 108
IG smart00409
Immunoglobulin;
26-121 9.12e-09

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 50.58  E-value: 9.12e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749   26 PELLRVLEGKTVSVTCMYDPlYNSDEKIWCKQIDNLcyplvskGAEKPRFSILQSSkfNFFTVTMSKLRMSDSGIYHCgI 105
Cdd:smart00409   1 PPSVTVKEGESVTLSCEASG-SPPPEVTWYKQGGKL-------LAESGRFSVSRSG--STSTLTISNVTPEDSGTYTC-A 69
                           90
                   ....*....|....*.
gi 1039753749  106 AANTRITYLRGIQLVV 121
Cdd:smart00409  70 ATNSSGSASSGTTLTV 85
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
26-121 9.12e-09

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653  Cd Length: 85  Bit Score: 50.58  E-value: 9.12e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749   26 PELLRVLEGKTVSVTCMYDPlYNSDEKIWCKQIDNLcyplvskGAEKPRFSILQSSkfNFFTVTMSKLRMSDSGIYHCgI 105
Cdd:smart00410   1 PPSVTVKEGESVTLSCEASG-SPPPEVTWYKQGGKL-------LAESGRFSVSRSG--STSTLTISNVTPEDSGTYTC-A 69
                           90
                   ....*....|....*.
gi 1039753749  106 AANTRITYLRGIQLVV 121
Cdd:smart00410  70 ATNSSGSASSGTTLTV 85
IgV cd00099
Immunoglobulin variable domain (IgV); The members here are composed of the immunoglobulin ...
23-103 1.94e-04

Immunoglobulin variable domain (IgV); The members here are composed of the immunoglobulin variable domain (IgV). The IgV family contains the standard Ig superfamily V-set AGFCC'C"/DEB domain topology, and are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond. Ig superfamily (IgSF) domains can be divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets. Typically, the V-set domains have A, B, E and, D strands in one sheet and A', G, F, C, C', and C" strands in the other.


Pssm-ID: 409355  Cd Length: 111  Bit Score: 39.24  E-value: 1.94e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749  23 TQNPELLRVLEGKTVSVTCMYDPLYNSDEKIWCKQIDN-----LCY----PLVSKGAEKPRFSIlQSSKFNFFTVTMSKL 93
Cdd:cd00099     2 TQSPRSLSVQEGESVTLSCEVSSSFSSTYIYWYRQKPGqgpefLIYlsssKGKTKGGVPGRFSG-SRDGTSSFSLTISNL 80
                          90
                  ....*....|
gi 1039753749  94 RMSDSGIYHC 103
Cdd:cd00099    81 QPEDSGTYYC 90
IGv smart00406
Immunoglobulin V-Type;
72-103 2.32e-04

Immunoglobulin V-Type;


Pssm-ID: 214650  Cd Length: 81  Bit Score: 38.52  E-value: 2.32e-04
                           10        20        30
                   ....*....|....*....|....*....|..
gi 1039753749   72 KPRFSILQSSKFNFFTVTMSKLRMSDSGIYHC 103
Cdd:smart00406  48 KGRFTISKDTSKNDVSLTISNLRVEDTGTYYC 79
IgV_CD8_beta cd07700
Immunoglobulin (Ig) variable (V) domain of Cluster of Differentiation (CD) 8 beta chain; The ...
24-121 1.08e-03

Immunoglobulin (Ig) variable (V) domain of Cluster of Differentiation (CD) 8 beta chain; The members here are composed of the immunoglobulin (Ig)-like domain in Cluster of Differentiation (CD) 8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation, and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners, etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion, and a short intracellular domain. Members of this group contain standard Ig superfamily V-set AGFCC'C"/DEB domain topology.


Pssm-ID: 409497  Cd Length: 116  Bit Score: 37.43  E-value: 1.08e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749  24 QNPELLRVLEGKTVSVTCMYDPLYNSDEKIWCKQ---------IDNLCYPLVSKGA------EKPRFSILQSSKFNFFTV 88
Cdd:cd07700     3 QTPGSLLVQTNQTVKMSCEAKTSPKNTRIYWLRQrqapskdshFEFLASWDPSKGIvygegvDQEKLIILSDSDSSRYIL 82
                          90       100       110
                  ....*....|....*....|....*....|...
gi 1039753749  89 TMSKLRMSDSGIYHCGIAANTRITYLRGIQLVV 121
Cdd:cd07700    83 SLMSVKPEDSGTYFCMTVGSPELIFGTGTKLSV 115
IgV_TCR_delta cd07706
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain; The members here ...
23-121 1.75e-03

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain; The members here are composed of the immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains. Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs, but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is located at the N-terminus of the receptor. Members of this group contain standard Ig superfamily V-set AGFCC'C"/DEB domain topology.


Pssm-ID: 409503  Cd Length: 112  Bit Score: 36.73  E-value: 1.75e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749  23 TQNPELLRVLEGKTVSVTCMYDPLYNSDEKIWCKQIDNLCYPLVSKG------AEKPRFSILQSSKFNFFTVTMSKLRMS 96
Cdd:cd07706     3 TQAQPDVSVQVGEEVTLNCRYETSWTNYYLFWYKQLPSGEMTFLIRQdsseqnAKSGRYSVNFQKAQKSISLTISALQLE 82
                          90       100
                  ....*....|....*....|....*...
gi 1039753749  97 DSGIYHCGIAA--NT-RITYLRGIQLVV 121
Cdd:cd07706    83 DSAKYFCALSLpyDTdKLIFGKGTRLTV 110
IgV_TCR_alpha cd04983
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar ...
23-121 2.00e-03

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins; The members here are composed of the immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens directly without antigen processing and recognize MHC independently of the bound peptide. Members of this group contain standard Ig superfamily V-set AGFCC'C"/DEB domain topology.


Pssm-ID: 409372  Cd Length: 109  Bit Score: 36.48  E-value: 2.00e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1039753749  23 TQNPELLRVLEGKTVSVTCMYDPLyNSDEKIWCKQIDN-----LCYPLVSKGAE-KPRFSILQSSKFNFFTVTMSKLRMS 96
Cdd:cd04983     2 TQSPQSLSVQEGENVTLNCNYSTS-TFYYLFWYRQYPGqgpqfLIYISSDSGNKkKGRFSATLDKSRKSSSLHISAAQLS 80
                          90       100
                  ....*....|....*....|....*...
gi 1039753749  97 DSGIYHC---GIAANTRITYLRGIQLVV 121
Cdd:cd04983    81 DSAVYFCalsESGGTGKLTFGKGTRLTV 108
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH