NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1074041683|gb|AOV60054|]
View 

Protein Classification

Sm_like domain-containing protein (domain architecture ID 11242010)

Sm_like domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Sm_like pfam16243
Sm_like domain; This domain, approximately 150 residues, is mainly found in several ...
14-98 3.72e-52

Sm_like domain; This domain, approximately 150 residues, is mainly found in several uncharacterized proteins in various Prochlorococcus and Synechococcus species. The crystal structure of ECX21941 reveals unexpected similarity to Sm/LSm proteins, which are important RNA-binding proteins, despite no detectable sequence similarity. The specific function of this family is unknown, but the structure analysis of ECX21941 indicates nucleic acid-binding capabilities and suggests a role in RNA and/or DNA processing.


:

Pssm-ID: 318477  Cd Length: 85  Bit Score: 159.48  E-value: 3.72e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1074041683  14 IFKLLNGEEVLGKAVLTEDEGQTLVFIQDPVCTQIVTKETDDGKTIRGVGFAKWMQMSDEDFFILQEKDILTVTSMSKEI 93
Cdd:pfam16243   1 IFKLVNGEEVLGKAVLTEDEGETLVFIQDPVMVQIVTKELDDGKVARGMGFAKWMQMSDEDFFILREKDIITIATMSKEV 80

                  ....*
gi 1074041683  94 SYLYE 98
Cdd:pfam16243  81 IFMYE 85
 
Name Accession Description Interval E-value
Sm_like pfam16243
Sm_like domain; This domain, approximately 150 residues, is mainly found in several ...
14-98 3.72e-52

Sm_like domain; This domain, approximately 150 residues, is mainly found in several uncharacterized proteins in various Prochlorococcus and Synechococcus species. The crystal structure of ECX21941 reveals unexpected similarity to Sm/LSm proteins, which are important RNA-binding proteins, despite no detectable sequence similarity. The specific function of this family is unknown, but the structure analysis of ECX21941 indicates nucleic acid-binding capabilities and suggests a role in RNA and/or DNA processing.


Pssm-ID: 318477  Cd Length: 85  Bit Score: 159.48  E-value: 3.72e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1074041683  14 IFKLLNGEEVLGKAVLTEDEGQTLVFIQDPVCTQIVTKETDDGKTIRGVGFAKWMQMSDEDFFILQEKDILTVTSMSKEI 93
Cdd:pfam16243   1 IFKLVNGEEVLGKAVLTEDEGETLVFIQDPVMVQIVTKELDDGKVARGMGFAKWMQMSDEDFFILREKDIITIATMSKEV 80

                  ....*
gi 1074041683  94 SYLYE 98
Cdd:pfam16243  81 IFMYE 85
 
Name Accession Description Interval E-value
Sm_like pfam16243
Sm_like domain; This domain, approximately 150 residues, is mainly found in several ...
14-98 3.72e-52

Sm_like domain; This domain, approximately 150 residues, is mainly found in several uncharacterized proteins in various Prochlorococcus and Synechococcus species. The crystal structure of ECX21941 reveals unexpected similarity to Sm/LSm proteins, which are important RNA-binding proteins, despite no detectable sequence similarity. The specific function of this family is unknown, but the structure analysis of ECX21941 indicates nucleic acid-binding capabilities and suggests a role in RNA and/or DNA processing.


Pssm-ID: 318477  Cd Length: 85  Bit Score: 159.48  E-value: 3.72e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1074041683  14 IFKLLNGEEVLGKAVLTEDEGQTLVFIQDPVCTQIVTKETDDGKTIRGVGFAKWMQMSDEDFFILQEKDILTVTSMSKEI 93
Cdd:pfam16243   1 IFKLVNGEEVLGKAVLTEDEGETLVFIQDPVMVQIVTKELDDGKVARGMGFAKWMQMSDEDFFILREKDIITIATMSKEV 80

                  ....*
gi 1074041683  94 SYLYE 98
Cdd:pfam16243  81 IFMYE 85
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH