NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1084307571|ref|XP_018645365|]
View 

Protein Classification

TES domain-containing protein (domain architecture ID 10547169)

TES domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TES pfam08034
Trematode eggshell synthesis protein; This domain has been identified in a number of distantly ...
101-166 2.59e-19

Trematode eggshell synthesis protein; This domain has been identified in a number of distantly related species of trematodes. This protein domain is crucial for eggshell synthesis in trematodes (Ebersberger I).


:

Pssm-ID: 400403  Cd Length: 66  Bit Score: 78.67  E-value: 2.59e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1084307571 101 YTKGYQTFLGKRRRGSKSHVRTTFRRRSGYDYNGRKERSSTFESYGEADSFDRKKIRDVFDVNGYI 166
Cdd:pfam08034   1 YTKGKFTSRGNSRKGSKSSETTYFRRGSKYDRYGRREKYSTFDTRGKSDSYDKKKIKDVFDINGKL 66
 
Name Accession Description Interval E-value
TES pfam08034
Trematode eggshell synthesis protein; This domain has been identified in a number of distantly ...
101-166 2.59e-19

Trematode eggshell synthesis protein; This domain has been identified in a number of distantly related species of trematodes. This protein domain is crucial for eggshell synthesis in trematodes (Ebersberger I).


Pssm-ID: 400403  Cd Length: 66  Bit Score: 78.67  E-value: 2.59e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1084307571 101 YTKGYQTFLGKRRRGSKSHVRTTFRRRSGYDYNGRKERSSTFESYGEADSFDRKKIRDVFDVNGYI 166
Cdd:pfam08034   1 YTKGKFTSRGNSRKGSKSSETTYFRRGSKYDRYGRREKYSTFDTRGKSDSYDKKKIKDVFDINGKL 66
 
Name Accession Description Interval E-value
TES pfam08034
Trematode eggshell synthesis protein; This domain has been identified in a number of distantly ...
101-166 2.59e-19

Trematode eggshell synthesis protein; This domain has been identified in a number of distantly related species of trematodes. This protein domain is crucial for eggshell synthesis in trematodes (Ebersberger I).


Pssm-ID: 400403  Cd Length: 66  Bit Score: 78.67  E-value: 2.59e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1084307571 101 YTKGYQTFLGKRRRGSKSHVRTTFRRRSGYDYNGRKERSSTFESYGEADSFDRKKIRDVFDVNGYI 166
Cdd:pfam08034   1 YTKGKFTSRGNSRKGSKSSETTYFRRGSKYDRYGRREKYSTFDTRGKSDSYDKKKIKDVFDINGKL 66
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH