NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|73953222|ref|XP_852242|]
View 

sodium-dependent phosphate transport protein 2A isoform X5 [Canis lupus familiaris]

Protein Classification

sodium-dependent phosphate transport protein 2 (domain architecture ID 11490082)

sodium-dependent phosphate transport protein 2 may be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-590 0e+00

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


:

Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 530.59  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   108 LAFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHVTGLVVASFNIHGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   268 KIITEPFTKLIIQLDKSVITSIAtgdeSLRNHSLIRIWCHPDPMgvptlMPRAEANTSRMpgnasmekcNHIFVDtglpd 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTLSS-----LPVPESNLPIE---------AHIFVN----- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   348 laVGLILLASSLMVLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWATGYFAMVVGAGMTFIVQSSSVFTSAIT 427
Cdd:TIGR01013 218 --VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLDTPVPFLWVTGYEALLVGDAMTFIIQSSSVFTSALT 295
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   428 PLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAVQIALCHFFFNISGILLWYPVPCTRLPIRMAKALGKR 507
Cdd:TIGR01013 296 PLVGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYCHNLFNISGIVLFYPLPCTRKPIAAARGFGDD 375
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   508 TAKYRWFAVLYLLLCFLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVFISVLQNRSPRhlPKWLQTWDFLPRWMHSLQ 587
Cdd:TIGR01013 376 GSKYRWFLIVYLVLNFLLAPSLLFGLDLNLARRLVGVKIPFRILELFSSLLHVLQLRCPR--PQSLQTWSFLPDWLRSLK 453

                  ...
gi 73953222   588 PLD 590
Cdd:TIGR01013 454 RLD 456
 
Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-590 0e+00

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 530.59  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   108 LAFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHVTGLVVASFNIHGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   268 KIITEPFTKLIIQLDKSVITSIAtgdeSLRNHSLIRIWCHPDPMgvptlMPRAEANTSRMpgnasmekcNHIFVDtglpd 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTLSS-----LPVPESNLPIE---------AHIFVN----- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   348 laVGLILLASSLMVLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWATGYFAMVVGAGMTFIVQSSSVFTSAIT 427
Cdd:TIGR01013 218 --VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLDTPVPFLWVTGYEALLVGDAMTFIIQSSSVFTSALT 295
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   428 PLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAVQIALCHFFFNISGILLWYPVPCTRLPIRMAKALGKR 507
Cdd:TIGR01013 296 PLVGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYCHNLFNISGIVLFYPLPCTRKPIAAARGFGDD 375
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   508 TAKYRWFAVLYLLLCFLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVFISVLQNRSPRhlPKWLQTWDFLPRWMHSLQ 587
Cdd:TIGR01013 376 GSKYRWFLIVYLVLNFLLAPSLLFGLDLNLARRLVGVKIPFRILELFSSLLHVLQLRCPR--PQSLQTWSFLPDWLRSLK 453

                  ...
gi 73953222   588 PLD 590
Cdd:TIGR01013 454 RLD 456
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
106-491 1.91e-18

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 88.85  E-value: 1.91e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 106 LMLAFLYLFVCSLDVLSSAFQLAGGKVAGDIFkdNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAI 185
Cdd:COG1283   9 NLLGAVALLLFGIKMVGDGVQRAAGDRLRKIL--ARFTSNPILGVLAGIVATALLQSSTATTVLTIGFVAAGLLSLKQAI 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 186 PIIMGSNIGTSVTNTIVALmqaGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAatgylhhvtglvvasfnihggrdapd 265
Cdd:COG1283  87 GVILGANIGTTVTAWIVAL---DLSWLSPPLLAIGAILFFFGKSSKLRQLGRVL-------------------------- 137
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 266 llkiitepftkliiqldksvitsiatgdeslrnhsliriwchpdpmgvptlmpraeantsrmpgnasmekcnhifvdtgl 345
Cdd:COG1283     --------------------------------------------------------------------------------
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 346 pdLAVGLILLASSLMVlctclillvkmlNSLLKGQVAKVIQKVINTDFPAPFTwatgyfAMVVGAGMTFIVQSSSVFTSA 425
Cdd:COG1283 138 --FGIGLIFLSLELLG------------QATEPLRQSPAFSDFIAKLSDDPIV------ALLIGALLTALIQSSLAAIGI 197
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 73953222 426 ITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPReklsSAVQIALCHFFFNISGILLWYPV 491
Cdd:COG1283 198 LLSLTSQGLISLEAALALVLGANLGTTITAVLAALGASA----AARRVALGNLLFNLIGVLIFLPV 259
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
113-204 2.60e-15

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 72.82  E-value: 2.60e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   113 LFVCSLDVLSSAFQlaggKVAGDIFKD--NAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMG 190
Cdd:pfam02690   1 LFLFGMKLMSDGLQ----KLAGGRLRRilEKLTSNPLKGLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMG 76
                          90
                  ....*....|....
gi 73953222   191 SNIGTSVTNTIVAL 204
Cdd:pfam02690  77 ANIGTTVTAQLIAF 90
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
403-490 8.97e-11

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 63.00  E-value: 8.97e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222  403 YFAMVVGAGMTFIVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREklssAVQIALCHFFFNI 482
Cdd:NF037997 165 LLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASIGSGKE----AKLTAYAHIWLNV 240

                 ....*...
gi 73953222  483 SGILLWYP 490
Cdd:NF037997 241 LGVLLFLP 248
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
145-237 5.25e-05

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 45.67  E-value: 5.25e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222  145 NPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHD 224
Cdd:NF037997 163 SLLLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASI--GSGKEAKLTAYA----HI 236
                         90
                 ....*....|...
gi 73953222  225 CFNWLSVLVLLPL 237
Cdd:NF037997 237 WLNVLGVLLFLPF 249
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
400-479 4.51e-03

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 39.51  E-value: 4.51e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222  400 ATGYFAMVVGAGMTFIVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAVQIALCHFF 479
Cdd:NF037997  36 DTPLKGFLTGTVITAILQSSSAVMVLTVGLVSAGILTFRQSIGIILGTNIGTTFTTEFITFDIDRLIIPLLIIGALLLFL 115
 
Name Accession Description Interval E-value
2a58 TIGR01013
Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron ...
108-590 0e+00

Phosphate:Na+ Symporter (PNaS) Family; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 162157 [Multi-domain]  Cd Length: 456  Bit Score: 530.59  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   108 LAFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPI 187
Cdd:TIGR01013   1 LVLLFVFVCSLAVLSAAFILLGAKVGGAIFADILITDNPWASPLLGFLGTVLLQSSSTSRSIVVGMVSAGLLLVLLAIPL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   188 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHVTGLVVASFNIHGGRDAPDLL 267
Cdd:TIGR01013  81 IMGANIGSSVTNAIVAIMQSGDRAWFRRAFIGATVADIFNSSLALVLLPLELTTGGIESVTLLVVLVFGANGGGDAPDLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   268 KIITEPFTKLIIQLDKSVITSIAtgdeSLRNHSLIRIWCHPDPMgvptlMPRAEANTSRMpgnasmekcNHIFVDtglpd 347
Cdd:TIGR01013 161 NSLTAPATALIVQLDNLIIRLIG----SLLILPLIDILASTLSS-----LPVPESNLPIE---------AHIFVN----- 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   348 laVGLILLASSLMVLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWATGYFAMVVGAGMTFIVQSSSVFTSAIT 427
Cdd:TIGR01013 218 --VGLILLALPFVRLCARLILVVIPLNSLLDGQVAPVILDVINLDTPVPFLWVTGYEALLVGDAMTFIIQSSSVFTSALT 295
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   428 PLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAVQIALCHFFFNISGILLWYPVPCTRLPIRMAKALGKR 507
Cdd:TIGR01013 296 PLVGKGVISLERAYPLVLGSNIGTTLTAVLAALLSEDEKRRSALQIAYCHNLFNISGIVLFYPLPCTRKPIAAARGFGDD 375
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   508 TAKYRWFAVLYLLLCFLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVFISVLQNRSPRhlPKWLQTWDFLPRWMHSLQ 587
Cdd:TIGR01013 376 GSKYRWFLIVYLVLNFLLAPSLLFGLDLNLARRLVGVKIPFRILELFSSLLHVLQLRCPR--PQSLQTWSFLPDWLRSLK 453

                  ...
gi 73953222   588 PLD 590
Cdd:TIGR01013 454 RLD 456
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
106-491 1.91e-18

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 88.85  E-value: 1.91e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 106 LMLAFLYLFVCSLDVLSSAFQLAGGKVAGDIFkdNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAI 185
Cdd:COG1283   9 NLLGAVALLLFGIKMVGDGVQRAAGDRLRKIL--ARFTSNPILGVLAGIVATALLQSSTATTVLTIGFVAAGLLSLKQAI 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 186 PIIMGSNIGTSVTNTIVALmqaGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAatgylhhvtglvvasfnihggrdapd 265
Cdd:COG1283  87 GVILGANIGTTVTAWIVAL---DLSWLSPPLLAIGAILFFFGKSSKLRQLGRVL-------------------------- 137
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 266 llkiitepftkliiqldksvitsiatgdeslrnhsliriwchpdpmgvptlmpraeantsrmpgnasmekcnhifvdtgl 345
Cdd:COG1283     --------------------------------------------------------------------------------
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 346 pdLAVGLILLASSLMVlctclillvkmlNSLLKGQVAKVIQKVINTDFPAPFTwatgyfAMVVGAGMTFIVQSSSVFTSA 425
Cdd:COG1283 138 --FGIGLIFLSLELLG------------QATEPLRQSPAFSDFIAKLSDDPIV------ALLIGALLTALIQSSLAAIGI 197
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 73953222 426 ITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPReklsSAVQIALCHFFFNISGILLWYPV 491
Cdd:COG1283 198 LLSLTSQGLISLEAALALVLGANLGTTITAVLAALGASA----AARRVALGNLLFNLIGVLIFLPV 259
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
113-204 2.60e-15

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 72.82  E-value: 2.60e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222   113 LFVCSLDVLSSAFQlaggKVAGDIFKD--NAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMG 190
Cdd:pfam02690   1 LFLFGMKLMSDGLQ----KLAGGRLRRilEKLTSNPLKGLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMG 76
                          90
                  ....*....|....
gi 73953222   191 SNIGTSVTNTIVAL 204
Cdd:pfam02690  77 ANIGTTVTAQLIAF 90
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
403-490 8.97e-11

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 63.00  E-value: 8.97e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222  403 YFAMVVGAGMTFIVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREklssAVQIALCHFFFNI 482
Cdd:NF037997 165 LLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASIGSGKE----AKLTAYAHIWLNV 240

                 ....*...
gi 73953222  483 SGILLWYP 490
Cdd:NF037997 241 LGVLLFLP 248
Na_Pi_cotrans pfam02690
Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters ...
405-460 4.23e-10

Na+/Pi-cotransporter; This is a family of mainly mammalian type II renal Na+/Pi-cotransporters with other related sequences from lower eukaryotes and bacteria some of which are also Na+/Pi-cotransporters. In the kidney the type II renal Na+/Pi-cotransporters protein allows re-absorption of filtered Pi in the proximal tubule.


Pssm-ID: 397008 [Multi-domain]  Cd Length: 137  Bit Score: 58.18  E-value: 4.23e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 73953222   405 AMVVGAGMTFIVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAAL 460
Cdd:pfam02690  35 GLLVGLLVTALLQSSSATTVMVVGFVNAGLLTLRQAIGVIMGANIGTTVTAQLIAF 90
NptA COG1283
Na+/phosphate symporter [Inorganic ion transport and metabolism];
107-278 9.77e-06

Na+/phosphate symporter [Inorganic ion transport and metabolism];


Pssm-ID: 224202 [Multi-domain]  Cd Length: 533  Bit Score: 48.40  E-value: 9.77e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 107 MLAFLYLFVCSLDVLSSAFQ-LAGGKVAGDIFKdnAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAI 185
Cdd:COG1283 136 VLFGIGLIFLSLELLGQATEpLRQSPAFSDFIA--KLSDDPIVALLIGALLTALIQSSLAAIGILLSLTSQGLISLEAAL 213
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222 186 PIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHDCFNWLSVLVLLPLeaaTGYLHHVTG---------LVVAS-- 254
Cdd:COG1283 214 ALVLGANLGTTITAVLAAL--GASAAARRVALG----NLLFNLIGVLIFLPV---IHLLATFASklslppaalIAHAHll 284
                       170       180
                ....*....|....*....|....
gi 73953222 255 FNIhggrdapdLLKIITEPFTKLI 278
Cdd:COG1283 285 FNI--------VLALAALPFTGLL 300
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
145-237 5.25e-05

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 45.67  E-value: 5.25e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222  145 NPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALmqAGDRTDFRRAFAgatvHD 224
Cdd:NF037997 163 SLLLALLIGTVLTAIIQSSSATTGITMSFLNEGILTLPAGIAIMLGANIGTCITALLASI--GSGKEAKLTAYA----HI 236
                         90
                 ....*....|...
gi 73953222  225 CFNWLSVLVLLPL 237
Cdd:NF037997 237 WLNVLGVLLFLPF 249
Na_Pi_symport NF037997
Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) ...
400-479 4.51e-03

Na/Pi symporter; Proteins of this family belong to the Phosphate:Na+ Symporter (PNaS) superfamily.


Pssm-ID: 411591  Cd Length: 294  Bit Score: 39.51  E-value: 4.51e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73953222  400 ATGYFAMVVGAGMTFIVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAVQIALCHFF 479
Cdd:NF037997  36 DTPLKGFLTGTVITAILQSSSAVMVLTVGLVSAGILTFRQSIGIILGTNIGTTFTTEFITFDIDRLIIPLLIIGALLLFL 115
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH