NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1071373367|ref|WP_069805781|]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA03247 super family cl33720
large tegument protein UL36; Provisional
415-605 1.22e-15

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 81.91  E-value: 1.22e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  415 TPTIPTPSLTPTPFPTMPGEPGVSPVPSLV-PTKTPAPSSTPKPTATASPTpKPTVTASPTPKPTVTASPTPKPTVTASP 493
Cdd:PHA03247  2621 THAPDPPPPSPSPAANEPDPHPPPTVPPPErPRDDPAPGRVSRPRRARRLG-RAAQASSPPQRPRRRAARPTVGSLTSLA 2699
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  494 TP-KPTVTASPTPKPTVTASPTPkPTVTASPTPKPTVTASPTPKPTVTASPTP-KPTATARPSVTPTVTPTASPTVRPTA 571
Cdd:PHA03247  2700 DPpPPPPTPEPAPHALVSATPLP-PGPAAARQASPALPAAPAPPAVPAGPATPgGPARPARPPTTAGPPAPAPPAAPAAG 2778
                          170       180       190
                   ....*....|....*....|....*....|....
gi 1071373367  572 TAGVTPSPTAGTITRALASGEAGPLAMPNGLALS 605
Cdd:PHA03247  2779 PPRRLTRPAVASLSESRESLPSPWDPADPPAAVL 2812
COG3942 COG3942
Surface antigen [Cell wall/membrane/envelope biogenesis];
49-208 5.49e-13

Surface antigen [Cell wall/membrane/envelope biogenesis];


:

Pssm-ID: 226451  Cd Length: 173  Bit Score: 67.87  E-value: 5.49e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  49 NLLQANAQGLGYTASTLNSSCDQLSFSADGNPFAlcpgpfprGGNCVWWAWEQWHWLHYDLPLNWGNAADWISAAQRAGL 128
Cdd:COG3942    36 APKYGSVLSFAPTAAMYLGKVYSVSSVDASNTYY--------VGQCTWYVANRRGQAGGYVGPTWGNAGDWAYSAAAAGY 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 129 AVGTQPRVGAIAVFPVAdgvwAYssaGHVAFVTWVSPDGdTFNVTYQNYGDPtpvhlgigYQVSVINQPRYQHGQLRFIY 208
Cdd:COG3942   108 QVNVTPTVGAIAQSADG----GY---GHVAYVESVNSDG-SILISEMNAAGT--------GKISSRTISAQQADSYDYIH 171
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
415-605 1.22e-15

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 81.91  E-value: 1.22e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  415 TPTIPTPSLTPTPFPTMPGEPGVSPVPSLV-PTKTPAPSSTPKPTATASPTpKPTVTASPTPKPTVTASPTPKPTVTASP 493
Cdd:PHA03247  2621 THAPDPPPPSPSPAANEPDPHPPPTVPPPErPRDDPAPGRVSRPRRARRLG-RAAQASSPPQRPRRRAARPTVGSLTSLA 2699
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  494 TP-KPTVTASPTPKPTVTASPTPkPTVTASPTPKPTVTASPTPKPTVTASPTP-KPTATARPSVTPTVTPTASPTVRPTA 571
Cdd:PHA03247  2700 DPpPPPPTPEPAPHALVSATPLP-PGPAAARQASPALPAAPAPPAVPAGPATPgGPARPARPPTTAGPPAPAPPAAPAAG 2778
                          170       180       190
                   ....*....|....*....|....*....|....
gi 1071373367  572 TAGVTPSPTAGTITRALASGEAGPLAMPNGLALS 605
Cdd:PHA03247  2779 PPRRLTRPAVASLSESRESLPSPWDPADPPAAVL 2812
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
410-597 1.08e-14

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 78.42  E-value: 1.08e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 410 FANTLTPTIPTPSLTPTPFPTMPGEPGVsPVPSLVPTKTPAPSSTPKPTATA---SPTPKPTVT-ASPtpkptVTASPTP 485
Cdd:pfam05109 421 FSKAPESTTTSPTLNTTGFAAPNTTTGL-PSSTHVPTNLTAPASTGPTVSTAdvtSPTPAGTTSgASP-----VTPSPSP 494
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 486 KPTVTASPTPKPT--VTASPTPKPTVTaSPTPKPTvtaSPTPKPTVTASPTPKPTvTASPTPKPTATARPSVTPTVTPTA 563
Cdd:pfam05109 495 RDNGTESKAPDMTspTSAVTTPTPNAT-SPTPAVT---TPTPNATSPTLGKTSPT-SAVTTPTPNATSPTPAVTTPTPNA 569
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 1071373367 564 S-PTVRPTA--TAGVTPSPTAGTITralaSGEAGPLA 597
Cdd:pfam05109 570 TiPTLGKTSptSAVTTPTPNATSPT----VGETSPQA 602
COG3942 COG3942
Surface antigen [Cell wall/membrane/envelope biogenesis];
49-208 5.49e-13

Surface antigen [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 226451  Cd Length: 173  Bit Score: 67.87  E-value: 5.49e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  49 NLLQANAQGLGYTASTLNSSCDQLSFSADGNPFAlcpgpfprGGNCVWWAWEQWHWLHYDLPLNWGNAADWISAAQRAGL 128
Cdd:COG3942    36 APKYGSVLSFAPTAAMYLGKVYSVSSVDASNTYY--------VGQCTWYVANRRGQAGGYVGPTWGNAGDWAYSAAAAGY 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 129 AVGTQPRVGAIAVFPVAdgvwAYssaGHVAFVTWVSPDGdTFNVTYQNYGDPtpvhlgigYQVSVINQPRYQHGQLRFIY 208
Cdd:COG3942   108 QVNVTPTVGAIAQSADG----GY---GHVAYVESVNSDG-SILISEMNAAGT--------GKISSRTISAQQADSYDYIH 171
CHAP pfam05257
CHAP domain; This domain corresponds to an amidase function. Many of these proteins are ...
92-176 1.52e-12

CHAP domain; This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.


Pssm-ID: 336080  Cd Length: 84  Bit Score: 63.59  E-value: 1.52e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  92 GNCVWWAWEQWHWLHYDLPlNWGNAADWISAAQRAGLAVGTQPRVGAIAVFPvADGVWAYssaGHVAFVTwvSPDGdTFN 171
Cdd:pfam05257   8 GQCTWFVYWRVAQLGGPIP-GLGNAGDWADNAAGAYKVGSTTPKVGDIVVFD-PGGGGPY---GHVAIVE--AVDG-SIT 79

                  ....*
gi 1071373367 172 VTYQN 176
Cdd:pfam05257  80 VSEQN 84
TonB COG0810
Periplasmic protein TonB, links inner and outer membranes [Cell wall/membrane/envelope ...
421-579 2.92e-09

Periplasmic protein TonB, links inner and outer membranes [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 223880 [Multi-domain]  Cd Length: 244  Bit Score: 58.26  E-value: 2.92e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 421 PSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTvtasptpkptvtasptPKPTVT 500
Cdd:COG0810    24 VFLHQEDFVGIELVPLAVFLLAAKVLEAPTEEPQPEPEPPEEQPKPPTEPETPPEPTP----------------PKPKEK 87
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1071373367 501 ASPTPKPTVtasPTPKPtvtaSPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSP 579
Cdd:COG0810    88 PKPEKKPKK---PKPKP----KPKPKPKPKVKPQPKPKKPPSKTAAKAPAAPNQPARPPSAASASGAATGPSASYLSGL 159
PRK08581 PRK08581
N-acetylmuramoyl-L-alanine amidase; Validated
80-167 3.68e-07

N-acetylmuramoyl-L-alanine amidase; Validated


Pssm-ID: 236304 [Multi-domain]  Cd Length: 619  Bit Score: 53.64  E-value: 3.68e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  80 PFALCPG--PFPRGgNCVWWAWEQWHWLHYDLPLNWGNAADWISAAQRAGLAVGTQPRVGAIAVFPVadGVW-AYSSAGH 156
Cdd:PRK08581  498 PFREYSGssPYPHG-QCTWYVYNRMKQFGTSISGDLGDAHNWNNRAQARGYQVSHTPKRHAAVVFEA--GQAgADQHYGH 574
                          90
                  ....*....|.
gi 1071373367 157 VAFVTWVSPDG 167
Cdd:PRK08581  575 VAFVEKVNSDG 585
rad23 TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
505-591 6.72e-07

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273167 [Multi-domain]  Cd Length: 378  Bit Score: 52.20  E-value: 6.72e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 505 PKPTVTASPTPKPTVTASPTPKPTVTASPTPKptvtasPTPKPTATARPSVTPTVTPTAsPTVRPTATAGVTPSPTAgti 584
Cdd:TIGR00601  77 PKTGTGKVAPPAATPTSAPTPTPSPPASPASG------MSAAPASAVEEKSPSEESATA-TAPESPSTSVPSSGSDA--- 146

                  ....*..
gi 1071373367 585 TRALASG 591
Cdd:TIGR00601 147 ASTLVVG 153
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
415-605 1.22e-15

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 81.91  E-value: 1.22e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  415 TPTIPTPSLTPTPFPTMPGEPGVSPVPSLV-PTKTPAPSSTPKPTATASPTpKPTVTASPTPKPTVTASPTPKPTVTASP 493
Cdd:PHA03247  2621 THAPDPPPPSPSPAANEPDPHPPPTVPPPErPRDDPAPGRVSRPRRARRLG-RAAQASSPPQRPRRRAARPTVGSLTSLA 2699
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  494 TP-KPTVTASPTPKPTVTASPTPkPTVTASPTPKPTVTASPTPKPTVTASPTP-KPTATARPSVTPTVTPTASPTVRPTA 571
Cdd:PHA03247  2700 DPpPPPPTPEPAPHALVSATPLP-PGPAAARQASPALPAAPAPPAVPAGPATPgGPARPARPPTTAGPPAPAPPAAPAAG 2778
                          170       180       190
                   ....*....|....*....|....*....|....
gi 1071373367  572 TAGVTPSPTAGTITRALASGEAGPLAMPNGLALS 605
Cdd:PHA03247  2779 PPRRLTRPAVASLSESRESLPSPWDPADPPAAVL 2812
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
410-597 1.08e-14

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 78.42  E-value: 1.08e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 410 FANTLTPTIPTPSLTPTPFPTMPGEPGVsPVPSLVPTKTPAPSSTPKPTATA---SPTPKPTVT-ASPtpkptVTASPTP 485
Cdd:pfam05109 421 FSKAPESTTTSPTLNTTGFAAPNTTTGL-PSSTHVPTNLTAPASTGPTVSTAdvtSPTPAGTTSgASP-----VTPSPSP 494
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 486 KPTVTASPTPKPT--VTASPTPKPTVTaSPTPKPTvtaSPTPKPTVTASPTPKPTvTASPTPKPTATARPSVTPTVTPTA 563
Cdd:pfam05109 495 RDNGTESKAPDMTspTSAVTTPTPNAT-SPTPAVT---TPTPNATSPTLGKTSPT-SAVTTPTPNATSPTPAVTTPTPNA 569
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 1071373367 564 S-PTVRPTA--TAGVTPSPTAGTITralaSGEAGPLA 597
Cdd:pfam05109 570 TiPTLGKTSptSAVTTPTPNATSPT----VGETSPQA 602
PHA03247 PHA03247
large tegument protein UL36; Provisional
411-595 1.50e-14

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 78.44  E-value: 1.50e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  411 ANTLTPTIPTPSLTPTPFPTMPGEPgVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVT 490
Cdd:PHA03247  2696 TSLADPPPPPPTPEPAPHALVSATP-LPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAA 2774
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  491 ASPTPKPTVTASPTPKPTVTASPTPKPtvtasPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPT 570
Cdd:PHA03247  2775 PAAGPPRRLTRPAVASLSESRESLPSP-----WDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPS 2849
                          170       180
                   ....*....|....*....|....*
gi 1071373367  571 ATAGVTPSPtAGTITRALASGEAGP 595
Cdd:PHA03247  2850 LPLGGSVAP-GGDVRRRPPSRSPAA 2873
PHA03247 PHA03247
large tegument protein UL36; Provisional
416-591 2.26e-14

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 77.67  E-value: 2.26e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  416 PTIPTPSLTPTPFPTMPG-EPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTAS---PTPKPTVTASPTPKPTVTA 491
Cdd:PHA03247  2670 LGRAAQASSPPQRPRRRAaRPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPAAarqASPALPAAPAPPAVPAGPA 2749
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  492 SP-----TPKPTVTASPtPKPTVTASP--TPKPTVTASPTPKPTVTASPTPKPTvTASPTPKPTATARPSVTPTVTPtAS 564
Cdd:PHA03247  2750 TPggparPARPPTTAGP-PAPAPPAAPaaGPPRRLTRPAVASLSESRESLPSPW-DPADPPAAVLAPAAALPPAASP-AG 2826
                          170       180
                   ....*....|....*....|....*..
gi 1071373367  565 PTVRPTATAGVTPSPTAGTITRALASG 591
Cdd:PHA03247  2827 PLPPPTSAQPTAPPPPPGPPPPSLPLG 2853
PHA03247 PHA03247
large tegument protein UL36; Provisional
416-599 4.84e-14

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 76.90  E-value: 4.84e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  416 PTIPTPSLTPTP-------FPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTV--------- 479
Cdd:PHA03247  2776 AAGPPRRLTRPAvaslsesRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPppslplggs 2855
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  480 ------------TASPTPKPTVTASP----TPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASP 543
Cdd:PHA03247  2856 vapggdvrrrppSRSPAAKPAAPARPpvrrLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPP 2935
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 1071373367  544 TPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTAgtITRALASGEAGPLAMP 599
Cdd:PHA03247  2936 PPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPGRVA--VPRFRVPQPAPSREAP 2989
PHA03247 PHA03247
large tegument protein UL36; Provisional
419-591 8.75e-14

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 75.75  E-value: 8.75e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  419 PTPSLTPTPFPTMPGEPGVSPVPSlVPTKTPAPSSTPKPTA--------------TASPTPKPTVTASP----TPKPTVT 480
Cdd:PHA03247  2814 PAAALPPAASPAGPLPPPTSAQPT-APPPPPGPPPPSLPLGgsvapggdvrrrppSRSPAAKPAAPARPpvrrLARPAVS 2892
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  481 ASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVT 560
Cdd:PHA03247  2893 RSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPGRV 2972
                          170       180       190
                   ....*....|....*....|....*....|.
gi 1071373367  561 PTASPTVRPTATAGVTPSPTAGTITRALASG 591
Cdd:PHA03247  2973 AVPRFRVPQPAPSREAPASSTPPLTGHSLSR 3003
PHA03247 PHA03247
large tegument protein UL36; Provisional
416-599 1.16e-13

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 75.36  E-value: 1.16e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  416 PTIPTPSLTPTPF-PTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASP- 493
Cdd:PHA03247  2703 PPPPTPEPAPHALvSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRr 2782
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  494 TPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPS--VTPTVTPTAS------- 564
Cdd:PHA03247  2783 LTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPgpPPPSLPLGGSvapggdv 2862
                          170       180       190
                   ....*....|....*....|....*....|....*....
gi 1071373367  565 ---PTVRPTATAGVTPS-PTAGTITRALASGEAGPLAMP 599
Cdd:PHA03247  2863 rrrPPSRSPAAKPAAPArPPVRRLARPAVSRSTESFALP 2901
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
401-592 1.34e-13

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 74.95  E-value: 1.34e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 401 TTGLLLYNRFANTLT------PTIPTPSLT-PTPFPTMPGEPGVSPVPSLVP--TKTPAPSSTPKPTATASPTPKPTvta 471
Cdd:pfam05109 445 TTGLPSSTHVPTNLTapastgPTVSTADVTsPTPAGTTSGASPVTPSPSPRDngTESKAPDMTSPTSAVTTPTPNAT--- 521
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 472 SPTPKPTvtaSPTPKPTvtaSPTPKPTVTASPTPKPTVTASpTPKPTVTaSPTPKPTVTASPTPKPTvTASPTPKPTATA 551
Cdd:pfam05109 522 SPTPAVT---TPTPNAT---SPTLGKTSPTSAVTTPTPNAT-SPTPAVT-TPTPNATIPTLGKTSPT-SAVTTPTPNATS 592
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 1071373367 552 rPSVTPTvTPTASPTVRPTATAGVTPSPTA--GTITRALASGE 592
Cdd:pfam05109 593 -PTVGET-SPQANTTNHTLGGTSSTPVVTSppKNATSAVTTGQ 633
PHA03247 PHA03247
large tegument protein UL36; Provisional
409-604 1.50e-13

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 74.97  E-value: 1.50e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  409 RFANTLTPTIPTPSLTP--TPFPTMPGEPGVSPVPSlvptkTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPK 486
Cdd:PHA03247  2759 RPPTTAGPPAPAPPAAPaaGPPRRLTRPAVASLSES-----RESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTS 2833
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  487 PTVTASPTPKPTVTAS----------------PTPKPTVTASPTP-KPTVTASPTPKPTVTASPTPKPTVTASPTPKPTA 549
Cdd:PHA03247  2834 AQPTAPPPPPGPPPPSlplggsvapggdvrrrPPSRSPAAKPAAPaRPPVRRLARPAVSRSTESFALPPDQPERPPQPQA 2913
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1071373367  550 TARPSVTPTVTPTASPTVRPtATAGVTPSPTAGTITRALASGEAGPLAMPNGLAL 604
Cdd:PHA03247  2914 PPPPQPQPQPPPPPQPQPPP-PPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGAL 2967
PHA03247 PHA03247
large tegument protein UL36; Provisional
421-599 3.01e-13

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 74.20  E-value: 3.01e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  421 PSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASP--TPKPTVTASPTPKPTVTASPTPKPTVTASPT---P 495
Cdd:PHA03247  2733 PALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPaaGPPRRLTRPAVASLSESRESLPSPWDPADPPaavL 2812
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  496 KPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTV-----------TASPTPKPTATARPSVT----PTVT 560
Cdd:PHA03247  2813 APAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVapggdvrrrppSRSPAAKPAAPARPPVRrlarPAVS 2892
                          170       180       190
                   ....*....|....*....|....*....|....*....
gi 1071373367  561 PTASPTVRPTATAGVTPSPTAGTITRALASGEAGPLAMP 599
Cdd:PHA03247  2893 RSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQP 2931
PHA03269 PHA03269
envelope glycoprotein C; Provisional
402-552 3.96e-13

envelope glycoprotein C; Provisional


Pssm-ID: 165527  Cd Length: 566  Bit Score: 72.84  E-value: 3.96e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 402 TGLLLYNRFANTLTPTIPTPSLTPTPFPTMPGE-PGVSPVPSLVPTKTPAPSSTPKPTATASPTPK--PTVTASPTPKPT 478
Cdd:PHA03269    6 IILIITIACINLIIANLNTNIPIPELHTSAATQkPDPAPAPHQAASRAPDPAVAPTSAASRKPDLAqaPTPAASEKFDPA 85
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1071373367 479 VtaSPTPKPTVTASPTPKPTVTASPTPKPTVtaSPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATAR 552
Cdd:PHA03269   86 P--APHQAASRAPDPAVAPQLAAAPKPDAAE--AFTSAAQAHEAPADAGTSAASKKPDPAAHTQHSPPPFAYTR 155
COG3942 COG3942
Surface antigen [Cell wall/membrane/envelope biogenesis];
49-208 5.49e-13

Surface antigen [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 226451  Cd Length: 173  Bit Score: 67.87  E-value: 5.49e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  49 NLLQANAQGLGYTASTLNSSCDQLSFSADGNPFAlcpgpfprGGNCVWWAWEQWHWLHYDLPLNWGNAADWISAAQRAGL 128
Cdd:COG3942    36 APKYGSVLSFAPTAAMYLGKVYSVSSVDASNTYY--------VGQCTWYVANRRGQAGGYVGPTWGNAGDWAYSAAAAGY 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 129 AVGTQPRVGAIAVFPVAdgvwAYssaGHVAFVTWVSPDGdTFNVTYQNYGDPtpvhlgigYQVSVINQPRYQHGQLRFIY 208
Cdd:COG3942   108 QVNVTPTVGAIAQSADG----GY---GHVAYVESVNSDG-SILISEMNAAGT--------GKISSRTISAQQADSYDYIH 171
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
411-596 6.27e-13

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 72.64  E-value: 6.27e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 411 ANTLTPTIPTPSLTPTPFpTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVT 490
Cdd:pfam05109 441 APNTTTGLPSSTHVPTNL-TAPASTGPTVSTADVTSPTPAGTTSGASPVTPSPSPRDNGTESKAPDMTSPTSAVTTPTPN 519
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 491 ASpTPKPTVTaSPTPKPTVTASPTPKPTvTASPTPKPTVTaSPTPKPTvtaSPTPKPTATARPSVTPTVTPTaSPTVRPT 570
Cdd:pfam05109 520 AT-SPTPAVT-TPTPNATSPTLGKTSPT-SAVTTPTPNAT-SPTPAVT---TPTPNATIPTLGKTSPTSAVT-TPTPNAT 591
                         170       180
                  ....*....|....*....|....*.
gi 1071373367 571 ATAGVTPSPTAGTITRALASGEAGPL 596
Cdd:pfam05109 592 SPTVGETSPQANTTNHTLGGTSSTPV 617
PHA03269 PHA03269
envelope glycoprotein C; Provisional
445-583 6.89e-13

envelope glycoprotein C; Provisional


Pssm-ID: 165527  Cd Length: 566  Bit Score: 72.07  E-value: 6.89e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 445 PTKTPAPS-STPKPTATASPTPKPTVTASPTPKPTVTasptpkPTVTASPTPKPTVtaSPTPKPTVTASPTPKPTVTAS- 522
Cdd:PHA03269   23 NTNIPIPElHTSAATQKPDPAPAPHQAASRAPDPAVA------PTSAASRKPDLAQ--APTPAASEKFDPAPAPHQAASr 94
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1071373367 523 ---PTPKPTVTASPTPKPTVtaSPTPKPTATARPSVTPTVTPTASPTvrPTATAGVTPSPTAGT 583
Cdd:PHA03269   95 apdPAVAPQLAAAPKPDAAE--AFTSAAQAHEAPADAGTSAASKKPD--PAAHTQHSPPPFAYT 154
PHA03247 PHA03247
large tegument protein UL36; Provisional
425-605 1.08e-12

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 72.28  E-value: 1.08e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  425 PTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPK--PTVTASPTPKPTVTASPTPKPTVTAS 502
Cdd:PHA03247  2609 RGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRvsRPRRARRLGRAAQASSPPQRPRRRAA 2688
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  503 PTPKPTVTASPTP-KPTVTASPTPKPTVTASPTPkPTVTASPTPKPTATARPSVTPTVTPTASP-TVRPTATAGVTPSPT 580
Cdd:PHA03247  2689 RPTVGSLTSLADPpPPPPTPEPAPHALVSATPLP-PGPAAARQASPALPAAPAPPAVPAGPATPgGPARPARPPTTAGPP 2767
                          170       180
                   ....*....|....*....|....*
gi 1071373367  581 AGTITRALASGEAGPLAMPNGLALS 605
Cdd:PHA03247  2768 APAPPAAPAAGPPRRLTRPAVASLS 2792
PHA03247 PHA03247
large tegument protein UL36; Provisional
419-628 1.31e-12

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 71.89  E-value: 1.31e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  419 PTPSLTPTPFPTMPGEPGVSPVPSLVPTK-----------TPAPSSTPK--------PTATASPTPKPTVTASPTPKP-- 477
Cdd:PHA03247  2551 PPPPLPPAAPPAAPDRSVPPPRPAPRPSEpavtsrarrpdAPPQSARPRapvddrgdPRGPAPPSPLPPDTHAPDPPPps 2630
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  478 ------------TVTASPTPKPTVTASPT-----------PKPTVTASPTPKPTVTASPTPKPTVTASPTP-KPTVTASP 533
Cdd:PHA03247  2631 pspaanepdphpPPTVPPPERPRDDPAPGrvsrprrarrlGRAAQASSPPQRPRRRAARPTVGSLTSLADPpPPPPTPEP 2710
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  534 TPKPTVTASPTPKPTATARPSVTPtvtPTASPTVRPTATAGVTPSPTAGTITRALASGEAGPlAMPNGLALSLNPGDGGG 613
Cdd:PHA03247  2711 APHALVSATPLPPGPAAARQASPA---LPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAP-APPAAPAAGPPRRLTRP 2786
                          250
                   ....*....|....*
gi 1071373367  614 KDLGGAQSSQAQLRP 628
Cdd:PHA03247  2787 AVASLSESRESLPSP 2801
CHAP pfam05257
CHAP domain; This domain corresponds to an amidase function. Many of these proteins are ...
92-176 1.52e-12

CHAP domain; This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.


Pssm-ID: 336080  Cd Length: 84  Bit Score: 63.59  E-value: 1.52e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  92 GNCVWWAWEQWHWLHYDLPlNWGNAADWISAAQRAGLAVGTQPRVGAIAVFPvADGVWAYssaGHVAFVTwvSPDGdTFN 171
Cdd:pfam05257   8 GQCTWFVYWRVAQLGGPIP-GLGNAGDWADNAAGAYKVGSTTPKVGDIVVFD-PGGGGPY---GHVAIVE--AVDG-SIT 79

                  ....*
gi 1071373367 172 VTYQN 176
Cdd:pfam05257  80 VSEQN 84
GGN pfam15685
Gametogenetin; GGN is a family of proteins largely found in mammals. It reacts with POG in the ...
396-597 1.61e-12

Gametogenetin; GGN is a family of proteins largely found in mammals. It reacts with POG in the maturation of sperm and is expressed virtually only in the testis. It is found to be associated with the intracellular membrane, binds with GGNBP1 and may be involved in vesicular trafficking.


Pssm-ID: 317988 [Multi-domain]  Cd Length: 648  Bit Score: 71.23  E-value: 1.61e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 396 RFNGQTTGLLLYNRFANTLT-----PTIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVT 470
Cdd:pfam15685 366 RFNGAGGGVGAPRRRAAALSgpwgsPPPPPGQKHPAPGPRRPAPALLAPPMFIFPAPTNGEPVRPGPPGQQELPPMPPPV 445
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 471 ASPTPKPTVTaSPTPKPtVTASPTPKPTVTASPTPKPtvtASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTAT 550
Cdd:pfam15685 446 PPPTPQPPAL-QPTPLP-VAPPPTPGPGHAESALAPP---PAPALPPALAADQTPAPAPAPSPAPAPTTAEPLPPAPAPT 520
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 1071373367 551 ARPSVTPTVTPTASPTVRPTATAGVTP-SPTAGTITRALASGEAGPLA 597
Cdd:pfam15685 521 KTRTRRNKGSRAARGATREDGLPGDGPrERATATVTDSGGGGSGAAQA 568
PHA03378 PHA03378
EBNA-3B; Provisional
416-595 9.28e-12

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 68.94  E-value: 9.28e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 416 PTIPTPSLTPTPFPTmPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTvTASPTPKPTVTASPTPKPTVTASPTP 495
Cdd:PHA03378  646 LVFPTPHQPPQVEIT-PYKPTWTQIGHIPYQPSPTGANTMLPIQWAPGTMQPP-PRAPTPMRPPAAPPGRAQRPAAATGR 723
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 496 KPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASP---TPKPTATARPsvTPTVTPTASPTVRPTAT 572
Cdd:PHA03378  724 ARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPgapTPQPPPQAPP--APQQRPRGAPTPQPPPQ 801
                         170       180
                  ....*....|....*....|...
gi 1071373367 573 AGvtpsPTAGTITRALASGEAGP 595
Cdd:PHA03378  802 AG----PTSMQLMPRAAPGQQGP 820
PHA03378 PHA03378
EBNA-3B; Provisional
386-583 1.17e-11

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 68.56  E-value: 1.17e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 386 WGPGWEIYTGRFNGQTTGLLLYNRfantlTPTIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKptatASPTP 465
Cdd:PHA03378  653 QPPQVEITPYKPTWTQIGHIPYQP-----SPTGANTMLPIQWAPGTMQPPPRAPTPMRPPAAPPGRAQRPA----AATGR 723
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 466 KPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASP---TPKPTVTASPTPKPTVTASPTPKPTVTAS 542
Cdd:PHA03378  724 ARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPgapTPQPPPQAPPAPQQRPRGAPTPQPPPQAG 803
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 1071373367 543 PT------PKPTATARPS--VTPTVTPTASPTVRPT----------ATAGVTPSPTAGT 583
Cdd:PHA03378  804 PTsmqlmpRAAPGQQGPTkqILRQLLTGGVKRGRPSlkkpaalerqAAAGPTPSPGSGT 862
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
415-582 1.24e-11

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 335243 [Multi-domain]  Cd Length: 980  Bit Score: 68.51  E-value: 1.24e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 415 TPTIPTP-------------SLTPTPFPTMPGEPGVSPVPSL----VPTKTPAPSSTPKPTATASPTPKPTVTASPTPKP 477
Cdd:pfam03154 146 SPSIPSPqdnesdsdssaqqQILQTQPPVLQCQNGVPSPPPGpqtqVATPAPTPSAPSLPSQVSPPTTQPPLQPLPVASP 225
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 478 TVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPT--PKPTVTA------SPTPKPTA 549
Cdd:pfam03154 226 HTLIQQTPTLHPQRLPSPHPPLQPMPDPPSQVSPQSAPQPGLHGPMPPMPHSLQGPShlPHPGPPQpfgqgqVPPPPSLQ 305
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 1071373367 550 TARPSVTPTVTP--TASPTVRPTATAGVTPSPTAG 582
Cdd:pfam03154 306 APHPSQLQHTPPsqSQGPSPQPPREQPLPPAPLSM 340
PHA03247 PHA03247
large tegument protein UL36; Provisional
413-598 1.57e-11

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 68.43  E-value: 1.57e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  413 TLTPTIPTPSLTPTPfPTMPGEPGVSP-------VPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTP 485
Cdd:PHA03247  2833 SAQPTAPPPPPGPPP-PSLPLGGSVAPggdvrrrPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQP 2911
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  486 KPTVTASPTPKPTVTASPTPKPtvtaSPTPKPTVTASPTPKPTVTASPTPkptVTASPTPKPTATARPSVTPTVTPTASP 565
Cdd:PHA03247  2912 QAPPPPQPQPQPPPPPQPQPPP----PPPPRPQPPLAPTTDPAGAGEPSG---AVPQPWLGALVPGRVAVPRFRVPQPAP 2984
                          170       180       190
                   ....*....|....*....|....*....|...
gi 1071373367  566 TVRptATAGVTPSPTAGTITRalASGEAGPLAM 598
Cdd:PHA03247  2985 SRE--APASSTPPLTGHSLSR--VSSWASSLAL 3013
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
427-608 2.22e-11

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 67.57  E-value: 2.22e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 427 PFPTMPGEPGvSPVPSLVPTKTPAPSSTPKPTATASPTPkptvtASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPK 506
Cdd:PRK07003  360 PAVTGGGAPG-GGVPARVAGAVPAPGARAAAAVGASAVP-----AVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPP 433
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 507 PT--VTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTAGTI 584
Cdd:PRK07003  434 ATadRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARAP 513
                         170       180
                  ....*....|....*....|....
gi 1071373367 585 TRALASGEAGPLAMPNGLALSLNP 608
Cdd:PRK07003  514 AAASREDAPAAAAPPAPEARPPTP 537
PARM pfam17061
PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present ...
416-569 3.45e-11

PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present in most tissues, with high levels in the heart, kidney and placenta. It has been shown to be induced and expressed in prostate after castration and may have a role in cell proliferation and immortalisation in prostate cancer.


Pssm-ID: 319112 [Multi-domain]  Cd Length: 296  Bit Score: 64.86  E-value: 3.45e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 416 PTIPTPSL-TPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPK----PTATASPTPKPTVTASPTPkptvTASPTPKPTvt 490
Cdd:pfam17061  76 PTSPASNWeGTNTDPSPPGLSPTSGGVHLTPTPEEHSSGTPEasvpATGSQSPAESPTLTSPQAP----ASSPSSLST-- 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 491 aSPTPKPTVTASPTPKPTVTAS-PTPKPTVTASPTPKPTVTASPTPKPTVTASPTPK-PTATARPSVTPTVTPTASPTVR 568
Cdd:pfam17061 150 -SPPEVSSASVTTNHSSTETSTqPTGAPTTPESPTEEHSSGHTPTSHATSEPVPTETtPQTTVPAKVTCELIDTETTTTS 228

                  .
gi 1071373367 569 P 569
Cdd:pfam17061 229 P 229
PARM pfam17061
PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present ...
412-591 5.60e-11

PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present in most tissues, with high levels in the heart, kidney and placenta. It has been shown to be induced and expressed in prostate after castration and may have a role in cell proliferation and immortalisation in prostate cancer.


Pssm-ID: 319112 [Multi-domain]  Cd Length: 296  Bit Score: 64.47  E-value: 5.60e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 412 NTLTPTIPTPSLTPTP---FPTMPGEPGVSPvPSLVPTKTPAPSSTPKPTATASP---TPKPTVTASPTPKPTV--TASP 483
Cdd:pfam17061  48 NNSVLPVTASAPTSPLpknISVEPREEEPTS-PASNWEGTNTDPSPPGLSPTSGGvhlTPTPEEHSSGTPEASVpaTGSQ 126
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 484 TPK--PTVTASPTPK---PTVTASPTPKPTVTASPTPKPTVTAS-PTPKPTVTASPTPKPTvtASPTPKPTATARPSVTP 557
Cdd:pfam17061 127 SPAesPTLTSPQAPAsspSSLSTSPPEVSSASVTTNHSSTETSTqPTGAPTTPESPTEEHS--SGHTPTSHATSEPVPTE 204
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1071373367 558 TVTPTASPT-----VRPTATAGVTPSPTAGTITRALASG 591
Cdd:pfam17061 205 TTPQTTVPAkvtceLIDTETTTTSPRVIMQEVEHALSSG 243
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
422-577 5.99e-11

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 65.99  E-value: 5.99e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 422 SLTPTPFPTMPGEPGVspVPSLVptkTPAPSSTPKPTATASPTPK-PTVTASPTPKPTVTASPTPKPTVTASPTPkPTVT 500
Cdd:PRK14950  340 QLRTTSYGQLPLELAV--IEALL---VPVPAPQPAKPTAAAPSPVrPTPAPSTRPKAAAAANIPPKEPVRETATP-PPVP 413
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 501 ASPTPKPTVTASPT-PKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATAR-----PSVTPTVtPTASPTVRPTATAG 574
Cdd:PRK14950  414 PRPVAPPVPHTPESaPKLTRAAIPVDEKPKYTPPAPPKEEEKALIADGDVLEQleaiwKQILRDV-PPRSPAVQALLSSG 492

                  ...
gi 1071373367 575 VTP 577
Cdd:PRK14950  493 VRP 495
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
419-589 6.09e-11

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 66.05  E-value: 6.09e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 419 PTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSStpkPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPT 498
Cdd:PRK12323  428 PAPEALAAARQASARGPGGAPAPAPAPAAAPAAAA---RPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPP 504
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 499 VTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTvTPTASPTVRPTATAGVTPS 578
Cdd:PRK12323  505 EFASPAPAQPDAAPAGWVAESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPR-PPRASASGLPDMFDGDWPA 583
                         170
                  ....*....|.
gi 1071373367 579 PTAGTITRALA 589
Cdd:PRK12323  584 LAARLPVRGLA 594
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
411-629 1.34e-10

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 64.56  E-value: 1.34e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 411 ANTLTPTIPTPSL---TPTPFPTmPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVT---------------AS 472
Cdd:PLN03209  307 AETTAPLTPMEELlakIPSQRVP-PKESDAADGPKPVPTKPVTPEAPSPPIEEEPPQPKAVVPrplspytayedlkppTS 385
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 473 PTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTAS-PTPKPTVTASP-TP-------KPTVTASPTPKPTVTASP 543
Cdd:PLN03209  386 PIPTPPSSSPASSKSVDAVAKPAEPDVVPSPGSASNVPEVePAQVEAKKTRPlSPyaryedlKPPTSPSPTAPTGVSPSV 465
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 544 TPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTAGTITRALASGEAGPLAMPNGLALSLNPGDGGGKDLGGAQSSQ 623
Cdd:PLN03209  466 SSTSSVPAVPDTAPATAATDAAAPPPANMRPLSPYAVYDDLKPPTSPSPAAPVGKVAPSSTNEVVKVGNSAPPTALADEQ 545

                  ....*.
gi 1071373367 624 AQLRPN 629
Cdd:PLN03209  546 HHAQPK 551
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
411-581 1.62e-10

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 335243 [Multi-domain]  Cd Length: 980  Bit Score: 65.04  E-value: 1.62e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 411 ANTLTPTIPTPSLTPTPFPTMPGEPgVSPVPSLVPTKTpaPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVT 490
Cdd:pfam03154 192 VATPAPTPSAPSLPSQVSPPTTQPP-LQPLPVASPHTL--IQQTPTLHPQRLPSPHPPLQPMPDPPSQVSPQSAPQPGLH 268
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 491 ASPTPKPTVTASPTPKPtvtaSPTPKPTVTASPTPKPTVTASPTPKPTVTASPT----PKPTATARPSVTPtvTPTASPT 566
Cdd:pfam03154 269 GPMPPMPHSLQGPSHLP----HPGPPQPFGQGQVPPPPSLQAPHPSQLQHTPPSqsqgPSPQPPREQPLPP--APLSMPH 342
                         170
                  ....*....|....*
gi 1071373367 567 VRPTATAGVTPSPTA 581
Cdd:pfam03154 343 IKPPPTTPIPQLPNP 357
PRK10905 PRK10905
cell division protein DamX; Validated
430-542 2.16e-10

cell division protein DamX; Validated


Pssm-ID: 236792 [Multi-domain]  Cd Length: 328  Bit Score: 63.03  E-value: 2.16e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 430 TMPGEPG-VSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPtpKPTVTASPTPKPTVTASPTPKPTVTASPTPKPT 508
Cdd:PRK10905  122 TLPTEPAtVAPVRNGNASRQTAKTQTAERPATTRPARKQAVIEPK--KPQATAKTEPKPVAQTPKRTEPAAPVASTKAPA 199
                          90       100       110
                  ....*....|....*....|....*....|....
gi 1071373367 509 VTASPTPKPTVTASPTPKPTVTASPTPKPTVTAS 542
Cdd:PRK10905  200 ATSTPAPKETATTAPVQTASPAQTTATPAAGGKT 233
PARM pfam17061
PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present ...
413-583 2.22e-10

PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present in most tissues, with high levels in the heart, kidney and placenta. It has been shown to be induced and expressed in prostate after castration and may have a role in cell proliferation and immortalisation in prostate cancer.


Pssm-ID: 319112 [Multi-domain]  Cd Length: 296  Bit Score: 62.55  E-value: 2.22e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 413 TLTPTIPTPSLTPTPFPTMPgePGVSPVPSLVPTKTPAPSST-PKPTATASPTPKPTVTASPTPKPTVTASP-------- 483
Cdd:pfam17061  23 PPTATWTSSPQNTAAVTASP--TSGTHNNSVLPVTASAPTSPlPKNISVEPREEEPTSPASNWEGTNTDPSPpglsptsg 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 484 ----TPKPTVTASPTPKPTV--TASPTPK--PTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSV 555
Cdd:pfam17061 101 gvhlTPTPEEHSSGTPEASVpaTGSQSPAesPTLTSPQAPASSPSSLSTSPPEVSSASVTTNHSSTETSTQPTGAPTTPE 180
                         170       180
                  ....*....|....*....|....*...
gi 1071373367 556 TPTVTPTASPTvrPTATAGVTPSPTAGT 583
Cdd:pfam17061 181 SPTEEHSSGHT--PTSHATSEPVPTETT 206
PRK10819 PRK10819
transport protein TonB; Provisional
405-551 3.02e-10

transport protein TonB; Provisional


Pssm-ID: 236768 [Multi-domain]  Cd Length: 246  Bit Score: 61.24  E-value: 3.02e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 405 LLYNRFANTLT-PTIPTP-SLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPtatasPTPKPTVTASPTPKPTVTAS 482
Cdd:PRK10819   30 LLYTSVHQVIElPAPAQPiSVTMVAPADLEPPQAVQPPPEPVVEPEPEPEPIPEP-----PKEAPVVIPKPEPKPKPKPK 104
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1071373367 483 PTPKPTVTASPTPKPTV-TASPTPKPTVTASPTPKPTVTASPT--PKPTVTASPTPKPTVTASPTPKPTATA 551
Cdd:PRK10819  105 PKPKPVKKVEEQPKREVkPVEPRPASPFENTAPARPTSSTATAaaSKPVTSVSSGPRALSRNQPQYPARAQA 176
PRK10819 PRK10819
transport protein TonB; Provisional
449-554 3.02e-10

transport protein TonB; Provisional


Pssm-ID: 236768 [Multi-domain]  Cd Length: 246  Bit Score: 61.24  E-value: 3.02e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 449 PAPSSTPKPTATASPTPKPTVTASP-TPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTV-TASPTPKPTVTASPTPK 526
Cdd:PRK10819   60 PPQAVQPPPEPVVEPEPEPEPIPEPpKEAPVVIPKPEPKPKPKPKPKPKPVKKVEEQPKREVkPVEPRPASPFENTAPAR 139
                          90       100       110
                  ....*....|....*....|....*....|
gi 1071373367 527 PTVTASPT--PKPTVTASPTPKPTATARPS 554
Cdd:PRK10819  140 PTSSTATAaaSKPVTSVSSGPRALSRNQPQ 169
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
417-595 4.55e-10

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 63.40  E-value: 4.55e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 417 TIPTPSLT-PTPFPTMPGEPGVSPvpSLVPTKTPAPSSTPKPTATaSPTPKPTvtaSPTPKPTVTASPTPKPTvTASPTP 495
Cdd:pfam05109 514 TTPTPNATsPTPAVTTPTPNATSP--TLGKTSPTSAVTTPTPNAT-SPTPAVT---TPTPNATIPTLGKTSPT-SAVTTP 586
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 496 KPTVTaSPTPKPTVTASPTPKPT--------VTASPtPKPTVTASPTPKPTVTASPTpkPTATARP-SVTPTVTPTAS-- 564
Cdd:pfam05109 587 TPNAT-SPTVGETSPQANTTNHTlggtsstpVVTSP-PKNATSAVTTGQHNITSSST--SSMSLRPsSISETLSPSTSdn 662
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1071373367 565 --------PTVRPTATAGVTPSPTAGTITRALASGEAGP 595
Cdd:pfam05109 663 stshmpllTSAHPTGGENITQVTPASTSTHHVSTSSPAP 701
PHA03269 PHA03269
envelope glycoprotein C; Provisional
473-585 6.11e-10

envelope glycoprotein C; Provisional


Pssm-ID: 165527  Cd Length: 566  Bit Score: 62.44  E-value: 6.11e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 473 PTPKPTvTASPTPKPTVTASPTPKPTVTASPTPKPTV--TASPTPKPTVTASPTPKPTVTASPTPKPTVTAS----PTPK 546
Cdd:PHA03269   23 NTNIPI-PELHTSAATQKPDPAPAPHQAASRAPDPAVapTSAASRKPDLAQAPTPAASEKFDPAPAPHQAASrapdPAVA 101
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 1071373367 547 PTATARPSVTPTVTPTASPT------VRPTATAGVTPSPTAGTIT 585
Cdd:PHA03269  102 PQLAAAPKPDAAEAFTSAAQaheapaDAGTSAASKKPDPAAHTQH 146
BASP1 pfam05466
Brain acid soluble protein 1 (BASP1 protein); This family consists of several brain acid ...
445-581 6.88e-10

Brain acid soluble protein 1 (BASP1 protein); This family consists of several brain acid soluble protein 1 (BASP1) or neuronal axonal membrane protein NAP-22. The BASP1 is a neuron enriched Ca(2+)-dependent calmodulin-binding protein of unknown function.


Pssm-ID: 310221 [Multi-domain]  Cd Length: 238  Bit Score: 59.99  E-value: 6.88e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 445 PTKTPAPSSTP-KPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTAS-PTPKPTVT-----------A 511
Cdd:pfam05466  80 AAKEEAPKAEPeKPEAAAEGKAEPPKSAEQEEEPAAAPAPAAAGEAPKASEPSGEAKASqPSEAPAASkvdekskeegeA 159
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1071373367 512 SPTPKPTVTASPTPKPTVTASPTPKPTVT-ASPTPKPTATARPSvtPTVTPTASPTVRPTATAGVTPSPTA 581
Cdd:pfam05466 160 KKTEAPAAPAAQETKSEAAPASDSKPSSSeAAPSSKETPAATEA--PSSTPKASEPAAPAEEAKPSEAPAA 228
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
429-607 7.37e-10

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 62.56  E-value: 7.37e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 429 PTMPGE-PGVSPVPSLVPTKTPAPSSTPKPTATAS-PTPKPTVTASPTPKPTVTASPTPKPT--VTASPTPKPTVTASPT 504
Cdd:PRK07003  374 ARVAGAvPAPGARAAAAVGASAVPAVTAVTGAAGAaLAPKAAAAAAATRAEAPPAAPAPPATadRGDDAADGDAPVPAKA 453
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 505 PKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPkPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTAgTI 584
Cdd:PRK07003  454 NARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAP-RAAAPSAATPAAVPDARAPAAASREDAPAAAAPPA-PE 531
                         170       180
                  ....*....|....*....|...
gi 1071373367 585 TRALASGEAGPLAMPNGLALSLN 607
Cdd:PRK07003  532 ARPPTPAAAAPAARAGGAAAALD 554
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
434-565 8.44e-10

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 62.31  E-value: 8.44e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 434 EPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPkptvtASPTPKPTVTASP 513
Cdd:PRK07764  382 ERRLGVAGGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPS-----PAGNAPAGGAPSP 456
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1071373367 514 TPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASP 565
Cdd:PRK07764  457 PPAAAPSAQPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAGADD 508
PHA03378 PHA03378
EBNA-3B; Provisional
417-586 8.77e-10

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 62.39  E-value: 8.77e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 417 TIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPT--ATASPTPKPTVTASPTPKPTVTASPTPKPTVTASP- 493
Cdd:PHA03378  693 TMQPPPRAPTPMRPPAAPPGRAQRPAAATGRARPPAAAPGRArpPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPg 772
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 494 --TPKPTVTASPTPKPTVTASPTPKPTVTASPT------PKPTVTASPTP--------------KPTV----------TA 541
Cdd:PHA03378  773 apTPQPPPQAPPAPQQRPRGAPTPQPPPQAGPTsmqlmpRAAPGQQGPTKqilrqlltggvkrgRPSLkkpaalerqaAA 852
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1071373367 542 SPTPKPTATAR-----------PSVTPTVTPTASPTVRPTATAGVTPSPTAGTITR 586
Cdd:PHA03378  853 GPTPSPGSGTSdkivqapvfypPVLQPIQVMRQLGSVRAAAASTVTQAPTEYTGER 908
Rib_recp_KP_reg pfam05104
Ribosome receptor lysine/proline rich region; This highly conserved region is found towards ...
418-545 8.86e-10

Ribosome receptor lysine/proline rich region; This highly conserved region is found towards the C-terminus of the transmembrane domain. The function is unclear.


Pssm-ID: 309995 [Multi-domain]  Cd Length: 162  Bit Score: 58.09  E-value: 8.86e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 418 IPTPSLTPTPFPTmpgepgVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKP 497
Cdd:pfam05104  51 IPESESTQEPAEA------SEPYVEVVPEAPPAPPPPAKPAPVPEPVPPPKKSKPPSVKPAAVAKAPAPVLAQAAPPQAK 124
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 1071373367 498 tvtASPTPKPTvtaSPTPKPTVTASPTPkptvTASPTPKPTVTASPTP 545
Cdd:pfam05104 125 ---PAPSPKDK---KKPEKKVAKVEPAP----TKGKPPISSQKAAPLP 162
TonB_N pfam16031
TonB N-terminal region; TonB_N is a short domain found just downstream of the ...
448-567 1.07e-09

TonB N-terminal region; TonB_N is a short domain found just downstream of the cytoplasmic-membrane anchor at the N-terminus of TonB proteins. The exact function is not known.


Pssm-ID: 339583 [Multi-domain]  Cd Length: 133  Bit Score: 57.25  E-value: 1.07e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 448 TPAPSSTPKPTAtASPTPKPTVTASPTPKPTVTASPTPkPTVTASPTPKPTVTASPTPKPtVTASPTPKPTVtasptpKP 527
Cdd:pfam16031  19 APADLEPPQPAP-AAPQPPPEPVVEPEPEPEPEPVPEP-PAPVVIEKPKPVPKPKPKPKP-VKKVEVPKREV------KP 89
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 1071373367 528 TvtaspTPKPtvtASP--TPKPTATARPSVTPTVTPTASPTV 567
Cdd:pfam16031  90 V-----EPRP---ASPfeNDPPTTPARPTTAPATAATAAPSV 123
BASP1 pfam05466
Brain acid soluble protein 1 (BASP1 protein); This family consists of several brain acid ...
434-558 1.10e-09

Brain acid soluble protein 1 (BASP1 protein); This family consists of several brain acid soluble protein 1 (BASP1) or neuronal axonal membrane protein NAP-22. The BASP1 is a neuron enriched Ca(2+)-dependent calmodulin-binding protein of unknown function.


Pssm-ID: 310221 [Multi-domain]  Cd Length: 238  Bit Score: 59.60  E-value: 1.10e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 434 EPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASP 513
Cdd:pfam05466 102 EPPKSAEQEEEPAAAPAPAAAGEAPKASEPSGEAKASQPSEAPAASKVDEKSKEEGEAKKTEAPAAPAAQETKSEAAPAS 181
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 1071373367 514 TPKPTVT-ASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPT 558
Cdd:pfam05466 182 DSKPSSSeAAPSSKETPAATEAPSSTPKASEPAAPAEEAKPSEAPA 227
BASP1 pfam05466
Brain acid soluble protein 1 (BASP1 protein); This family consists of several brain acid ...
429-576 1.15e-09

Brain acid soluble protein 1 (BASP1 protein); This family consists of several brain acid soluble protein 1 (BASP1) or neuronal axonal membrane protein NAP-22. The BASP1 is a neuron enriched Ca(2+)-dependent calmodulin-binding protein of unknown function.


Pssm-ID: 310221 [Multi-domain]  Cd Length: 238  Bit Score: 59.60  E-value: 1.15e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 429 PTMPGEPGVSPVPSLVPTKTPAPSSTPkptATASPTPKptvTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPT 508
Cdd:pfam05466  93 PEAAAEGKAEPPKSAEQEEEPAAAPAP---AAAGEAPK---ASEPSGEAKASQPSEAPAASKVDEKSKEEGEAKKTEAPA 166
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1071373367 509 VTASPTPKPTVTASPTPKPTVT-ASPTPKPTVTASPTPKPTATARPSVTPtvTPTASPTVRPTATAGVT 576
Cdd:pfam05466 167 APAAQETKSEAAPASDSKPSSSeAAPSSKETPAATEAPSSTPKASEPAAP--AEEAKPSEAPAANSDQT 233
PRK11633 PRK11633
cell division protein DedD; Provisional
429-551 1.46e-09

cell division protein DedD; Provisional


Pssm-ID: 236940 [Multi-domain]  Cd Length: 226  Bit Score: 58.86  E-value: 1.46e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 429 PTMPgEPGVSPVPSLVPTKTPAPSSTPKPTAT----ASPTPKPTVTASPTPKPTVTASPTPKPTvtasPTPKPTVTASPT 504
Cdd:PRK11633   42 PLVP-KPGDRDEPDMMPAATQALPTQPPEGAAeavrAGDAAAPSLDPATVAPPNTPVEPEPAPV----EPPKPKPVEKPK 116
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 1071373367 505 PKptvtasPTPKPTVTASPTPKptvtasPTPKPtvTASPTPKPTATA 551
Cdd:PRK11633  117 PK------PKPQQKVEAPPAPK------PEPKP--VVEEKAAPTGKA 149
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
415-605 1.46e-09

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 61.43  E-value: 1.46e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 415 TPTIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPT-----ATASPTPKPTVTASPTPKPTVTASPTPKPTV 489
Cdd:PRK12323  373 GPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAAravaaAPARRSPAPEALAAARQASARGPGGAPAPAP 452
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 490 TASPTPKPTV---TASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPT 566
Cdd:PRK12323  453 APAAAPAAAArpaAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDPATA 532
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1071373367 567 VRPTATAGVTPSPTAGTITRALASGEAGPLAMPNGLALS 605
Cdd:PRK12323  533 DPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASAS 571
PARM pfam17061
PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present ...
439-583 1.51e-09

PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present in most tissues, with high levels in the heart, kidney and placenta. It has been shown to be induced and expressed in prostate after castration and may have a role in cell proliferation and immortalisation in prostate cancer.


Pssm-ID: 319112 [Multi-domain]  Cd Length: 296  Bit Score: 59.85  E-value: 1.51e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 439 PVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPT 518
Cdd:pfam17061   8 PTSAPLPVSLPAKITPPTATWTSSPQNTAAVTASPTSGTHNNSVLPVTASAPTSPLPKNISVEPREEEPTSPASNWEGTN 87
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1071373367 519 VTASPtPKPTVTASP---TPKPTVTASPTPK----PTATARPSVTPTVT----PTASPTVRPTaTAGVTPSPTAGT 583
Cdd:pfam17061  88 TDPSP-PGLSPTSGGvhlTPTPEEHSSGTPEasvpATGSQSPAESPTLTspqaPASSPSSLST-SPPEVSSASVTT 161
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
422-581 1.82e-09

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 61.73  E-value: 1.82e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  422 SLTPTPFPTMPGEPGVSPVP-SLVPTKTPAPSSTPKPTATASPTPKPtvtaSPTPKPTVTASPTPKPTVTASPTPKPtVT 500
Cdd:PHA03307    58 GAAACDRFEPPTGPPPGPGTeAPANESRSTPTWSLSTLAPASPAREG----SPTPPGPSSPDPPPPTPPPASPPPSP-AP 132
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  501 ASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVT-PTASPTVRPTATAGVTPSP 579
Cdd:PHA03307   133 DLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRQAALPLSSPEETARAPSSPPAEpPPSTPPAAASPRPPRRSSP 212

                   ..
gi 1071373367  580 TA 581
Cdd:PHA03307   213 IS 214
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
413-599 2.08e-09

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 61.09  E-value: 2.08e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 413 TLTP--TIPTPSLT-PTPFPTMPGEPGVSPVPSLVptkTPAPSSTPKPTATASPTPKPTV---------TASPTPKPTVT 480
Cdd:pfam05109 515 TPTPnaTSPTPAVTtPTPNATSPTLGKTSPTSAVT---TPTPNATSPTPAVTTPTPNATIptlgktsptSAVTTPTPNAT 591
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 481 ASPTPKPTVTASPTPKPTVTASPTPkptVTASPtPKPTVTASPTPKPTVTASPTPKPTV-------TASPTPKPTATARP 553
Cdd:pfam05109 592 SPTVGETSPQANTTNHTLGGTSSTP---VVTSP-PKNATSAVTTGQHNITSSSTSSMSLrpssiseTLSPSTSDNSTSHM 667
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1071373367 554 SVTPTVTPTASPT---VRPTAT-----AGVTPSPTAGTITRALASGEAGPLAMP 599
Cdd:pfam05109 668 PLLTSAHPTGGENitqVTPASTsthhvSTSSPAPRPGTTSQASGPGNSSTSTKP 721
TALPID3 pfam15324
Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for ...
413-607 2.60e-09

Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for Hedgehog signalling. Mutations in this gene noticed first in chickens lead to multiple abnormalities of development.


Pssm-ID: 317697 [Multi-domain]  Cd Length: 1241  Bit Score: 61.01  E-value: 2.60e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  413 TLTPT-IPTPSLTPTPFPTMPGE-------PGVSPVPS---------LVPTKTPA--PSSTPKPTATASPTPKPTVTASP 473
Cdd:pfam15324  934 TTLPTpVPTPQPTPPPSPPSSLKepspvktPDSSPCPSehdgafpvkEIPAEKGAdgPAVTPVITPTVTPVATPPPAATP 1013
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  474 TPKPTVTASPTPKPTVTASPT-------------PKPTVTASPTPKPTVTASPT---PKPTVTASPTPKPTVTASPTPKP 537
Cdd:pfam15324 1014 SPPLSENSIDKLKSPSPELPKpwedadlpleeenPNPFQEEPLHPRAVVMSVAKdeePESLVFPASPPEPVPFAPLPLGA 1093
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1071373367  538 TVTASPTPKPTATARPSVTPTVTPTASPTV-RPTATAGVTPSPTAGTITRALASGEagpLAMPNgLALSLN 607
Cdd:pfam15324 1094 RVPSPVQSPSSSSSTQESSSSVTVTETETLdRPISEGEILFSYGQLLAARALAEGG---LSLPN-LNDSLS 1160
TonB_N pfam16031
TonB N-terminal region; TonB_N is a short domain found just downstream of the ...
419-538 2.64e-09

TonB N-terminal region; TonB_N is a short domain found just downstream of the cytoplasmic-membrane anchor at the N-terminus of TonB proteins. The exact function is not known.


Pssm-ID: 339583 [Multi-domain]  Cd Length: 133  Bit Score: 56.09  E-value: 2.64e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 419 PTPSLTPTPFPTMPGEPGVSPVPSLVPTKtPAPSSTPKPtataSPTPKPtvtaSPTPKPtVTASPTPKPTVtaSPTPKPT 498
Cdd:pfam16031  27 QPAPAAPQPPPEPVVEPEPEPEPEPVPEP-PAPVVIEKP----KPVPKP----KPKPKP-VKKVEVPKREV--KPVEPRP 94
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 1071373367 499 VTASPTPKPTVTASPTPKPTVtaSPTPKPTVTASPTPKPT 538
Cdd:pfam16031  95 ASPFENDPPTTPARPTTAPAT--AATAAPSVSAASGPRAL 132
Herpes_U47 pfam05467
Herpesvirus glycoprotein U47;
448-576 2.65e-09

Herpesvirus glycoprotein U47;


Pssm-ID: 283192 [Multi-domain]  Cd Length: 677  Bit Score: 60.68  E-value: 2.65e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 448 TPAPSSTPKPTATASPTPKPTVTASPTPKPT-VTASPTPKPTVTASPTPK-PTVTASPTP--KPTVTASPTPKPTVTASP 523
Cdd:pfam05467 238 TTTPSSTPSSTSASITSPHIPSTNTPTPEPSpVTKNFTELQTDTIKVTPNtPTITAQTTEsiKKVVKRSDFPRPMYTPTD 317
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1071373367 524 TPKPTVTASPTPKPTV-TASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVT 576
Cdd:pfam05467 318 IPTLTIRRNATIKTEQnTENPTENPKSPPKPTNFENTTIRIPETFESTTVATNT 371
Rib_recp_KP_reg pfam05104
Ribosome receptor lysine/proline rich region; This highly conserved region is found towards ...
447-569 2.67e-09

Ribosome receptor lysine/proline rich region; This highly conserved region is found towards the C-terminus of the transmembrane domain. The function is unclear.


Pssm-ID: 309995 [Multi-domain]  Cd Length: 162  Bit Score: 56.93  E-value: 2.67e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 447 KTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKptvtasPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPK 526
Cdd:pfam05104  50 KIPESESTQEPAEASEPYVEVVPEAPPAPPPPAKPAPVPE------PVPPPKKSKPPSVKPAAVAKAPAPVLAQAAPPQA 123
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 1071373367 527 PtvtASPTPKPTvtaSPTPKPTATARPSVTPTVTPTASPTVRP 569
Cdd:pfam05104 124 K---PAPSPKDK---KKPEKKVAKVEPAPTKGKPPISSQKAAP 160
PRK10819 PRK10819
transport protein TonB; Provisional
450-573 2.69e-09

transport protein TonB; Provisional


Pssm-ID: 236768 [Multi-domain]  Cd Length: 246  Bit Score: 58.54  E-value: 2.69e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 450 APSSTPKPTAtASPTPKPTVTASPTPKPtVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTV-TASPTPKPT 528
Cdd:PRK10819   54 APADLEPPQA-VQPPPEPVVEPEPEPEP-IPEPPKEAPVVIPKPEPKPKPKPKPKPKPVKKVEEQPKREVkPVEPRPASP 131
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 1071373367 529 VTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATA 573
Cdd:PRK10819  132 FENTAPARPTSSTATAAASKPVTSVSSGPRALSRNQPQYPARAQA 176
PHA03247 PHA03247
large tegument protein UL36; Provisional
415-605 2.85e-09

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 61.11  E-value: 2.85e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  415 TPTIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPT 494
Cdd:PHA03247  2877 APARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPS 2956
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  495 ---PKPTVTA------------SPTPKPTVTASPTPKPTVTASPTPKPTVTAS-------PTPKP------------TVT 540
Cdd:PHA03247  2957 gavPQPWLGAlvpgrvavprfrVPQPAPSREAPASSTPPLTGHSLSRVSSWASslalheeTDPPPvslkqtlwppddTED 3036
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1071373367  541 ASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTAGtiTRALASGEAGPLAMPNGLALS 605
Cdd:PHA03247  3037 SDADSLFDSDSERSDLEALDPLPPEPHDPFAHEPDPATPEAG--ARESPSSQFGPPPLSANAALS 3099
TonB COG0810
Periplasmic protein TonB, links inner and outer membranes [Cell wall/membrane/envelope ...
421-579 2.92e-09

Periplasmic protein TonB, links inner and outer membranes [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 223880 [Multi-domain]  Cd Length: 244  Bit Score: 58.26  E-value: 2.92e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 421 PSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTvtasptpkptvtasptPKPTVT 500
Cdd:COG0810    24 VFLHQEDFVGIELVPLAVFLLAAKVLEAPTEEPQPEPEPPEEQPKPPTEPETPPEPTP----------------PKPKEK 87
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1071373367 501 ASPTPKPTVtasPTPKPtvtaSPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSP 579
Cdd:COG0810    88 PKPEKKPKK---PKPKP----KPKPKPKPKVKPQPKPKKPPSKTAAKAPAAPNQPARPPSAASASGAATGPSASYLSGL 159
PRK10819 PRK10819
transport protein TonB; Provisional
455-579 3.18e-09

transport protein TonB; Provisional


Pssm-ID: 236768 [Multi-domain]  Cd Length: 246  Bit Score: 58.16  E-value: 3.18e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 455 PKPTATASPTpkpTVTASPTPKPTVtASPTPKPTVTASPTPKPtVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPT 534
Cdd:PRK10819   42 PAPAQPISVT---MVAPADLEPPQA-VQPPPEPVVEPEPEPEP-IPEPPKEAPVVIPKPEPKPKPKPKPKPKPVKKVEEQ 116
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 1071373367 535 PKPTV-TASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSP 579
Cdd:PRK10819  117 PKREVkPVEPRPASPFENTAPARPTSSTATAAASKPVTSVSSGPRA 162
PRK00708 PRK00708
sec-independent translocase; Provisional
446-552 3.38e-09

sec-independent translocase; Provisional


Pssm-ID: 234818 [Multi-domain]  Cd Length: 209  Bit Score: 57.51  E-value: 3.38e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 446 TKTPAPSSTPKPTATASPTPKPTVTASPTPKPtvTASPTPKPTVTASPTP-KPTVTASPTPK-PTVTASPTPKPTVTAsP 523
Cdd:PRK00708  100 TSMSEPATENKPAEVTTPVEPMGLPETPPAVP--VPAPAPAVAAAAAQAAaAPKAPAKPRAKsPRPAAKAAPKPTETI-T 176
                          90       100
                  ....*....|....*....|....*....
gi 1071373367 524 TPKPTVTASPtPKPTVTASPTPKPTATAR 552
Cdd:PRK00708  177 AKKAKKTAAA-PKPTADKTATPAKKTTKK 204
Endomucin pfam07010
Endomucin; This family consists of several mammalian endomucin proteins. Endomucin is an early ...
438-581 3.61e-09

Endomucin; This family consists of several mammalian endomucin proteins. Endomucin is an early endothelial-specific antigen that is also expressed on putative hematopoietic progenitor cells.


Pssm-ID: 311146 [Multi-domain]  Cd Length: 251  Bit Score: 58.35  E-value: 3.61e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 438 SPVPSLVPTKTPA---PSSTPKPTATASPTPKPTVT--ASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTAS 512
Cdd:pfam07010  22 NPSLSVSPSTTKSattPTATKLNTPTGGTSPKGTTSseLSKTSLVSTTSSLTTTKEGRGTTTTDVSKNESSTTKPTVTNT 101
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1071373367 513 PTPKPTVT-ASPTPKPTVTASP--TPKPTV-TASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTA 581
Cdd:pfam07010 102 PLSNAVSTlQSSQHKTENQSSIktTEISGVsTLPPDASPSETATLSSISVTTPENTSQSQGTEDGKNASTSST 174
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
416-564 4.59e-09

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 335243 [Multi-domain]  Cd Length: 980  Bit Score: 60.03  E-value: 4.59e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 416 PTIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKT-----PAPSSTPKPTAT----ASPTPKPTVTASPTPKPTVTASPTPK 486
Cdd:pfam03154 392 PTHHPPSAHPPPLQLMPQSQQLPSPPAQPPVLTqsqshPPKASPHPPTAAshslPSQSPFPQHSFSPSGSPPVTPPSGPP 471
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1071373367 487 PTVTAS-PTPKPtvtasPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTAtarPSVTPTVTPTAS 564
Cdd:pfam03154 472 PSPSPSmPGLQP-----PSSSATSVSSSGPVPAAVSCVLPPVQIKEEPLDEEEEPESPPPPPRS---PSPEPTVVNTPS 542
KAR9 pfam08580
Yeast cortical protein KAR9; The KAR9 protein in Saccharomyces cerevisiae is a cytoskeletal ...
415-608 4.88e-09

Yeast cortical protein KAR9; The KAR9 protein in Saccharomyces cerevisiae is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules. KAR9 localizes at the shmoo tip in mating cells and at the tip of the growing bud in anaphase.


Pssm-ID: 312178  Cd Length: 668  Bit Score: 59.81  E-value: 4.88e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 415 TPTI-PTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPtatasptpkptVTASPTPKPTVTASPTPKPTVTASP 493
Cdd:pfam08580 425 TPGSsPASSVIMEPVNGPKSNGSSSRRGSSFGSGPRAIVSKLRR-----------ESKIPQIASTLTKRKSSIPRLSPTP 493
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 494 tPKPTVTASPTP--KPTVTASPTP--KPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPtvtPTASPTVRP 569
Cdd:pfam08580 494 -SNTITSETPTPasRPPGRPPPPPpnRPRWNASTNTNDLDVGHNFKPLTPTTPSSPTPSRGSRSPSTP---PSPSPLSRD 569
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1071373367 570 TATAGVTPSPTAGTITRALASGEAGPLAMPNGLALSLNP 608
Cdd:pfam08580 570 KSRSPAPTCRSGSRVSRRRASRKPTRIGSPNSRTSLLDE 608
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
488-593 5.27e-09

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 59.44  E-value: 5.27e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 488 TVTASPTPKPTVTASPTP---KPTVTASPTPKPTVTASPTPKPTVTASPTPkPTVTASPTPKPTATARPSVtPTVTPTAS 564
Cdd:PRK14950  359 LLVPVPAPQPAKPTAAAPspvRPTPAPSTRPKAAAAANIPPKEPVRETATP-PPVPPRPVAPPVPHTPESA-PKLTRAAI 436
                          90       100       110
                  ....*....|....*....|....*....|
gi 1071373367 565 PT-VRPTATAgvtPSPTAGTITRALASGEA 593
Cdd:PRK14950  437 PVdEKPKYTP---PAPPKEEEKALIADGDV 463
Herpes_U47 pfam05467
Herpesvirus glycoprotein U47;
437-584 5.39e-09

Herpesvirus glycoprotein U47;


Pssm-ID: 283192 [Multi-domain]  Cd Length: 677  Bit Score: 59.52  E-value: 5.39e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 437 VSPVPSLVPTKTPAPSSTPKPTATASPTPKPT-VTASPTPKPTVTASPTPK-PTVTASPTP--KPTVTASPTPKPTVTAS 512
Cdd:pfam05467 237 LTTTPSSTPSSTSASITSPHIPSTNTPTPEPSpVTKNFTELQTDTIKVTPNtPTITAQTTEsiKKVVKRSDFPRPMYTPT 316
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1071373367 513 PTPKPTVTASPTPKptvTASPTPKPTVTASPTPKPTATARPSVTPTVTpTASPTVRPTATAGVTPSPTAGTI 584
Cdd:pfam05467 317 DIPTLTIRRNATIK---TEQNTENPTENPKSPPKPTNFENTTIRIPET-FESTTVATNTTQKLESTTFATTI 384
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
432-581 5.66e-09

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 59.61  E-value: 5.66e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 432 PGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPkPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTA 511
Cdd:PRK07764  596 GGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAP-AGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAG 674
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1071373367 512 SPTPkptvtASPTPKPTVTASPTPKPTVTASPTPKPTATARP-----SVTPTVTPTASPTVRPTATAGVTPSPTA 581
Cdd:PRK07764  675 GAAP-----AAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAgqaddPAAQPPQAAQGASAPSPAADDPVPLPPE 744
PARM pfam17061
PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present ...
413-582 5.95e-09

PARM; Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein that is present in most tissues, with high levels in the heart, kidney and placenta. It has been shown to be induced and expressed in prostate after castration and may have a role in cell proliferation and immortalisation in prostate cancer.


Pssm-ID: 319112 [Multi-domain]  Cd Length: 296  Bit Score: 58.31  E-value: 5.95e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 413 TLTPTIPTPSLTPTPFPTMPgEPGVSPVPSLVPTKTPAPSSTPKPT-ATASPTPKPTVTASPTPKPTVTASPTPKPTVTA 491
Cdd:pfam17061  12 PLPVSLPAKITPPTATWTSS-PQNTAAVTASPTSGTHNNSVLPVTAsAPTSPLPKNISVEPREEEPTSPASNWEGTNTDP 90
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 492 SP------------TPKPTVTASPTPKPTV--TASPTPK--PTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSV 555
Cdd:pfam17061  91 SPpglsptsggvhlTPTPEEHSSGTPEASVpaTGSQSPAesPTLTSPQAPASSPSSLSTSPPEVSSASVTTNHSSTETST 170
                         170       180
                  ....*....|....*....|....*....
gi 1071373367 556 TPTVTPTA--SPTVRPTATAGVTPSPTAG 582
Cdd:pfam17061 171 QPTGAPTTpeSPTEEHSSGHTPTSHATSE 199
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
441-558 6.36e-09

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 59.34  E-value: 6.36e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 441 PSLVPTKTPAPSSTPKPTATASPTPKP-----TVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTP 515
Cdd:PRK14951  367 AAAAEAAAPAEKKTPARPEAAAPAAAPvaqaaAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVA 446
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 1071373367 516 KPTVTASPTPKPTVTASPT--PKPTVTASPTPKPTATARPSVTPT 558
Cdd:PRK14951  447 LAPAPPAQAAPETVAIPVRvaPEPAVASAAPAPAAAPAAARLTPT 491
TonB_N pfam16031
TonB N-terminal region; TonB_N is a short domain found just downstream of the ...
437-548 6.54e-09

TonB N-terminal region; TonB_N is a short domain found just downstream of the cytoplasmic-membrane anchor at the N-terminus of TonB proteins. The exact function is not known.


Pssm-ID: 339583 [Multi-domain]  Cd Length: 133  Bit Score: 54.94  E-value: 6.54e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 437 VSPVPsLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPkPTVTASPTPKPTVTASPTPKPtVTASPTPKPTVT------ 510
Cdd:pfam16031  18 VAPAD-LEPPQPAPAAPQPPPEPVVEPEPEPEPEPVPEP-PAPVVIEKPKPVPKPKPKPKP-VKKVEVPKREVKpveprp 94
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 1071373367 511 ASP--TPKPTVTASPTPKPTVtaSPTPKPTVTASPTPKPT 548
Cdd:pfam16031  95 ASPfeNDPPTTPARPTTAPAT--AATAAPSVSAASGPRAL 132
TALPID3 pfam15324
Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for ...
408-579 8.33e-09

Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for Hedgehog signalling. Mutations in this gene noticed first in chickens lead to multiple abnormalities of development.


Pssm-ID: 317697 [Multi-domain]  Cd Length: 1241  Bit Score: 59.47  E-value: 8.33e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  408 NRFAN-TLTPTI-------------PTPSLTPTPFPTMpgepgVSPVPSLVPTKTPAPSSTPkPTATASPTPKPTVTASP 473
Cdd:pfam15324  895 RHFVNeALAETIaimlgdreaqrpaPVAPSVPGDASDK-----ETTLPTPVPTPQPTPPPSP-PSSLKEPSPVKTPDSSP 968
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  474 TPKPTVTASPTP-KPTVTASPTPK------PTVTASPTPKPTVTASPT-PKPTVTASPTPKPtvtasPTPKPTVTA---- 541
Cdd:pfam15324  969 CPSEHDGAFPVKeIPAEKGADGPAvtpvitPTVTPVATPPPAATPSPPlSENSIDKLKSPSP-----ELPKPWEDAdlpl 1043
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1071373367  542 ---SPTPKPTATARP--------------SVTPTVTPTASPTVRPTATAGVTPSP 579
Cdd:pfam15324 1044 eeeNPNPFQEEPLHPravvmsvakdeepeSLVFPASPPEPVPFAPLPLGARVPSP 1098
CBP_CCPA pfam17040
Cellulose-complementing protein A; This is a family of bacterial cellulose-complementing ...
434-585 1.05e-08

Cellulose-complementing protein A; This is a family of bacterial cellulose-complementing protein A proteins necessary for cellulose biosynthesis. Cellulose is necessary for biofilm formation in bacteria. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)).


Pssm-ID: 319101 [Multi-domain]  Cd Length: 342  Bit Score: 57.94  E-value: 1.05e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 434 EPGVSPVPSlVPTKTPAPSSTPKPTATASPT--PKPTVTASP-TPKPTVTASPTPKPT----VTASPTPKPTVTASPTPK 506
Cdd:pfam17040  57 EEQVTPAPQ-IAVAPPPPPVVPDPPAIVTETapPPPVVVSAPvTYEPPAAAVPAEPPVqeapVQAAPVPPAPVPPIAEQA 135
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 507 PTVTASPT--PKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTpTVTPTASPTVRPTATAGVTPSPTAGTI 584
Cdd:pfam17040 136 PPAAPDPAsvPYANVAAAPVPPDPAPVTPAPQARVTGPNTRMVEPFSRPQVR-TVQEGATPSRVPSRSMNAFPRTSASSI 214

                  .
gi 1071373367 585 T 585
Cdd:pfam17040 215 S 215
PRK11633 PRK11633
cell division protein DedD; Provisional
421-516 1.20e-08

cell division protein DedD; Provisional


Pssm-ID: 236940 [Multi-domain]  Cd Length: 226  Bit Score: 56.16  E-value: 1.20e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 421 PSLTPtPFPTMPGE-------PGVSPVPSLVPTKTPAPSSTPKptatasPTPKPTVTASPTPKPTVTASPTPKPTVTASP 493
Cdd:PRK11633   57 PAATQ-ALPTQPPEgaaeavrAGDAAAPSLDPATVAPPNTPVE------PEPAPVEPPKPKPVEKPKPKPKPQQKVEAPP 129
                          90       100
                  ....*....|....*....|...
gi 1071373367 494 TPKptvtasPTPKPTVTASPTPK 516
Cdd:PRK11633  130 APK------PEPKPVVEEKAAPT 146
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
416-561 1.28e-08

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 335243 [Multi-domain]  Cd Length: 980  Bit Score: 58.88  E-value: 1.28e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 416 PTIPTPSLT-------------PTPFPTMPgePGVSPVPSLVPTK---TPAPSSTPKPTATASPTPKPtVTASPTPKPTV 479
Cdd:pfam03154 347 PTTPIPQLPnpqshkhpphlsaPSPFPQMP--SNLPPPPALKPLSslpTHHPPSAHPPPLQLMPQSQQ-LPSPPAQPPVL 423
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 480 TASPTPKPTvtASPTPKPTVT---ASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVT 556
Cdd:pfam03154 424 TQSQSHPPK--ASPHPPTAAShslPSQSPFPQHSFSPSGSPPVTPPSGPPPSPSPSMPGLQPPSSSATSVSSSGPVPAAV 501

                  ....*
gi 1071373367 557 PTVTP 561
Cdd:pfam03154 502 SCVLP 506
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
457-582 1.55e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 58.46  E-value: 1.55e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 457 PTATASPTPKPTVTASPTPKPTVTASPtPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTV-TASPTP 535
Cdd:PRK07764  386 GVAGGAGAPAAAAPSAAAAAPAAAPAP-AAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPpAAAPSA 464
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 1071373367 536 KPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTAG 582
Cdd:PRK07764  465 QPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAGADDAAT 511
PRK10905 PRK10905
cell division protein DamX; Validated
450-574 1.66e-08

cell division protein DamX; Validated


Pssm-ID: 236792 [Multi-domain]  Cd Length: 328  Bit Score: 57.26  E-value: 1.66e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 450 APSSTPKPTATASPtpkptVTASPTPKPTVTASPTPKPTvTASPTPKPTVTASPtpKPTVTASPTPKPTVTASPTPKPTV 529
Cdd:PRK10905  119 VNSTLPTEPATVAP-----VRNGNASRQTAKTQTAERPA-TTRPARKQAVIEPK--KPQATAKTEPKPVAQTPKRTEPAA 190
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 1071373367 530 TASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAG 574
Cdd:PRK10905  191 PVASTKAPAATSTPAPKETATTAPVQTASPAQTTATPAAGGKTAG 235
PHA02682 PHA02682
ORF080 virion core protein; Provisional
436-589 1.88e-08

ORF080 virion core protein; Provisional


Pssm-ID: 177464 [Multi-domain]  Cd Length: 280  Bit Score: 56.41  E-value: 1.88e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 436 GVSPVPSLVPTKTPAPSsTPKPtATASPTPKPTVTASPTPKPTVTASPTPKPTVTasptPKPTVTASPTPKPTVTASPTP 515
Cdd:PHA02682   78 GQSPLAPSPACAAPAPA-CPAC-APAAPAPAVTCPAPAPACPPATAPTCPPPAVC----PAPARPAPACPPSTRQCPPAP 151
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1071373367 516 kptvtASPTPKPtvtaSPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGV--TPSPTAGTITRALA 589
Cdd:PHA02682  152 -----PLPTPKP----APAAKPIFLHNQLPPPDYPAASCPTIETAPAASPVLEPRIPDKIidADNDDKDLIKKELA 218
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
419-601 1.88e-08

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 58.26  E-value: 1.88e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  419 PTPSLTPTPFPTMPGEPGVSPvpslVPTKTPAPSSTPKPTATASPTP-KPTVTASPTPKPTVTASPTPKPTVTASPTPKP 497
Cdd:PHA03307   258 PRPAPITLPTRIWEASGWNGP----SSRPGPASSSSSPRERSPSPSPsSPGSGPAPSSPRASSSSSSSRESSSSSTSSSS 333
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  498 TV--TASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPT-ATARPSVTPTVTPTASPTVRPTATAG 574
Cdd:PHA03307   334 ESsrGAAVSPGPSPSRSPSPSRPPPPADPSSPRKRPRPSRAPSSPAASAGRPTrRRARAAVAGRARRRDATGRFPAGRPR 413
                          170       180
                   ....*....|....*....|....*..
gi 1071373367  575 VTPSPTAGTITRALASgeaGPLAMPNG 601
Cdd:PHA03307   414 PSPLDAGAASGAFYAR---YPLLTPSG 437
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
415-595 1.91e-08

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 58.26  E-value: 1.91e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  415 TPTIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPT 494
Cdd:PHA03307    87 TPTWSLSTLAPASPAREGSPTPPGPSSPDPPPPTPPPASPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDA 166
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  495 PKPTVTASPTPKP--TVTASPTPKPTVTASPTPKPTVTASPTPKPTVTA---SPTPKPTATARPSVTPTVTPTASPTVRP 569
Cdd:PHA03307   167 ASSRQAALPLSSPeeTARAPSSPPAEPPPSTPPAAASPRPPRRSSPISAsasSPAPAPGRSAADDAGASSSDSSSSESSG 246
                          170       180
                   ....*....|....*....|....*...
gi 1071373367  570 TATAG--VTPSPTAGTITRALASGEAGP 595
Cdd:PHA03307   247 CGWGPenECPLPRPAPITLPTRIWEASG 274
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
451-580 2.30e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 57.42  E-value: 2.30e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 451 PSSTPKPTATASPTPKPTVTASPTPKPtvtasPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVT 530
Cdd:PRK14951  367 AAAAEAAAPAEKKTPARPEAAAPAAAP-----VAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAA 441
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 1071373367 531 ASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPT 580
Cdd:PRK14951  442 PAAVALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPT 491
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
445-597 2.39e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 57.69  E-value: 2.39e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 445 PTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTAS-PTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASP 523
Cdd:PRK07764  597 GEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAaPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGA 676
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1071373367 524 TPkptvtASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAgvtPSPTAGTITRALASGEAGPLA 597
Cdd:PRK07764  677 AP-----AAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQP---PQAAQGASAPSPAADDPVPLP 742
Trypan_PARP pfam05887
Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei ...
480-555 2.58e-08

Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of Trypanosoma brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated.


Pssm-ID: 114603  Cd Length: 145  Bit Score: 53.42  E-value: 2.58e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1071373367 480 TASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSV 555
Cdd:pfam05887  55 TNGTDPDDEPEEEEEPEPEEEGEEEPEPEEEGEEEPEPEETGEEEPEPEPEPEPEPEPEPEPEPEPEPGAATLKSV 130
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
450-589 2.78e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 57.42  E-value: 2.78e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 450 APSSTPKPTATASPTPKPTVTASPTPKP-TVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTP--- 525
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAaAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVAlap 449
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1071373367 526 -KPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTAGTITRALA 589
Cdd:PRK14951  450 aPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTEEGDVWHATVQQLAAAEAITALA 514
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
416-605 3.11e-08

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 57.24  E-value: 3.11e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 416 PTIPTPSLTPTPFPTMPGEPGVSPVPS-----------------------LVPTKTPAPSST------PKPTATASPTPK 466
Cdd:PLN03209  330 PKESDAADGPKPVPTKPVTPEAPSPPIeeeppqpkavvprplspytayedLKPPTSPIPTPPssspasSKSVDAVAKPAE 409
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 467 PTVTASPTPKPTVTAS-PTPKPTVTASP-TP-------KPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKP 537
Cdd:PLN03209  410 PDVVPSPGSASNVPEVePAQVEAKKTRPlSPyaryedlKPPTSPSPTAPTGVSPSVSSTSSVPAVPDTAPATAATDAAAP 489
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1071373367 538 TvTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTAGTITRALASGEAGPLAMPNGLALS 605
Cdd:PLN03209  490 P-PANMRPLSPYAVYDDLKPPTSPSPAAPVGKVAPSSTNEVVKVGNSAPPTALADEQHHAQPKPRPLS 556
PHA02682 PHA02682
ORF080 virion core protein; Provisional
415-539 3.49e-08

ORF080 virion core protein; Provisional


Pssm-ID: 177464 [Multi-domain]  Cd Length: 280  Bit Score: 55.64  E-value: 3.49e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 415 TPTIPTPSlTPTPFPTMPGEPGVSPVPSlVPTKTPAPSSTPKPTATASPTPKPTVTASPTPK-PTVTASPTPKPTVtasP 493
Cdd:PHA02682   80 SPLAPSPA-CAAPAPACPACAPAAPAPA-VTCPAPAPACPPATAPTCPPPAVCPAPARPAPAcPPSTRQCPPAPPL---P 154
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 1071373367 494 TPKPtvtaSPTPKPTVTASPTPKPTVTAS--PTPKPTVTASPTPKPTV 539
Cdd:PHA02682  155 TPKP----APAAKPIFLHNQLPPPDYPAAscPTIETAPAASPVLEPRI 198
PRK13914 PRK13914
invasion associated secreted endopeptidase; Provisional
445-679 3.54e-08

invasion associated secreted endopeptidase; Provisional


Pssm-ID: 237555 [Multi-domain]  Cd Length: 481  Bit Score: 56.73  E-value: 3.54e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 445 PTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASpTPKPTVTASPT 524
Cdd:PRK13914  246 TANTATPKAEVKTEAPAAEKQAAPVVKENTNTNTATTEKKETTTQQQTAPKAPTEAAKPAPAPSTNTN-ANKTNTNTNTN 324
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 525 PKPTVTASPTPKptvtaspTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPTAGTITRALASGEAGPLAM------ 598
Cdd:PRK13914  325 TNNTNTSTPSKN-------TNTNTNSNTNTNSNTNANQGSSNNNSNSSASAIIAEAQKHLGKAYSWGGNGPTTFdcsgyt 397
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 599 -----PNGLALslnPGDGGGKDLGGAQSSQAQLRP-NVLLVDFTSkfGIKHLQryllsqdsweIYVGS--FISAQQDGLf 670
Cdd:PRK13914  398 kyvfaKAGISL---PRTSGAQYASTTRISESQAKPgDLVFFDYGS--GISHVG----------IYVGNgqMINAQDNGV- 461

                  ....*....
gi 1071373367 671 LYDRLNGQG 679
Cdd:PRK13914  462 KYDNIHGSG 470
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
416-600 3.71e-08

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 57.49  E-value: 3.71e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  416 PTIPTPSLTPTPFPTM-PGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKP---TVTASPTPKPTVTASPTPKPTVTA 491
Cdd:PHA03307   106 PTPPGPSSPDPPPPTPpPASPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGASpaaVASDAASSRQAALPLSSPEETARA 185
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  492 SPTPKPTV-TASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKP----------TATARPSVTPtvt 560
Cdd:PHA03307   186 PSSPPAEPpPSTPPAAASPRPPRRSSPISASASSPAPAPGRSAADDAGASSSDSSSSessgcgwgpeNECPLPRPAP--- 262
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|
gi 1071373367  561 pTASPTVRPTATAGVTPSPTAGTITRALASGEAGPLAMPN 600
Cdd:PHA03307   263 -ITLPTRIWEASGWNGPSSRPGPASSSSSPRERSPSPSPS 301
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
389-537 4.23e-08

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 56.64  E-value: 4.23e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 389 GWEIYTGRFNGQTtglLLYNRFANT-----LT-----PTIPTPS----LTPTPFPTMPGEP-----GVSPVPSLVPTKTP 449
Cdd:PLN02217  491 GWQPWLGDFGLNT---LFYSEVQNTgpgaaITkrvtwPGIKKLSdeeiLKFTPAQYIQGDAwipgkGVPYIPGLFAGNPG 567
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 450 APSSTPkptaTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPkPTVTASPTPKPTV 529
Cdd:PLN02217  568 STNSTP----TGSAASSNTTFSSDSPSTVVAPSTSPPAGHLGSPPATPSKIVSPSTSPPASHLGSP-STTPSSPESSIKV 642

                  ....*...
gi 1071373367 530 TASPTPKP 537
Cdd:PLN02217  643 ASTETASP 650
PHA02682 PHA02682
ORF080 virion core protein; Provisional
425-573 4.30e-08

ORF080 virion core protein; Provisional


Pssm-ID: 177464 [Multi-domain]  Cd Length: 280  Bit Score: 55.25  E-value: 4.30e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 425 PTPFPTMPGEPGVSPVPSLVpTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVtASPTPKPTVTASPTPKPTVTA-SP 503
Cdd:PHA02682   35 PAPAAPCPPDADVDPLDKYS-VKEAGRYYQSRLKANSACMQRPSGQSPLAPSPAC-AAPAPACPACAPAAPAPAVTCpAP 112
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1071373367 504 TPK-PTVTASPTPKPTVTASPT-PKPTVTASPTPKPTVTASPTPKPTATARP-----SVTPTVTPTAS-PTVRPTATA 573
Cdd:PHA02682  113 APAcPPATAPTCPPPAVCPAPArPAPACPPSTRQCPPAPPLPTPKPAPAAKPiflhnQLPPPDYPAAScPTIETAPAA 190
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
412-591 4.42e-08

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 335243 [Multi-domain]  Cd Length: 980  Bit Score: 56.95  E-value: 4.42e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 412 NTLTPTIPTPSLTPTPFPtmPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTV-- 489
Cdd:pfam03154 310 SQLQHTPPSQSQGPSPQP--PREQPLPPAPLSMPHIKPPPTTPIPQLPNPQSHKHPPHLSAPSPFPQMPSNLPPPPALkp 387
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 490 -----TASP--TPKPTVTASPTPKPtVTASPTPKPTVTASPTPKPTVTASPTPK-PTVTASPTPKPTATARPSVTPTVTP 561
Cdd:pfam03154 388 lsslpTHHPpsAHPPPLQLMPQSQQ-LPSPPAQPPVLTQSQSHPPKASPHPPTAaSHSLPSQSPFPQHSFSPSGSPPVTP 466
                         170       180       190
                  ....*....|....*....|....*....|
gi 1071373367 562 TASPtVRPTATAGVTPSPTAGTITRALASG 591
Cdd:pfam03154 467 PSGP-PPSPSPSMPGLQPPSSSATSVSSSG 495
COG3889 COG3889
Predicted periplasmic protein [Function unknown];
396-606 4.74e-08

Predicted periplasmic protein [Function unknown];


Pssm-ID: 226406 [Multi-domain]  Cd Length: 872  Bit Score: 56.79  E-value: 4.74e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 396 RFNGQTTGLLLYnrfANTLTPTIPTPSLTPTPFPTMPGEPGVspVPSLVPTKTPAPSSTPKPTaTASPTPKPTVTASPTP 475
Cdd:COG3889   690 LFRDPPVGWLPY---TNSLYKATTLSSEAKNPDTVKIGQALT--VYGSLEVFPAGENWGFIPT-TKRVKVRIMDPASGTG 763
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 476 KPTVTASPTpkpTVTASPTPKPTvtaSPTPKPTVTaSPTPKPTVTASPTPKPTVTASPTPkptvtaspTPKPtatarpsv 555
Cdd:COG3889   764 TSITTSGTF---TAEVPQSPTKT---ETTLSYSAY-SNTSILIETTSVVITKTVTQTQTT--------TSSP-------- 820
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1071373367 556 TPTVTPTASPTVRPTATagvTPSPTAGTiTRALASGEAGPLAMPNGLALSL 606
Cdd:COG3889   821 SPTQTTSPTQTSTSTTT---TTSPSQTT-TGGGICGPIVIIVGLAALALLL 867
Rib_recp_KP_reg pfam05104
Ribosome receptor lysine/proline rich region; This highly conserved region is found towards ...
417-535 4.87e-08

Ribosome receptor lysine/proline rich region; This highly conserved region is found towards the C-terminus of the transmembrane domain. The function is unclear.


Pssm-ID: 309995 [Multi-domain]  Cd Length: 162  Bit Score: 53.08  E-value: 4.87e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 417 TIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPtVTASPTPkptVTASPTPkPTVTASPTPK 496
Cdd:pfam05104  56 STQEPAEASEPYVEVVPEAPPAPPPPAKPAPVPEPVPPPKKSKPPSVKPAA-VAKAPAP---VLAQAAP-PQAKPAPSPK 130
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 1071373367 497 PTvtaSPTPKPTVTASPTPkptvTASPTPKPTVTASPTP 535
Cdd:pfam05104 131 DK---KKPEKKVAKVEPAP----TKGKPPISSQKAAPLP 162
Endomucin pfam07010
Endomucin; This family consists of several mammalian endomucin proteins. Endomucin is an early ...
411-573 4.93e-08

Endomucin; This family consists of several mammalian endomucin proteins. Endomucin is an early endothelial-specific antigen that is also expressed on putative hematopoietic progenitor cells.


Pssm-ID: 311146 [Multi-domain]  Cd Length: 251  Bit Score: 54.89  E-value: 4.93e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 411 ANTLTPTIPTPSLTPTPFPTMpgepGVSPVPslvpTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVT 490
Cdd:pfam07010  28 SPSTTKSATTPTATKLNTPTG----GTSPKG----TTSSELSKTSLVSTTSSLTTTKEGRGTTTTDVSKNESSTTKPTVT 99
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 491 ASPTPKPTVT-ASPTPKPTVTASP--TPKPTV-TASPTPKPTVTASPTPKPTVTASPTPKPTATARPSV--TPTVTPTAS 564
Cdd:pfam07010 100 NTPLSNAVSTlQSSQHKTENQSSIktTEISGVsTLPPDASPSETATLSSISVTTPENTSQSQGTEDGKNasTSSTSPSYS 179

                  ....*....
gi 1071373367 565 PTVRPTATA 573
Cdd:pfam07010 180 SIILPVVIA 188
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
421-595 4.98e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 56.53  E-value: 4.98e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 421 PSLTPTPFPTMPGEPGVSPVPSLVPTKT--PAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPT 498
Cdd:PRK07764  597 GEGPPAPASSGPPEEAARPAAPAAPAAPaaPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGA 676
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 499 VTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPS-VTPTVTPTASPTVRPTATAGVTP 577
Cdd:PRK07764  677 APAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSpAADDPVPLPPEPDDPPDPAGAPA 756
                         170
                  ....*....|....*...
gi 1071373367 578 SPTAGTITRALASGEAGP 595
Cdd:PRK07764  757 QPPPPPAPAPAAAPAAAP 774
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
429-559 5.03e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 56.53  E-value: 5.03e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 429 PTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPtpkPTVTASPTPKPTVTASPTPKPTvTASPTPKPTVTASPTPKPT 508
Cdd:PRK07764  386 GVAGGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAA---AAPAPAAAPQPAPAPAPAPAPP-SPAGNAPAGGAPSPPPAAA 461
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1071373367 509 VTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTV 559
Cdd:PRK07764  462 PSAQPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAGADDAATL 512
SAP130_C pfam16014
Histone deacetylase complex subunit SAP130 C-terminus;
420-569 5.23e-08

Histone deacetylase complex subunit SAP130 C-terminus;


Pssm-ID: 318271 [Multi-domain]  Cd Length: 405  Bit Score: 56.11  E-value: 5.23e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 420 TPSLTPTPfPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTV 499
Cdd:pfam16014  66 APPVTVAV-EALSGQSSDQQTASALPPSQHPAQAIPTLLAAASPPSQPSAALSALPAAMAVTPPIASMANVVAPPTQPAA 144
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 500 TASPTpkpTVTASPTPKPTVTASPTPKPTVTASPTPKPTvTASPTPKPTATARPSVTPTVTPTASPTVRP 569
Cdd:pfam16014 145 SSTPA---CAISSVLPEIKIKQEAEPMDTSQPVPPLTPN-SVAPALTSLANNLSVPAGDLLPGASPRKKP 210
Rib_recp_KP_reg pfam05104
Ribosome receptor lysine/proline rich region; This highly conserved region is found towards ...
440-561 5.73e-08

Ribosome receptor lysine/proline rich region; This highly conserved region is found towards the C-terminus of the transmembrane domain. The function is unclear.


Pssm-ID: 309995 [Multi-domain]  Cd Length: 162  Bit Score: 53.08  E-value: 5.73e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 440 VPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTvtasPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPtv 519
Cdd:pfam05104  51 IPESESTQEPAEASEPYVEVVPEAPPAPPPPAKPAPVPE----PVPPPKKSKPPSVKPAAVAKAPAPVLAQAAPPQAK-- 124
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 1071373367 520 tASPTPKPTvtaSPTPKPTVTASPTPKPTATARPSVTPTVTP 561
Cdd:pfam05104 125 -PAPSPKDK---KKPEKKVAKVEPAPTKGKPPISSQKAAPLP 162
PRK00708 PRK00708
sec-independent translocase; Provisional
415-515 5.96e-08

sec-independent translocase; Provisional


Pssm-ID: 234818 [Multi-domain]  Cd Length: 209  Bit Score: 54.05  E-value: 5.96e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 415 TPTIPTPSLTPTPfPTMPGEPGVSPVPslvPTKTPAPSSTPKPTATASPTP-KPTVTASPTPK-PTVTASPTPKPTVTAs 492
Cdd:PRK00708  101 SMSEPATENKPAE-VTTPVEPMGLPET---PPAVPVPAPAPAVAAAAAQAAaAPKAPAKPRAKsPRPAAKAAPKPTETI- 175
                          90       100
                  ....*....|....*....|...
gi 1071373367 493 PTPKPTVTASPtPKPTVTASPTP 515
Cdd:PRK00708  176 TAKKAKKTAAA-PKPTADKTATP 197
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
441-597 6.07e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 56.41  E-value: 6.07e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 441 PSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVT 520
Cdd:PRK07994  361 PAAPLPEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAARQQLQRAQGATKAKK 440
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1071373367 521 ASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSPtagtITRALASGEAGPLA 597
Cdd:PRK07994  441 SEPAAASRARPVNSALERLASVRPAPSALEKAPAKKEAYRWKATNPVEVKKEPVATPKA----LKKALEHEKTPELA 513
DUF3246 pfam11596
Protein of unknown function (DUF3246); This is a small family of fungal proteins one of whose ...
413-583 6.27e-08

Protein of unknown function (DUF3246); This is a small family of fungal proteins one of whose members, MUC1.5 from Pichia stipitis is described as being an extremely serine rich protein-mucin-like protein.


Pssm-ID: 288450  Cd Length: 242  Bit Score: 54.31  E-value: 6.27e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 413 TLTPTIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVtasptPKPTVTAS 492
Cdd:pfam11596  13 TDIPTTTTATTTPTGSGTITLISTGSNSSTSNTAGSSITVAGPSSTGSDNDDDEEDETDCETEIPTV-----PTGTTTIL 87
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 493 PTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTasPTVRPTAT 572
Cdd:pfam11596  88 PTGNGTITGIPTASDTDDETDCETETDTVEPSIGTATTGVTKTTVISDGVTTTKTVTTVAPVPTQTQTET--ETVTITYT 165
                         170
                  ....*....|.
gi 1071373367 573 AGVTPSPTAGT 583
Cdd:pfam11596 166 GAGQTFTTYLT 176
TALPID3 pfam15324
Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for ...
460-581 6.28e-08

Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for Hedgehog signalling. Mutations in this gene noticed first in chickens lead to multiple abnormalities of development.


Pssm-ID: 317697 [Multi-domain]  Cd Length: 1241  Bit Score: 56.39  E-value: 6.28e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  460 TASPTPKPTVTASPTPKPTVTASPTPKPTvtasPTPKPtvtasptpkPTVTASPTPKPTVTASPTPkptvtasPTPKPTV 539
Cdd:pfam15324  918 PAPVAPSVPGDASDKETTLPTPVPTPQPT----PPPSP---------PSSLKEPSPVKTPDSSPCP-------SEHDGAF 977
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|..
gi 1071373367  540 TASPTPKPTATARPSVTPTVTPTASPTVRPTATAgvTPSPTA 581
Cdd:pfam15324  978 PVKEIPAEKGADGPAVTPVITPTVTPVATPPPAA--TPSPPL 1017
Pneumo_att_G pfam05539
Pneumovirinae attachment membrane glycoprotein G;
411-555 6.34e-08

Pneumovirinae attachment membrane glycoprotein G;


Pssm-ID: 114270 [Multi-domain]  Cd Length: 408  Bit Score: 55.82  E-value: 6.34e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 411 ANTLTPTIPTPSLTPTPFPTMpgepGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVT--ASPTPKPT 488
Cdd:pfam05539 182 TEVSHPTYPSQVTPQSQPATQ----GHQTATANQRLSSTEPVGTQGTTTSSNPEPQTEPPPSQRGPSGSPqhPPSTTSQD 257
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1071373367 489 VTASPTPKPTvTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSV 555
Cdd:pfam05539 258 QSTTGDGQEH-TQRRKTPPATSNRRSPHSTATPPPTTKRQETGRPTPRPTATTQSGSSPPHSSPPGV 323
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
476-572 6.36e-08

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 56.44  E-value: 6.36e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  476 KPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATArpsV 555
Cdd:PRK12270    37 GPGSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAA---V 113
                           90       100
                   ....*....|....*....|....*....
gi 1071373367  556 TPTVTP------------TASPTVrPTAT 572
Cdd:PRK12270   114 EDEVTPlrgaaaavaknmDASLEV-PTAT 141
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
449-550 7.60e-08

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 56.44  E-value: 7.60e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  449 PAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPT 528
Cdd:PRK12270    38 PGSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDEV 117
                           90       100
                   ....*....|....*....|....*
gi 1071373367  529 VTASPTPKPTVT---ASPTpKPTAT 550
Cdd:PRK12270   118 TPLRGAAAAVAKnmdASLE-VPTAT 141
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
425-555 8.75e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 55.76  E-value: 8.75e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 425 PTPFPTMPGEPGVSPVPSLVPTKTPAPsstPKPTATASPTPKPTVTASPTPKPTVTASPTP---KPTVTASPTPKPTVTA 501
Cdd:PRK07764  386 GVAGGAGAPAAAAPSAAAAAPAAAPAP---AAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSpagNAPAGGAPSPPPAAAP 462
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1071373367 502 SPTPKPTVTASPTPkptvTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSV 555
Cdd:PRK07764  463 SAQPAPAPAAAPEP----TAAPAPAPPAAPAPAAAPAAPAAPAAPAGADDAATL 512
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
415-583 9.67e-08

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 55.95  E-value: 9.67e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  415 TPTIPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASP---TPKPTVTASPTPKPTVTASPTPKPTvtA 491
Cdd:PHA03307    27 TPGDAADDLLSGSQGQLVSDSAELAAVTVVAGAAACDRFEPPTGPPPGPgteAPANESRSTPTWSLSTLAPASPARE--G 104
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  492 SPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPK---PTVTASPTPKPTATARPS----VTPTVTPTAS 564
Cdd:PHA03307   105 SPTPPGPSSPDPPPPTPPPASPPPSPAPDLSEMLRPVGSPGPPPAaspPAAGASPAAVASDAASSRqaalPLSSPEETAR 184
                          170
                   ....*....|....*....
gi 1071373367  565 PTVRPTATAGVTPSPTAGT 583
Cdd:PHA03307   185 APSSPPAEPPPSTPPAAAS 203
PRK00708 PRK00708
sec-independent translocase; Provisional
459-574 1.10e-07

sec-independent translocase; Provisional


Pssm-ID: 234818 [Multi-domain]  Cd Length: 209  Bit Score: 52.89  E-value: 1.10e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 459 ATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTvtasptpKPTVTASPTPK-PTVTASPTPKP 537
Cdd:PRK00708   99 ATSMSEPATENKPAEVTTPVEPMGLPETPPAVPVPAPAPAVAAAAAQAAA-------APKAPAKPRAKsPRPAAKAAPKP 171
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 1071373367 538 TVT-ASPTPKPTATARPSVTPTVTPTASPTVRPTATAG 574
Cdd:PRK00708  172 TETiTAKKAKKTAAAPKPTADKTATPAKKTTKKKKTKA 209
Trypan_PARP pfam05887
Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei ...
445-507 1.12e-07

Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of Trypanosoma brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated.


Pssm-ID: 114603  Cd Length: 145  Bit Score: 51.88  E-value: 1.12e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1071373367 445 PTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKP 507
Cdd:pfam05887  60 PDDEPEEEEEPEPEEEGEEEPEPEEEGEEEPEPEETGEEEPEPEPEPEPEPEPEPEPEPEPEP 122
Cornifin pfam02389
Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small ...
416-528 1.26e-07

Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small proline rich proteins) that are strongly induced during differentiation of human epidermal keratinocytes in vitro and in vivo. The most characteristic feature of the SPRR gene family resides in the structure of the central segments of the encoded polypeptides that are built up from tandemly repeated units of either eight (SPRR1 and SPRR3) or nine (SPRR2) amino acids with the general consensus XKXPEPXX where X is any amino acid. In order to avoid bacterial contamination due to the high polar-nature of the HMM the threshold has been set very high.


Pssm-ID: 280537 [Multi-domain]  Cd Length: 135  Bit Score: 51.21  E-value: 1.26e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 416 PTIPTPSLTPTPFPTMPG--EPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVTASPTP-KPTVTASPTPK-PTVTA 491
Cdd:pfam02389  19 PTTKEPCHSKVPEPCNPKvpEPCCPKVPEPCCPKVPEPCCPKVPEPCCPKVPEPCYPKVPEPcSPKVPEPCHPKaPEPCH 98
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 1071373367 492 SPTPKPTVTASPTPKPTVTASPTPkPTVTASPTPKPT 528
Cdd:pfam02389  99 PKVPEPCYPKAPEPCQPKVPEPCP-STVTPGPAQQKT 134
Endomucin pfam07010
Endomucin; This family consists of several mammalian endomucin proteins. Endomucin is an early ...
446-585 1.28e-07

Endomucin; This family consists of several mammalian endomucin proteins. Endomucin is an early endothelial-specific antigen that is also expressed on putative hematopoietic progenitor cells.


Pssm-ID: 311146 [Multi-domain]  Cd Length: 251  Bit Score: 53.73  E-value: 1.28e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 446 TKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKptvtaspTPKPTVTASPTPKPTVTASPTPKPTVTASPTP 525
Cdd:pfam07010  22 NPSLSVSPSTTKSATTPTATKLNTPTGGTSPKGTTSSELSK-------TSLVSTTSSLTTTKEGRGTTTTDVSKNESSTT 94
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1071373367 526 KPTVTASPTPKPTVT-ASPTPKPT-----ATARPSVTPTVTPTASPTVrpTATAGVTPSPTAGTIT 585
Cdd:pfam07010  95 KPTVTNTPLSNAVSTlQSSQHKTEnqssiKTTEISGVSTLPPDASPSE--TATLSSISVTTPENTS 158
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
418-588 1.32e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 55.24  E-value: 1.32e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 418 IPTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPSSTPKPTATASPtpkPTVTASPTPKPTVTASPTPKPTVTASPTPKP 497
Cdd:PRK07003  380 VPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEA---PPAAPAPPATADRGDDAADGDAPVPAKANAR 456
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 498 TVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVT------PTVTPTASPTVRPTA 571
Cdd:PRK07003  457 ASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARAPAAasredaPAAAAPPAPEARPPT 536
                         170
                  ....*....|....*..
gi 1071373367 572 TAGVTPSPTAGTITRAL 588
Cdd:PRK07003  537 PAAAAPAARAGGAAAAL 553
Spc7_N pfam15402
N-terminus of kinetochore NMS complex subunit Spc7;
400-575 1.33e-07

N-terminus of kinetochore NMS complex subunit Spc7;


Pssm-ID: 317767  Cd Length: 913  Bit Score: 55.52  E-value: 1.33e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 400 QTTGLLLYNRFANTLTP---TIPTPSLTPTPFPTMP-GEPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPTVtASPTP 475
Cdd:pfam15402 571 QTMGMEMTTAVGKILPPqrnRSPKSQPRMLMEAESDhAQPASSPFQENVRASPPKSPVTFHVAPVASESGSPSL-ASVRS 649
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 476 KPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVT---ASPTPKPTV-TASPTPKPTATA 551
Cdd:pfam15402 650 RPTRQSLGRRESTTPTSKSPQSSPVKNTSTPSKQSTPRVARPSTPAKTPPSSKVGfrsASPKKLFQPeLQSTASKAKSPG 729
                         170       180       190
                  ....*....|....*....|....*....|....
gi 1071373367 552 RPSV----------TPTVTPTASPTvRPTATAGV 575
Cdd:pfam15402 730 RKSLfgqnattgqsTPSFVLKPHRR-RRSSGLGI 762
Pneumo_att_G pfam05539
Pneumovirinae attachment membrane glycoprotein G;
445-579 1.36e-07

Pneumovirinae attachment membrane glycoprotein G;


Pssm-ID: 114270 [Multi-domain]  Cd Length: 408  Bit Score: 54.67  E-value: 1.36e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 445 PTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASP---TPKPTVTASPTPKPTVTASPTPKPTVT- 520
Cdd:pfam05539 169 KTAVTTSKTTSWPTEVSHPTYPSQVTPQSQPATQGHQTATANQRLSSTEpvgTQGTTTSSNPEPQTEPPPSQRGPSGSPq 248
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1071373367 521 ---ASPTPKPTVTA-----SPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVTPSP 579
Cdd:pfam05539 249 hppSTTSQDQSTTGdgqehTQRRKTPPATSNRRSPHSTATPPPTTKRQETGRPTPRPTATTQSGSSP 315
PTZ00144 PTZ00144
dihydrolipoamide succinyltransferase; Provisional
466-546 1.60e-07

dihydrolipoamide succinyltransferase; Provisional


Pssm-ID: 240289 [Multi-domain]  Cd Length: 418  Bit Score: 54.30  E-value: 1.60e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 466 KPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVtasPTPKPTVTASPTPKPTVTASPTP 545
Cdd:PTZ00144  113 APLSEIDTGGAPPAAAPAAAAAAKAEKTTPEKPKAAAPTPEPPAASKPTPPAAA---KPPEPAPAAKPPPTPVARADPRE 189

                  .
gi 1071373367 546 K 546
Cdd:PTZ00144  190 T 190
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
419-599 1.64e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 54.99  E-value: 1.64e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 419 PTPSLTPTPFPTMPGEPGVSPVPSLVPT-KTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPT-VTASPTPK 496
Cdd:PRK07764  605 SSGPPEEAARPAAPAAPAAPAAPAPAGAaAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGaAPAAPPPA 684
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 497 PTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTATARPSVTPTVTPTASPTVRPTATAGVT 576
Cdd:PRK07764  685 PAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPAGAPAQPPPPPAP 764
                         170       180
                  ....*....|....*....|...
gi 1071373367 577 PSPTAGTITRALASGEAGPLAMP 599
Cdd:PRK07764  765 APAAAPAAAPPPSPPSEEEEMAE 787
PRK11633 PRK11633
cell division protein DedD; Provisional
475-575 1.67e-07

cell division protein DedD; Provisional


Pssm-ID: 236940 [Multi-domain]  Cd Length: 226  Bit Score: 52.70  E-value: 1.67e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 475 PKPTVTASPTPKPTVTAS-PTPKP-----TVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPT 548
Cdd:PRK11633   45 PKPGDRDEPDMMPAATQAlPTQPPegaaeAVRAGDAAAPSLDPATVAPPNTPVEPEPAPVEPPKPKPVEKPKPKPKPQQK 124
                          90       100
                  ....*....|....*....|....*..
gi 1071373367 549 ATARPSVTPTVTPTASPTVRPTATAGV 575
Cdd:PRK11633  125 VEAPPAPKPEPKPVVEEKAAPTGKAYV 151
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
419-538 1.74e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 54.72  E-value: 1.74e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 419 PTPSLTPTPFPTMPGEPGVSPVPSLVPTKTPAPsstPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPT 498
Cdd:PRK14951  373 AAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAA---APAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 1071373367 499 VTASPTPKPTVTASPT--PKPTVTASPTPKPTVTASPTPKPT 538
Cdd:PRK14951  450 APPAQAAPETVAIPVRvaPEPAVASAAPAPAAAPAAARLTPT 491
Trypan_PARP pfam05887
Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei ...
434-497 2.03e-07

Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of Trypanosoma brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated.


Pssm-ID: 114603  Cd Length: 145  Bit Score: 51.11  E-value: 2.03e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1071373367 434 EPGVSPVPSLVPTKTPAPSSTPKPTATASPTPKPtvTASPTPKPTVTASPTPKPTVTASPTPKP 497
Cdd:pfam05887  61 DDEPEEEEEPEPEEEGEEEPEPEEEGEEEPEPEE--TGEEEPEPEPEPEPEPEPEPEPEPEPEP 122
PTZ00144 PTZ00144
dihydrolipoamide succinyltransferase; Provisional
456-536 2.13e-07

dihydrolipoamide succinyltransferase; Provisional


Pssm-ID: 240289 [Multi-domain]  Cd Length: 418  Bit Score: 53.92  E-value: 2.13e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 456 KPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVtasPTPKPTVTASPTPKPTVTASPTP 535
Cdd:PTZ00144  113 APLSEIDTGGAPPAAAPAAAAAAKAEKTTPEKPKAAAPTPEPPAASKPTPPAAA---KPPEPAPAAKPPPTPVARADPRE 189

                  .
gi 1071373367 536 K 536
Cdd:PTZ00144  190 T 190
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
442-527 2.18e-07

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 54.90  E-value: 2.18e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367  442 SLVPTKTPAPSSTPKPTATASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPTVTASPTPKPtVTASPTPKPTVTA 521
Cdd:PRK12270    35 DYGPGSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPP-AAAAAAAPAAAAV 113

                   ....*.
gi 1071373367  522 SPTPKP 527
Cdd:PRK12270   114 EDEVTP 119
Herpes_U47 pfam05467
Herpesvirus glycoprotein U47;
454-580 2.19e-07

Herpesvirus glycoprotein U47;


Pssm-ID: 283192 [Multi-domain]  Cd Length: 677  Bit Score: 54.51  E-value: 2.19e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1071373367 454 TPKPTATASPTPKPTV------TASPTPKPTVTASPTPKPTVTAS--PTPKPT-VTASPTPKPTVTASPTPK-PTVTA