NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|113681162|ref|NP_001038653|]
View 

Protein Classification

solute carrier organic anion transporter (domain architecture ID 13024459)

solute carrier organic anion transporter is a major facilitator superfamily (MFS) transporter that mediates the Na(+)-independent high affinity transport of organic anions such as pravastatin, taurocholate, methotrexate, dehydroepiandrosterone sulfate, prostaglandin E2, thromboxane B2, leukotriene C3, and the thyroid hormones thyroxine and triiodothyronine, among others

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MFS_SLCO3_OATP3 cd17402
Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of ...
27-555 0e+00

Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 3 (SLCO3) or Organic anion transporting polypeptide 3 (OATP3) family contains only one subfamily, OATP3A, which contains only one mammalian member OATP3A1 (encoded by SLCO3A1). It mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate, prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123, and vasopressin. SLCO3A1 has been identified as a Crohn's disease (CD)-associated gene, which mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation, resulting in a higher incidence of bowel perforation in CD patients. The SLCO3/OATP3 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


:

Pssm-ID: 340960 [Multi-domain]  Cd Length: 444  Bit Score: 806.46  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17402    1 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLASQYKitdtwskdqgrdvcsntskadepcgnranTNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17402   81 GALLSALPEFLTHQYK-----------------------------TNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVR 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQ 266
Cdd:cd17402  132 RKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSKLDITPDDPRWIGAWWGGFLLCGALLFFSALLMFGFPQ 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 SLpskemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccQQLRVIPKVTKHLLSNPVFTCIVLAACMEIA 346
Cdd:cd17402  212 SL-----------------------------------------------QQLRVIPKVTKHLLSNPVFTCIVLAACMEIA 244
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 347 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGC 426
Cdd:cd17402  245 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGC 324
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 427 DTGPVAGVTVAYGNETLQVG-QTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTraistglpaplSQNLSGCACI 505
Cdd:cd17402  325 DTGPVAGVTVPYGNDTAPGSsLDPYAPCNSNCECQTDSFSPVCGADGITYLSACFAGCS-----------STNLSGCACL 393
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|.
gi 113681162 506 SGYNDF-ATAVPGKCPRPGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17402  394 SSVPAEnATVVPGKCPSPGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIR 444
 
Name Accession Description Interval E-value
MFS_SLCO3_OATP3 cd17402
Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of ...
27-555 0e+00

Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 3 (SLCO3) or Organic anion transporting polypeptide 3 (OATP3) family contains only one subfamily, OATP3A, which contains only one mammalian member OATP3A1 (encoded by SLCO3A1). It mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate, prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123, and vasopressin. SLCO3A1 has been identified as a Crohn's disease (CD)-associated gene, which mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation, resulting in a higher incidence of bowel perforation in CD patients. The SLCO3/OATP3 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340960 [Multi-domain]  Cd Length: 444  Bit Score: 806.46  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17402    1 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLASQYKitdtwskdqgrdvcsntskadepcgnranTNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17402   81 GALLSALPEFLTHQYK-----------------------------TNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVR 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQ 266
Cdd:cd17402  132 RKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSKLDITPDDPRWIGAWWGGFLLCGALLFFSALLMFGFPQ 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 SLpskemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccQQLRVIPKVTKHLLSNPVFTCIVLAACMEIA 346
Cdd:cd17402  212 SL-----------------------------------------------QQLRVIPKVTKHLLSNPVFTCIVLAACMEIA 244
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 347 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGC 426
Cdd:cd17402  245 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGC 324
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 427 DTGPVAGVTVAYGNETLQVG-QTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTraistglpaplSQNLSGCACI 505
Cdd:cd17402  325 DTGPVAGVTVPYGNDTAPGSsLDPYAPCNSNCECQTDSFSPVCGADGITYLSACFAGCS-----------STNLSGCACL 393
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|.
gi 113681162 506 SGYNDF-ATAVPGKCPRPGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17402  394 SSVPAEnATVVPGKCPSPGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIR 444
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
29-614 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 397311 [Multi-domain]  Cd Length: 529  Bit Score: 607.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162   29 IFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMALGA 108
Cdd:pfam03137   1 GFLVFLSLLGLAQALVSGYFNSSITTIEKRFGLPSSLSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGVGSLLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  109 LLSALPEFLasqykitdtwskdqgrdvcsntskadepcgnrantnmmYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRKK 188
Cdd:pfam03137  81 LLFALPHFL--------------------------------------SGPFFLGQLLLGIGGTPLYTLGISYIDDNVKKK 122
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  189 DSSLYIGILFSTLVFGPACGFILGSVCTNFYVDalfIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQSL 268
Cdd:pfam03137 123 NSPLYIGILYAVRVLGPALGFLLGSLCLRIYVD---IGSVSLTLTPKDPRWVGAWWLGFLIAGLLLLLTAIPFFFFPKSL 199
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  269 PSKEmegvpeSEQAMlpaslsqdfEKSKPSNGVVQNYQPNSNSLSCCQQLRVIPKVTKHLLSNPVFTCIVLAACMEIAVV 348
Cdd:pfam03137 200 PGTA------KRRAE---------KKKERESHHSIKDKEKTKSLKLGKSLKDFPKALKRLLKNPVYMLLTLASVSEFLLI 264
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  349 AGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGCDT 428
Cdd:pfam03137 265 AGYATFLPKYIETQFGLSASTANLLTGVVLIPGAALGILLGGLIIKKFKLSAKGLAKFNLITSLVSLLLSLLLFFLGCPN 344
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  429 GPVAGVTVAYGNeTLQVGQTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGLPAPLSQNLSGCACISGY 508
Cdd:pfam03137 345 SPVAGITVPYGG-TQQLSGNLTASCNSNCSCSSSFYSPVCGSDGIGYTSPCPCGAGCSSSSGAGKSTYNCSCCCSCGSSD 423
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  509 -NDFATAVPGKCPrPGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGA 587
Cdd:pfam03137 424 sGGNGSATPGKCP-SDCSNKLPLFLALLFLASFFSSLSSTPGTLVILRCVPPEDKSFALGIQFLILRLLGFIPGPIIFGA 502
                         570       580
                  ....*....|....*....|....*..
gi 113681162  588 GIDSTCLFWSAECGVKGACLLYDNVTY 614
Cdd:pfam03137 503 LIDSTCLLWTKTCGGRGNCWLYDNDKL 529
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
22-641 2.90e-149

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279 [Multi-domain]  Cd Length: 632  Bit Score: 448.02  E-value: 2.90e-149
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162   22 SCFSNIKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGG 101
Cdd:TIGR00805  26 SLFSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIGNLLLIIFVSYFGTKLHRPIVIGAGC 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  102 IVMALGALLSALPEFLASQYKITDTWSKDqgrdvCSNTSKADEPC-GNRANT---------------NMMYLLLIGAQVL 165
Cdd:TIGR00805 106 AIMGLGSLLSSLPHFLMGRYSYSTTVSST-----GNLSSANSFLCmENLTQTlrptqdpsecqkqhkSLMWLLFLVSNIL 180
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  166 LGIGATPVQPLGVSYIDDHVRKKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWG 245
Cdd:TIGR00805 181 RGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSVNTEDLIITPTDPRWIGAWWI 260
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  246 GFLICGALLFFSALFMFGFPQSLPSkemEGVPESEQAMLPASLSQDFEKSKPSNGVVqnyqpnsnslsccqqLRVIPKVT 325
Cdd:TIGR00805 261 GFLVCGFVALLTSIPLFFFPKTLPK---EGKRVNVDVHEAEKLEKSRGEDRKKNSGI---------------TKDFPKFI 322
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  326 KHLLSNPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIR 405
Cdd:TIGR00805 323 KRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKAAY 402
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  406 MAMLVNLISTACYVSFLFLGCDTGPVAGVTVAYGNETLQVgQTPEApCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTR 485
Cdd:TIGR00805 403 FAICLSTLEYLLYSPKFLITCESAPVAGVNNPSNDQPLYV-ENRTD-CNRQCSCDSSIWDPVCGDNGLAYLSPCHAGCRM 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  486 AISTGlPAPLSQNLSgCACISGYNdfaTAVPGKCPRPgCQEAFLTFLCVICGCSMIGAMAQTPSVIILIRTVSPELKSYA 565
Cdd:TIGR00805 481 SVGTG-SNMVFTNCS-CIQTPGNS---SAKKGLCDPP-CATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLG 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 113681162  566 LGVLFLLLRLLGFIPPPLIFGAGIDSTCLFW-SAECGVKGACLLYDNVTYRHLYISMAIVLKIMAFLLYTTTWHCLR 641
Cdd:TIGR00805 555 LGLQWFCIRVFGTIPAPILFGALIDVTCLHWqTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILAR 631
KAZAL smart00280
Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and ...
457-488 7.89e-04

Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and follistatin-like domains.


Pssm-ID: 197624  Cd Length: 46  Bit Score: 37.66  E-value: 7.89e-04
                           10        20        30
                   ....*....|....*....|....*....|..
gi 113681162   457 CNCyTSSVSPVCGSNGVTYLSSCFAGCTRAIS 488
Cdd:smart00280   4 EAC-PREYDPVCGSDGVTYSNECHLCKAACES 34
 
Name Accession Description Interval E-value
MFS_SLCO3_OATP3 cd17402
Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of ...
27-555 0e+00

Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 3 (SLCO3) or Organic anion transporting polypeptide 3 (OATP3) family contains only one subfamily, OATP3A, which contains only one mammalian member OATP3A1 (encoded by SLCO3A1). It mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate, prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123, and vasopressin. SLCO3A1 has been identified as a Crohn's disease (CD)-associated gene, which mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation, resulting in a higher incidence of bowel perforation in CD patients. The SLCO3/OATP3 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340960 [Multi-domain]  Cd Length: 444  Bit Score: 806.46  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17402    1 IKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMAL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLASQYKitdtwskdqgrdvcsntskadepcgnranTNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17402   81 GALLSALPEFLTHQYK-----------------------------TNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVR 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQ 266
Cdd:cd17402  132 RKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSKLDITPDDPRWIGAWWGGFLLCGALLFFSALLMFGFPQ 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 SLpskemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccQQLRVIPKVTKHLLSNPVFTCIVLAACMEIA 346
Cdd:cd17402  212 SL-----------------------------------------------QQLRVIPKVTKHLLSNPVFTCIVLAACMEIA 244
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 347 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGC 426
Cdd:cd17402  245 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGC 324
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 427 DTGPVAGVTVAYGNETLQVG-QTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTraistglpaplSQNLSGCACI 505
Cdd:cd17402  325 DTGPVAGVTVPYGNDTAPGSsLDPYAPCNSNCECQTDSFSPVCGADGITYLSACFAGCS-----------STNLSGCACL 393
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|.
gi 113681162 506 SGYNDF-ATAVPGKCPRPGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17402  394 SSVPAEnATVVPGKCPSPGCQEAFLTFLCVMCVCSMIGAMAQTPSVIILIR 444
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
29-614 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 397311 [Multi-domain]  Cd Length: 529  Bit Score: 607.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162   29 IFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMALGA 108
Cdd:pfam03137   1 GFLVFLSLLGLAQALVSGYFNSSITTIEKRFGLPSSLSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGVGSLLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  109 LLSALPEFLasqykitdtwskdqgrdvcsntskadepcgnrantnmmYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRKK 188
Cdd:pfam03137  81 LLFALPHFL--------------------------------------SGPFFLGQLLLGIGGTPLYTLGISYIDDNVKKK 122
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  189 DSSLYIGILFSTLVFGPACGFILGSVCTNFYVDalfIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQSL 268
Cdd:pfam03137 123 NSPLYIGILYAVRVLGPALGFLLGSLCLRIYVD---IGSVSLTLTPKDPRWVGAWWLGFLIAGLLLLLTAIPFFFFPKSL 199
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  269 PSKEmegvpeSEQAMlpaslsqdfEKSKPSNGVVQNYQPNSNSLSCCQQLRVIPKVTKHLLSNPVFTCIVLAACMEIAVV 348
Cdd:pfam03137 200 PGTA------KRRAE---------KKKERESHHSIKDKEKTKSLKLGKSLKDFPKALKRLLKNPVYMLLTLASVSEFLLI 264
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  349 AGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGCDT 428
Cdd:pfam03137 265 AGYATFLPKYIETQFGLSASTANLLTGVVLIPGAALGILLGGLIIKKFKLSAKGLAKFNLITSLVSLLLSLLLFFLGCPN 344
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  429 GPVAGVTVAYGNeTLQVGQTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGLPAPLSQNLSGCACISGY 508
Cdd:pfam03137 345 SPVAGITVPYGG-TQQLSGNLTASCNSNCSCSSSFYSPVCGSDGIGYTSPCPCGAGCSSSSGAGKSTYNCSCCCSCGSSD 423
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  509 -NDFATAVPGKCPrPGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGA 587
Cdd:pfam03137 424 sGGNGSATPGKCP-SDCSNKLPLFLALLFLASFFSSLSSTPGTLVILRCVPPEDKSFALGIQFLILRLLGFIPGPIIFGA 502
                         570       580
                  ....*....|....*....|....*..
gi 113681162  588 GIDSTCLFWSAECGVKGACLLYDNVTY 614
Cdd:pfam03137 503 LIDSTCLLWTKTCGGRGNCWLYDNDKL 529
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
22-641 2.90e-149

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279 [Multi-domain]  Cd Length: 632  Bit Score: 448.02  E-value: 2.90e-149
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162   22 SCFSNIKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGG 101
Cdd:TIGR00805  26 SLFSKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIGNLLLIIFVSYFGTKLHRPIVIGAGC 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  102 IVMALGALLSALPEFLASQYKITDTWSKDqgrdvCSNTSKADEPC-GNRANT---------------NMMYLLLIGAQVL 165
Cdd:TIGR00805 106 AIMGLGSLLSSLPHFLMGRYSYSTTVSST-----GNLSSANSFLCmENLTQTlrptqdpsecqkqhkSLMWLLFLVSNIL 180
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  166 LGIGATPVQPLGVSYIDDHVRKKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWG 245
Cdd:TIGR00805 181 RGIGATPIFPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSVNTEDLIITPTDPRWIGAWWI 260
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  246 GFLICGALLFFSALFMFGFPQSLPSkemEGVPESEQAMLPASLSQDFEKSKPSNGVVqnyqpnsnslsccqqLRVIPKVT 325
Cdd:TIGR00805 261 GFLVCGFVALLTSIPLFFFPKTLPK---EGKRVNVDVHEAEKLEKSRGEDRKKNSGI---------------TKDFPKFI 322
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  326 KHLLSNPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIR 405
Cdd:TIGR00805 323 KRLLCNKIYMLVILAQVIDVLAFNGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKAAY 402
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  406 MAMLVNLISTACYVSFLFLGCDTGPVAGVTVAYGNETLQVgQTPEApCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTR 485
Cdd:TIGR00805 403 FAICLSTLEYLLYSPKFLITCESAPVAGVNNPSNDQPLYV-ENRTD-CNRQCSCDSSIWDPVCGDNGLAYLSPCHAGCRM 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  486 AISTGlPAPLSQNLSgCACISGYNdfaTAVPGKCPRPgCQEAFLTFLCVICGCSMIGAMAQTPSVIILIRTVSPELKSYA 565
Cdd:TIGR00805 481 SVGTG-SNMVFTNCS-CIQTPGNS---SAKKGLCDPP-CATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLG 554
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 113681162  566 LGVLFLLLRLLGFIPPPLIFGAGIDSTCLFW-SAECGVKGACLLYDNVTYRHLYISMAIVLKIMAFLLYTTTWHCLR 641
Cdd:TIGR00805 555 LGLQWFCIRVFGTIPAPILFGALIDVTCLHWqTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILAR 631
MFS_SLCO_OATP cd17336
Solute carrier organic anion transporters of the Major Facilitator Superfamily of transporters; ...
27-555 8.88e-147

Solute carrier organic anion transporters of the Major Facilitator Superfamily of transporters; Solute carrier organic anion transporters (SLCOs) are also called organic anion transporting polypeptides (OATPs) or SLC21 (Solute carrier family 21) proteins. They are sodium-independent transporters that mediate the transport of a broad range of endo- as well as xenobiotics. Their substrates are mainly amphipathic organic anions with a molecular weight of more than 300Da, although there are a few known neutral or positively charged substrates. These include drugs including statins, angiotensin-converting enzyme inhibitors, angiotensin receptor blockers, antibiotics, antihistaminics, antihypertensives, and anticancer drugs. SLCOs/OATPs can be classified into 6 families (SLCO1-6 or OATP1-6) and each family may have subfamilies (e.g. OATP1A, OATP1B, OATP1C). Within the subfamilies, individual members are numbered according to the chronology of their identification and if there is already an ortholog known, they are given the same number. For example, the first SLCO identified, is rat OATP1A1 (encoded by the Slco1a1 gene). The second SLCO identified is the first human SLCO from the same subfamily and is called OATP1A2 (encoded by the SLCO1A2 gene). There are 11 human SLCOs/OATPs. SLCOs belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340894 [Multi-domain]  Cd Length: 411  Bit Score: 433.59  E-value: 8.88e-147
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17336    1 PKVFVVLLCLLGLLQGAVVSYFVSTITTIEKRFGLSSSQSGLILSANDIGQLLAVLLVSYFGGRGHRPRWIGIGSILMGL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLasqykitdtwskdqgrdvcsntskadepcgnrantnmmylllIGAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17336   81 GCFLLALPHFL------------------------------------------FVGQFLLGIGSSPLYTLGITYIDDNVS 118
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTtqlNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPq 266
Cdd:cd17336  119 KKNSPLYIGILYAMRVLGPALGFLLGSFLLRIYVDFSRVPL---GITPDDPRWIGAWWLGFLILGILLLIVSIPLFFFP- 194
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 slpskemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtkhllsnPVFTCIVLAACMEIA 346
Cdd:cd17336  195 -----------------------------------------------------------------PIFILLLLAIVFESF 209
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 347 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGC 426
Cdd:cd17336  210 AISGFSTFLPKYLETQFRLSASLASLLTGLILVPGAALGILLGGLIIKKFKLTARGLAKFVLILSLLSVILYISLFFLGC 289
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 427 DTGPVAGVTVAYGNETLQVgqtpEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGlpapLSQNLSGCACIS 506
Cdd:cd17336  290 DNPPIAGVTTPYGSSSSPI----TSSCNSDCNCSDSSFSPVCGSDGITYFSPCHAGCTSSDAGN----GTKTYSNCSCIN 361
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|
gi 113681162 507 GYNDFATAVPGKC-PRPGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17336  362 SGTATSSGCPPDCsVAPNCCSKLIPFLAVLFLSSFLLSLSIVPSTMITLR 411
MFS_SLCO5_OATP5 cd17404
Solute carrier organic anion transporter 5 family of the Major Facilitator Superfamily of ...
28-555 4.51e-130

Solute carrier organic anion transporter 5 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 5 (SLCO5) or Organic anion transporting polypeptide 5 (OATP5) family contains only one subfamily, OATP5A, which contains only one mammalian member OATP5A1 (encoded by SLCO5A1). Deletion of the SLCO5A1 gene has been implicated in the pathogenesis of Mesomelia-synostoses syndrome (MSS), a rare autosomal-dominant disorder characterized by mesomelic limb shortening, acral synostoses, and multiple congenital malformations. OATP5A1 may be a non-classical OATP which is involved in biological processes that require the reorganization of the cell shape, such as differentiation and migration. It seems to affect intracellular transport of drugs and may participate in chemoresistance of small cell lung cancer (SCLC by sequestration), rather than mediating cellular uptake. The SLCO5/OATP5 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340962 [Multi-domain]  Cd Length: 425  Bit Score: 391.33  E-value: 4.51e-130
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  28 KIFLVAECALMLAQGT-VGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17404    1 KAFLVCMCLLIFIQSAlSSGYLNSVITTIEKRYSLKSSESGLIVSSYEIGSLLTVVFVSYFGGRGHRPRWIAVGGVLIAL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLasqykitdtwskdqgrdvcsntskadepcgnrantnmmylllIGAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17404   81 GSFLFSLPHFF------------------------------------------ILAQILIGMGGTPIFTLGTTYLDDHVK 118
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALfidTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQ 266
Cdd:cd17404  119 KESSSLYLAIMYVMGALGPAAGFLLGGLLINFYVDPL---STPPDISPGDPRWIGAWWGGFLLCGIALLLVAFPFFTFPK 195
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 slpskemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtkhllsnPVFTCIVLAACMEIA 346
Cdd:cd17404  196 -----------------------------------------------------------------MTFLVVSLGYCMELA 210
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 347 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGC 426
Cdd:cd17404  211 IVSGFITFLPKYLETQFGIPASNANIFTGVIAVPGAGIGIVLGGYILKRFKLGPKGAAKLALICNFLSLLLFLTLFFLGC 290
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 427 DTGPVAGVTVAYGNE---TLQVGQTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTraiSTGLPAPLSQNLSGCA 503
Cdd:cd17404  291 ESIKLAGITIPYTTGpslSSTHGRNLTSECNVNCGCSINEYEPVCGSDGITYFSPCLAGCT---SVGNTSTGIRNYTNCA 367
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113681162 504 CISGYNDFA--------TAVPGKCPRPgCQE--AFLTFLCVIcgcSMIGAMAQTPSVIILIR 555
Cdd:cd17404  368 CLQSRSSISpptvgqgsQLQAGPCSRT-CNTliPFLILLFIV---TLITACAQMPALMITLR 425
MFS_SLCO2A_OATP2A cd17461
Solute carrier organic anion transporter 2A subfamily of the Major Facilitator Superfamily of ...
26-555 3.53e-123

Solute carrier organic anion transporter 2A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2A (SLCO2A), also called Organic anion-transporting polypeptide 2A (OATP2A), subfamily has one mammalian member, OATP2A1 (encoded by SLCO2A1), which is also called prostaglandin transporter. It is a lactate/prostaglandin anion exchanger that mediates the release of newly synthesized prostaglandins (PGD2, PGE1, PGE2, PGF2A and PGI2) from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. Mutations in SLCO2A1 can cause primary hypertrophic osteoarthropathy (PHO), a rare multi-organic disease characterized by digital clubbing, pachydermia and periosteal reaction. The SLCO2A/OATP2A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341019 [Multi-domain]  Cd Length: 474  Bit Score: 375.30  E-value: 3.53e-123
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  26 NIKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMA 105
Cdd:cd17461    1 NIKVFVLCHGLLQLSQLLYSAYFKSSLTTIEKRFGLSSLSSGLISSLHEIGNAVLIIFVSYFGSRVHRPRLIGIGGLLLA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 106 LGALLSALPEFLASQYKITdtwskdqgrdvcsntskadepcgnrantnmMYLLLIGAQVLLGIGATPVQPLGVSYIDDHV 185
Cdd:cd17461   81 LGAFLLTLPHFLSEPYQYS------------------------------MWVLMVVAQLLAGIGTVPIQPFGISYVDDFA 130
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 186 RKKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFP 265
Cdd:cd17461  131 EPSNSPLYIAILFAISVFGPAFGYLLGSVVLRIFVDIGRVNTATVELTPADPRWIGAWWLGLLISSGLLVLTSLPYFFFP 210
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 266 QSLPSKEMegvPESEQAMLpaslsQDFEKSKPSNGVVQNYqpnsnslsccqqLRVIPKVTKHLLSNPVFTCIVLAACMEI 345
Cdd:cd17461  211 REMLVGKK---PSPEGDML-----RKKEDEKKEEGSLLDF------------IKRFPKMFVKLLLNPLFMLLVLAQCTFS 270
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 346 AVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLG 425
Cdd:cd17461  271 SVIAGLSTFLNKFLEKQYGASASYANFLIGAVNLPAAALGMLLGGIIMKRFGFSLRAIPRFSVVILSISIMLCVPLFFMG 350
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 426 CDTGPVAGVTVAYGNETlqvgQTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRaISTGLPAPLSQNLSGCACI 505
Cdd:cd17461  351 CSTQDVAGVYPKTSNSS----DGPHLSCSANCSCPESAFNPVCGENGIEYISPCHAGCTN-SNMDSSTYRQQIYSNCSCI 425
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|
gi 113681162 506 SGYNDFATAVPGKCPRPgCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17461  426 PDLSGEKPAKTGSCPNS-CSHLLLPVMFLISFAGLIACLTHNPLYMMVLR 474
MFS_SLCO2B_OATP2B cd17460
Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of ...
27-555 1.80e-121

Solute carrier organic anion transporter 2B subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2B (SLCO2B), also called Organic anion-transporting polypeptide 2B (OATP2B), subfamily has one mammalian member, OATP2B1 (encoded by SLCO2B1). It mediates the Na(+)-independent transport of various organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost. It also mediates the transport of endogenous sex steroid conjugates such as dehydroepiandrosterone sulfate (DHEAS). SLCO2B1 variations result in differential expression and uptake of DHEAS, which impacts subsequent resistance to androgen-deprivation therapy (ADT), the primary treatment of metastatic prostate cancer. The SLCO2B/OATP2B subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341018 [Multi-domain]  Cd Length: 479  Bit Score: 371.02  E-value: 1.80e-121
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17460    1 IKFFVLCHGLLQLSQLLVSGYLKSSISTIEKRFGLSSQTSGLLASFNEVGNTVLIVFVSYFGSRVHRPRFIGCGAILVSL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLASQYKitdtwskdqgrdvcsntskadepcgnrantnmmYLLLIGAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17460   81 AGFLMALPHFISEPYE---------------------------------YGILFLGQLLLGIGGVPIQPFGISYIDDFAS 127
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQ 266
Cdd:cd17460  128 ESNSPLYLGILFAVTVLGPGFGFMLGSAMLRFYVDIDKMSEDEISLEIGDPRWVGAWWLGFLIAATLVALSAVPYFFFPR 207
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 SLPSKEMEGVPeseqamLPASLSQD-FEKSKPSNGVVQNyqpnsnsLSCCQQLRVIPKVTKHLLSNPVFTCIVLAACMEI 345
Cdd:cd17460  208 EMPKEVVELQP------REKKLAKTmLKKLKSLSDILQN-------LSLLQFIKKFPRILLRTLRNPIYLLVVLAQVNLS 274
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 346 AVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLG 425
Cdd:cd17460  275 AMVAGLATFMGKFLERQFSITASFANLMIGGLNIPSAMVGIVVGGVILKRLQLTVRGCGAMCVLGMLLCLFFALPLLFIG 354
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 426 CDTGPVAGVTVAYGNETlqvGQTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCtRAISTGLPAPLSQNLSGCACI 505
Cdd:cd17460  355 CSTQKIAGITHRTSSSP---GLELSSQCSEACSCPPEAFNPVCGSDGVEYISPCHAGC-KSVNVQALDNSVVNYTDCSCV 430
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|
gi 113681162 506 SGYNDFATAVPGKCPrPGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17460  431 SEGGPVGAASPGTCG-SGCSHLLVPFMLLVSLGGFLASLSHTPSFMLILR 479
MFS_SLCO1A_OATP1A cd17458
Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of ...
27-556 2.82e-116

Solute carrier organic anion transporter 1A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1A (SLCO1A), also called Organic anion-transporting polypeptide 1A (OATP1A), subfamily is composed of one human member OATP1A2 (encoded by SLCO1A2) and several rodent proteins encoded by the Slco1a1, Slco1a3, Slco1a4, Slco1a5, and Slco1a6 genes. OATP1A2, also known as human OATP-A or OATP1, shows a broad spectrum of substrates including endogenous compounds (such as bile acids, steroid hormones and their conjugates, thyroid hormones) and various drugs (such as fexofenadine, ouabain and the cyanobacterial toxin microcystin). It is expressed in the brain, kidney, intestine, liver, lung, testes, and the eye (ciliary body). The SLCO1A/OATP1A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341016 [Multi-domain]  Cd Length: 527  Bit Score: 359.17  E-value: 2.82e-116
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17458    2 LKIFLLALSYAYVAKTLSGAYMNSMITQIERRFNIPSSLVGIINGSFEIGNLLVIAFVSYFGAKLHRPKVIGLGCLIMSL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLASQYKITDTWSKDQ-----------GRDVCSNTSKADEPCGNRANTNMMYLLLIGaQVLLGIGATPVQP 175
Cdd:cd17458   82 GCFLASLPHFLMGRYEYESTVSTTSnsssrvplclaNQSLSHNVTQLPSECEKESMSLMWIFVLVG-NLLRGIGETPVMP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 176 LGVSYIDDHVRKKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLICGALLF 255
Cdd:cd17458  161 LGISYIDDFSKKENSPFYIGCLHTATIVGPLLGLLLASFCAQLYVDLGSVNADDLTITPTDIRWVGAWWLGFLICAGVNF 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 256 FSALFMFGFPQSLPSKEMEGVPE-SEQAMLPASLSQDFEKSKPSNGVVQNYQPNSNSLSCcqqlrvipkvtkhllsNPVF 334
Cdd:cd17458  241 LAGLPFWFLPKSLPKEGEENETEpSKTLTVELEENKGQETKQEMYEIAKDFLPFLKSLFR----------------NPIY 304
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 335 TCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLIS 414
Cdd:cd17458  305 MLFIIVTVLQFNAFSGMISFMPKYLEQQYGKSASDAIFLIGVYNLPIICLGYFFGGLYMKKFKINTYQAAHIGFWVSLLE 384
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 415 TACYVSFLFLGCDTGPVAGVTVAYG--NETLQVGQTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGlp 492
Cdd:cd17458  385 YLLYFSAFWMGCDNSPVAGLTVSYEgiDQDSYYENTLLADCNRDCDCPLKVWDPVCGNNGLTYVSACLAGCKASVGTG-- 462
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 113681162 493 apLSQNLSGCACI--SGYNDFATAVPGKCPR-PGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIRT 556
Cdd:cd17458  463 --KNMVFQNCSCVaaSGFPSQNSSAVGQCDKgETCDKMLQYFLILSLVCSFIFSLAAMPGYMVLIRS 527
MFS_SLCO1C_OATP1C cd17459
Solute carrier organic anion transporter 1C subfamily of the Major Facilitator Superfamily of ...
27-555 3.61e-115

Solute carrier organic anion transporter 1C subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1C (SLCO1C), also called Organic anion-transporting polypeptide 1C (OATP1C), subfamily contains one mammalian member, OATP1C1 (encoded by SLCO1C1), which is also called thyroxine transporter. It mediates the high affinity transport of the thyroid hormones, T4 (3,5,3',5'tetraiodo-L-thyronine or thyroxine), rT3 (3,3'5'-triiodo-L-thyronine), and T3 (3,5,3'tri-iodo-L-thyronine or triiodothyronine), as well as organic anions such as 17-beta-glucuronosyl estradiol, estrone-3-sulfate, and sulfobromophthalein (BSP), which are transported with much lower efficiency. The SLCO1C/OATP1C subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341017 [Multi-domain]  Cd Length: 498  Bit Score: 355.61  E-value: 3.61e-115
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17459    1 LKIFLAALSFAYFAKALSGSYMKSTITQIERRFDIPSSLIGVIDGSFEMGNLLVIAFVSYFGAKLHRPRIIGAGCLLMAI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLASQYKITDTW----------------SKDQGRDVCSNTSKADEPCGNRANTNMMYLLLIGaQVLLGIGA 170
Cdd:cd17459   81 GTFLIALPHFFMGRYKYETAIqsssnstvsispcslePSPQLHSIESSDSKTGTGCEKEPGSSMWIYVFLG-NLLRGIGE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 171 TPVQPLGVSYIDDHVRKKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLIC 250
Cdd:cd17459  160 TPVQPLGISYIDDFAKEENAAFYIGCVQTIAIIGPVFGFLLGSLCAKLYVDIGFVNLDSITITPKDARWVGAWWLGYLIA 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 251 GALLFFSALFMFGFPQSLPskemegvpeseqamlpaslsQDFEKSkpsngvvqnyqpnsnslsccqqlrvipkvTKHLLS 330
Cdd:cd17459  240 GVITLLSAVPFWFLPKSLP--------------------KDFLPS-----------------------------LKNLLG 270
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 331 NPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLV 410
Cdd:cd17459  271 NPVYFLYLCTSILQFNSLIGMVTYKPKYIEQQYGQSASKANFLIGLINIPAVAIGIFSGGLLMKKFKLSVIGAAKLSFGT 350
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 411 NLISTACYVSFLFLGCDTGPVAGVTVAYgNETLQV---GQTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAI 487
Cdd:cd17459  351 SFFGYLLLLSFFAMGCENSDVAGLTVSY-NGTKQVsyaDRSLFSQCNADCKCSQKDWDPVCGENGITYVSPCLAGCKASN 429
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 113681162 488 STGLPAPLSQnlsgCACISGYNDFAT---AVPGKCPR-PGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17459  430 GSGKNTVFHN----CSCIGIPSSASGsssAILGQCPKgNACARMFLYFLAISVISSFTLSLGGTPGYILLIR 497
MFS_SLCO4_OATP4 cd17403
Solute carrier organic anion transporter 4 family of the Major Facilitator Superfamily of ...
27-555 6.59e-112

Solute carrier organic anion transporter 4 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4 (SLCO4) or Organic anion transporting polypeptide 4 (OATP4) family contains two families: OATP4A and OATP4C, each containing one mammalian member, OATP4A1 and OATP4C1, respectively. OATP4A1 (encoded by SLCO4A1), is ubiquitously expressed and mediates the Na(+)-independent transport of the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and other organic anions such as estrone sulfate and taurocholate. OATP4C1 (encoded by SLCO4C1) is capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate, cAMP, and uremic toxins, which accumulate in patients with chronic kidney diseases (CKDs). The SLCO4/OATP4 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340961 [Multi-domain]  Cd Length: 420  Bit Score: 344.24  E-value: 6.59e-112
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSV-LTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMA 105
Cdd:cd17403    1 PKGFLFFLCIFAFLQGMVVNGFVNVsITTIEKRFGLTSTQTGLIASSYDIASVLLLLFVSYFGGRGHKPRWLGIGAFIMG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 106 LGALLSALPEFLasqykitdtwskdqgrdvcsntskadepcgnrantnmmylLLIGAQVLLGIGATPVQPLGVSYIDDHV 185
Cdd:cd17403   81 IGSLVFALPHFT----------------------------------------VFILAQLLHGAGATPLYTLGVTYLDENV 120
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 186 RKKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDaLFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFP 265
Cdd:cd17403  121 STKMSPLYIGIFYAMAILGPAIGYVLGGFLLNLYTD-IDQVDSELGLTPDDPRWVGAWWLGFLISGALALIIAFPLLGFP 199
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 266 qslpskemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtkhllsnPVFTCIVLAACMEI 345
Cdd:cd17403  200 ------------------------------------------------------------------PTFMFLNLAGASEG 213
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 346 AVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACyVSFLFLG 425
Cdd:cd17403  214 MLLAGFATFLPKLIESQFSLSASLAALLVGVVVVPGGILGTFLGGLIVKKLKLKCKGILKFCIVCSIVAFLF-SFILLIY 292
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 426 CDTGPVAGVTVAYGNETLQVGQTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTraisTGLPAPLSQNLSGCACI 505
Cdd:cd17403  293 CPNAPFAGVTVPYGNSPLEGTSNLTSTCNADCHCSEDFYDPVCGSDGVTYYSPCHAGCT----TSHGDDGQKVYSNCSCI 368
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|...
gi 113681162 506 S--GYNDFATAVPGKCP-RPGCQEAFLtFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17403  369 QsnSSKTSTAATGKACPcETCCQKLYL-FLAVFFLLIVFTFMSSTPALSATLR 420
MFS_SLCO1B_OATP1B cd17457
Solute carrier organic anion transporter 1B subfamily of the Major Facilitator Superfamily of ...
27-555 3.12e-104

Solute carrier organic anion transporter 1B subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1B (SLCO1B), also called organic anion-transporting polypeptide 1B (OATP1B), subfamily is composed of two human proteins, OATP1B1 (encoded by SLCO1B1) and OATP1B3 (encoded by SLCO1B3), and one rodent member, OATP1B2 (encoded by Slco1b2). OATP1B1 and OATP1B3 are almost exclusively expressed on the basal side of hepatocytes in normal human organs. They both can accept a wide variety of structurally-unrelated compounds as substrates including clinically-important drugs such as hydroxymethylglutaryl (HMG)-CoA reductase inhibitors (statins), angiotensin II receptor blockers (sartans), angiotensin converting enzyme (ACE) inhibitors, and anti-diabetes drugs (glinides). Loss-of-function mutations in both SLCO1B1 and SLCO1B3 genes result in the Rotor syndrome, a hereditary hyperbilirubinemia. The SLCO1B/OATP1B subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341015 [Multi-domain]  Cd Length: 455  Bit Score: 325.64  E-value: 3.12e-104
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17457    1 LKMFLAALSFSYFAKALSGIIMKSSITQIERRFDISSSTVGFIDGSFEIGNLLVIAFVSYFGAKLHRPKLIAAGCFIMGL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLASQYKITdtwskdqgrdvcsntskadepCGNRANTNMMYLLLIGaQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17457   81 GSVLTALPHFFMGYYKYG---------------------CLKESGSYMWVYVLMG-NMLRGIGETPIVPLGISYLDDFAK 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSAL---FMFG 263
Cdd:cd17457  139 EENSPLYLACLHTIAMIGPMIGFTLGSLFAKLYVDIGFVDLSTIRITPQDSRWVGAWWLGFLVSGLFSIISAIpffFLPG 218
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 264 FPQSLpskemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtKHLLSNPVFTCIVLAACM 343
Cdd:cd17457  219 FFQSL---------------------------------------------------------KSILTNRLYVMFVCLTLL 241
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 344 EIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLF 423
Cdd:cd17457  242 QVSSFIGFFTYKPKYMEQQYGQSSSKANFLLGVITLPIFASGMFLGGYIMKKYKLNTVGAAKFACFTSVMALSFYLLYFF 321
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 424 LGCDTGPVAGVTVAYGNETLQVGQ--TPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGLPAPLSQnlsg 501
Cdd:cd17457  322 IGCENKSVAGITMTYDGNNPVTSHrdVILSYCNSDCNCDESQWDPVCGNNGITYISACLAGCKSSSGNGKPIVFHN---- 397
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 113681162 502 CACI---SGYNDFATAVPGKCPR-PGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17457  398 CSCLevtGSQNRNYSAHLGECPRdDDCSRMFYFYVVIQVLNLFFSALGGTSAYMLIVK 455
MFS_SLCO2_OATP2 cd17401
Solute carrier organic anion transporter 2 family of the Major Facilitator Superfamily of ...
27-555 2.09e-100

Solute carrier organic anion transporter 2 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 2 (SLCO2) or Organic anion transporting polypeptide 2 (OATP2) family contains two subfamilies: OATP2A and OATP2B, each containing one mammalian member, OATP2A1 and OATP2B1, respectively. OATP2A1 (encoded by SLCO2A1) is a lactate/prostaglandin anion exchanger that mediates the release of newly synthesized prostaglandins (PGD2, PGE1, PGE2, PGF2A and PGI2) from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. OATP2B1 (encoded by SLCO2B1) mediates the Na(+)-independent transport of various organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost, as well as endogenous sex steroid conjugates such as dehydroepiandrosterone sulfate (DHEAS). The SLCO2/OATP2 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340959 [Multi-domain]  Cd Length: 440  Bit Score: 315.25  E-value: 2.09e-100
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17401    1 IKVFVLCHGLLQLCQLLYSGYLKSSITTIEKRFGLSSSSSGLLASFNEVGNTILIVFVSYFGSRVHRPRLIGIGGLFLAA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLASQYKitdtwskdqgrdvcsntskadepcgnrantnmmYLLLIGAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17401   81 GAFLLTLPHFISEPYQ---------------------------------YGIMVVAQLLLGIGGVPIQPFGISYIDDFAE 127
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQ 266
Cdd:cd17401  128 PSNSPLYLGILFAVTVFGPAFGYLLGSVMLRLYVDIGRMNTAAVNLVPGDPRWIGAWWLGFLIAAALLVLTSFPYFFFPR 207
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 SLpskemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlRVIPKVTKHLLSNPVFTCIVLAACMEIA 346
Cdd:cd17401  208 FI--------------------------------------------------KRFPCIFLRTLRNPIFLLVVLAQVTLSS 237
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 347 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGC 426
Cdd:cd17401  238 MIAGLATFLNKFLEKQFGTTASYANFLIGAVNLPSAALGILFGGVLMKRLVLSLQAIPAICTTIITISMIFCVPLFFIGC 317
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 427 DTGPVAGVTvaygNETLQVGQTPEAP-CMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGLPAPLSQNLSGCACI 505
Cdd:cd17401  318 STPTIAGVY----PPSSSSSIHPQSPaCRRDCSCPDSIFNPVCGDNGVEYLSPCHAGCSNINMSTSATSKQVIYTNCSCV 393
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|
gi 113681162 506 SGYNdfATAVPGKCPRPgCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17401  394 TGGS--ASAKTGSCPSP-CSHLLLPFIFLISLVSLIACLSHTPSFMMILR 440
MFS_SLCO1_OATP1 cd17400
Solute carrier organic anion transporter 1 family of the Major Facilitator Superfamily of ...
27-555 1.71e-98

Solute carrier organic anion transporter 1 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 1 (SLCO1) or Organic anion transporting polypeptide 1 (OATP1) family contains three subfamilies: OATP1A, OATP1B, and OATP1C. OATP1A contains one human member, OATP1A2, which shows a broad spectrum of substrates including endogenous compounds (such as bile acids, steroid hormones and their conjugates, thyroid hormones) and various drugs (such as fexofenadine, ouabain and the cyanobacterial toxin microcystin). OATP1B contains two human proteins, OATP1B1 and OATP1B3, which can both accept a wide variety of structurally-unrelated compounds as substrates including clinically-important drugs such as hydroxymethylglutaryl (HMG)-CoA reductase inhibitors (statins), angiotensin II receptor blockers (sartans), angiotensin converting enzyme (ACE) inhibitors, and anti-diabetes drugs (glinides). OATP1C contains one mammalian member, OATP1C1, which is also called thyroxine transporter. It mediates the high affinity transport of the thyroid hormones, T4 (3,5,3',5'tetraiodo-L-thyronine or thyroxine), rT3 (3,3'5'-triiodo-L-thyronine), and T3 (3,5,3'tri-iodo-L-thyronine or triiodothyronine). The SLCO1/OATP1 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340958 [Multi-domain]  Cd Length: 436  Bit Score: 309.84  E-value: 1.71e-98
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17400    1 LKMFLLALSCAFVAKTLSGSYMKSMITQIERRFNIPSSLVGFIDGSFEIGNLLVIIFVSYFGTKLHRPKMIGIGCVIMGL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLASQYKITDTWskdqgrdvcsntskadepcgnrantnmMYLLLigAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17400   81 GCFLKALPHFFMNQYEYSLMW---------------------------IYVFV--GNILRGIGETPILPLGISYIDDFAK 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPq 266
Cdd:cd17400  132 EENSPLYIGLVETGAIIGPIIGFLLGSLCAKVYVDIGFVNLDDIIITPTDTRWVGAWWLGFLICGGVSVLTAIPFFFLP- 210
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 slpskemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtkhllsnPVFTCIVLAACMEIA 346
Cdd:cd17400  211 -----------------------------------------------------------------PIYMLFILVSVIQFN 225
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 347 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGC 426
Cdd:cd17400  226 SFVGMITYMPKYLEQQYGQSSSDANFLMGIINIPPIAIGYFIGGLIMKKFKITVKGAAKIGCWLSVLEYLLYLLSFLMTC 305
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 427 DTGPVAGVTVAY--GNETLQVGQTPEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGLPApLSQNLSgCAC 504
Cdd:cd17400  306 ENSSVAGLTTSYegIPPVLYHENDIFSDCNSDCNCPEKIWEPVCGNNGITYLSACLAGCETSIGTGKNI-VFYNCS-CIQ 383
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|...
gi 113681162 505 ISGY-NDFATAVPGKCPR-PGCQEAFLTFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17400  384 TSGNsSANLSLCDGGCPRdPDCSLMFQYFLIISVMSSFIYSLGGIPGYMLLLR 436
MFS_SLCO4C_OATP4C cd17463
Solute carrier organic anion transporter 4C subfamily of the Major Facilitator Superfamily of ...
28-555 7.27e-90

Solute carrier organic anion transporter 4C subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4C (SLCO4C), also called Organic anion-transporting polypeptide 4C (OATP4C), subfamily has one mammalian member, OATP4C1 (encoded by SLCO4C1). It is capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate and cAMP. It is the only OATP expressed at the basolateral side of proximal tubular cells in human kidney and it mediates the excretion of uremic toxins, which accumulate in patients with chronic kidney diseases (CKDs) and cause further progression of renal damage and cardiovascular diseases. Overexpression of human SLCO4C1 in rat kidney promotes the renal excretion of uremic toxins and reduces hypertension, cardiomegaly, and renal inflammation in renal failure. The SLCO4C/OATP4C subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341021 [Multi-domain]  Cd Length: 429  Bit Score: 287.02  E-value: 7.27e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  28 KIFLVAECALMLAQGTVGAYLVSV-LTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17463    2 KGYLLFYSLLAVVQGIVVNGLVNIsISTIEKRYELSSSLTGLISSSYDISFCLLSLFVSFYGERGHKPRWLAFSAFMIGL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLasqykitdtwskdqgrdvcsntskadepcgnrantnmmylLLIGAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17463   82 GSLVFSLPHFF----------------------------------------VFILGQLLLGVGGTPLYTLGTAYIDDSVP 121
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDALFIDTTQLniTPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQ 266
Cdd:cd17463  122 THKSSLYIGIGYGMSVLGPAIGYLLGGQLLNIYIDVNKGQSVDL--TEEDPRWLGAWWIGFLMCWLIAWCLIAPFSCFPK 199
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 SLPSkemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtkhLLSNPVFTCIVLAACMEIA 346
Cdd:cd17463  200 HLPG---------------------------------------------------------LLKNPVFMCLTISSCSEAL 222
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 347 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGC 426
Cdd:cd17463  223 ITTGFATFLPKFIENQFGQTSSFAAILGGLVLIPGAAIGQILGGIIVSKFKLKCKNMIKFAIITTTVSLLLLSVFIFAKC 302
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 427 DTGPVAGVTVAYgNETLQVGQTpEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGLPaplsQNLSGCACIS 506
Cdd:cd17463  303 GNDPFAGVSETY-NGTGKIGNL-TAPCNANCSCLSSFYYPVCGADGVQYFSPCFAGCTNENLHDKK----KVYYNCSCIG 376
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|...
gi 113681162 507 GYNDFATAVPGKCPRPGCQEAFLTFLCVICGCSMIGA----MAQTPSVIILIR 555
Cdd:cd17463  377 NFTEEFSANTTKCEEGKKCETTCKNLPIFLCFFFFVViftfMTSTPITVAILR 429
MFS_SLCO4A_OATP4A cd17462
Solute carrier organic anion transporter 4A subfamily of the Major Facilitator Superfamily of ...
28-535 2.96e-85

Solute carrier organic anion transporter 4A subfamily of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 4A (SLCO4A), also called Organic anion-transporting polypeptide 4A (OATP4A), subfamily has one mammalian member, OATP4A1 (encoded by SLCO4A1). It is ubiquitously expressed and it mediates the Na(+)-independent transport of the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and other organic anions such as estrone sulfate and taurocholate. OATP4A1 is the most abundantly expressed transporter colorectal cancer (CRC) and its role in the transport of estrone sulfate, which is used in hormone replacement therapy (HRT), affects the outcome of the treatment. The SLCO4A/OATP4A subfamily belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341020 [Multi-domain]  Cd Length: 427  Bit Score: 275.17  E-value: 2.96e-85
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  28 KIFLVAECALMLAQG-TVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17462    2 KGVLFFLCAASFLQGmTVNGFINTVITSIERRFDLRSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLIMGL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFlasqykitdtwskdqgrdvcsntskadepcgnranTNMMYllligAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17462   82 GSLVFALPHF-----------------------------------TVFML-----GQFLHGIGATPLYTLGVTYLDENVK 121
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSVCTNFYVDAlfidTTQLNITPDDPRWIGAWWGGFLICGALLFFSALFMFGFPQ 266
Cdd:cd17462  122 SNYSPVYIGIFYTAAIVGPAAGYLLGGFFLNIYTEI----GRQTELTPENPLWVGAWWIGFLGAGAAALLIALPILGYPR 197
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 267 SLPSkemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtkhLLSNPVFTCIVLAACMEIA 346
Cdd:cd17462  198 QLPG---------------------------------------------------------LLKNPTFIFLCLAGATEAT 220
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 347 VVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFlFLGC 426
Cdd:cd17462  221 LIAGMSTFGPKFLESQFSLSASEAATLFGYLVVPAGGGGTFLGGFIVNKLKLRCSGIIKFCLICTVVSLLAIFIF-SLHC 299
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 427 DTGPVAGVTVAYGNETLQVGQTP-EAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGLPAplSQNLSGCACI 505
Cdd:cd17462  300 PNVPMAGVTASYRGSVLPEGSLNlTALCNADCRCLEEIYSPVCGADGLMYYSPCHAGCSEAYSDIRNG--QKVYQDCSCV 377
                        490       500       510
                 ....*....|....*....|....*....|....
gi 113681162 506 SG--YNDFATAVPGKCPRPgCQE--AFLTFLCVI 535
Cdd:cd17462  378 AGnlSVGFGEASAGKCTSN-CNHmpLLLAFVFLV 410
MFS_SLCO6_OATP6 cd17405
Solute carrier organic anion transporter 6 family of the Major Facilitator Superfamily of ...
27-555 6.18e-45

Solute carrier organic anion transporter 6 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 6 (SLCO6) or Organic anion transporting polypeptide 6 (OATP6) family contains only one subfamily, OATP6A, which contains only one human member OATP6A1 (encoded by SLCO6A1). The OATP6 family is the most diverged of the OATPs. OATP6A1 is also called cancer/testis antigen 48 (CT48) or gonad-specific transporter. It is strongly expressed only in normal testis, and weakly in spleen, brain, fetal brain, and placenta. It is found in tumor samples (lung, bladder, and esophageal) and cancer cell lines (lung), and may be of potential use as a target for therapy for a variety of tumor types. The SLCO6/OATP6 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340963 [Multi-domain]  Cd Length: 428  Bit Score: 166.56  E-value: 6.18e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  27 IKIFLVAECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMAL 106
Cdd:cd17405    1 IDGFMILYCILVLIQGAVFGLVDMSIGIFQVQFSLTRTEKYLLDFSYDISSFLVAIIIAHYGSRGNRTRWIAASCFLMGL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 107 GALLSALPEFLasqykitdtwskdqgrdvcsntskadepcgnrantnmmylLLIGAQVLLGIGATPVQPLGVSYIDDHVR 186
Cdd:cd17405   81 GSMLFAFPFFT----------------------------------------FHIAGQCIQGIAGMPIYILGITFIFDNIP 120
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 187 KKDSSLYIGILFSTLVFGPACGFILGSvcTNFYVDalfIDTTQLNITPDD--PRWIGAWWGGFLICGALLFFSALFMFGF 264
Cdd:cd17405  121 TSSAGIYLGIAHSAYLIGYLLGYVGGL--PNFQPP---PNEKSVEIEVNKvyQLWQSGWWKTFLIAAAIAWCTSFPLVCF 195
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 265 PQSLPSkemegvpeseqamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtkhLLSNPVFTCIVLAACME 344
Cdd:cd17405  196 PTSLPG---------------------------------------------------------LLKNPLLLCQAICKATE 218
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 345 IAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFL 424
Cdd:cd17405  219 YLTFIGALEFLPHYLENQFLLTPGIASLLTGAFLIPGGAIGHFLGGLIVSRLEMSCKNKMRFILVTSVISLGLFVLIFFV 298
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 425 GCDTGPVAGVTVAYgNETLQVGQTpEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGlpapLSQNLSGCAC 504
Cdd:cd17405  299 ECQTVTFAGINEDY-DGYGQLGNL-TAPCNEYCDCTSSLYTSICGRDEIEYFSPCFAGCKASKVSN----TEKTYYNCSC 372
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 113681162 505 IS-------GYNDFATAVPGKCpRPGCQEAFLtFLCVICGCSMIGAMAQTPSVIILIR 555
Cdd:cd17405  373 IKeglaaadDEGDFIDAIAGKC-DSKCYKLPL-FFAFYFSATVFSNMCSIPIILIILR 428
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
35-439 1.57e-15

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 79.01  E-value: 1.57e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  35 CALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMALGALLSALP 114
Cdd:cd06174    2 LLGFFLTGLARGLISPLLPALLQSFGLSASQLGLLFALFSLGYALLQPLAGLLADRFGRRPVLLLGLLLFALGALLFAFA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 115 EflasqykitdtwskdqgrdvcsntskadepcgnrantnmMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRKKDSSLYI 194
Cdd:cd06174   82 P---------------------------------------SFWLLLLGRFLLGLGSGLIDPAVLALIADLFPERERGRAL 122
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 195 GILFSTLVFGPACGFILGSVCTNFYVdalfidttqlnitpddprwiGAWWGGFLICGALLFFSALFMFGFPQSLPSKEME 274
Cdd:cd06174  123 GLLQAFGSVGGILGPLLGGILASSLG--------------------FGWRAVFLIAAALALLAAILLLLVVPDPPESARA 182
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 275 GVPESEQAMLPASLsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtKHLLSNPVFTCIVLAACMEIAVVAGFAAF 354
Cdd:cd06174  183 KNEEASSKSVLKLL-------------------------------------KRVLKNPGLWLLLLAIFLVNLAYYSFSTL 225
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 355 LGKYLEQQFNLTTSSANQLLGMTAIpCACLGIFLGGLLVKKlnlsaLGAIRMAMLVNLISTACYVSFLFLGCDTGPVAGV 434
Cdd:cd06174  226 LPLFLLDLGGLSVAVAGLLLSLFGL-AGALGSLLLGLLSDR-----LIGRKPLLLIGLLLMALGLALLLLAPSLLLLLLL 299

                 ....*
gi 113681162 435 TVAYG 439
Cdd:cd06174  300 LLLLG 304
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
449-506 5.93e-15

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650 [Multi-domain]  Cd Length: 54  Bit Score: 69.26  E-value: 5.93e-15
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 113681162 449 PEAPCMSHCNCYTSSVSPVCGSNGVTYLSSCFAGCTRAISTGlpapLSQNLSGCACIS 506
Cdd:cd01330    1 LTSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCTNSTGSG----GSKIYTNCSCVG 54
MFS_1 pfam07690
Major Facilitator Superfamily;
35-425 5.28e-12

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 67.83  E-value: 5.28e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162   35 CALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMALGALLSAlp 114
Cdd:pfam07690   3 LAAFLAALGRSLLGPALPLLLAEDLGISPTEIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL-- 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  115 eFLASqykitdtwskdqgrdvcsntskadepcgnrantnmmYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRKKDSSLYI 194
Cdd:pfam07690  81 -FASS------------------------------------LWLLLVLRVLQGLGAGALFPAAAALIADWFPPEERGRAL 123
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  195 GILFSTLVFGPACGFILGSVCTNFYvdalfidttqlnitpdDPRWIgawwggFLICGALLFFSALFMFGFpqsLPSKEME 274
Cdd:pfam07690 124 GLLSAGFGLGAALGPLLGGLLASLF----------------GWRAA------FLILAILSLLAAVLAALL---LPRPPPE 178
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  275 GVPESEQAMLPASLSQDFekskpsngvvqnyqpnsnslsccqqlrvipkvtKHLLSNPVFTCIVLAACMeIAVVAGFAAF 354
Cdd:pfam07690 179 SKRPKPAEEAPAPLLPAW---------------------------------KLLLRDPVLWLLLALLLF-GFAFFGLLTY 224
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 113681162  355 LGKYLEqQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKklnlsaLGAIRMAMLVNLISTACYVSFLFLG 425
Cdd:pfam07690 225 LPLYQE-VLGLSALLAGLLLGLAGLLGAIGRLLLGRLSDR------LGRRRRLLLALLLLILAALGLLLLS 288
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
30-423 3.80e-07

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 52.96  E-value: 3.80e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  30 FLVAECALMLAQGTVgaylVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMALGAL 109
Cdd:cd17325    1 LSLALFLDMLGYGII----IPILPLYAESLGASVAQIGLIVAAYALAQLLFSPPAGRLSDRFGRKRLLLLGLLLLAVSTL 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 110 LSALpeflasqykitdtwskdqgrdvcsntskadepcgnrANTnmmYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRKKD 189
Cdd:cd17325   77 LFAF------------------------------------ATS---YWQLLLARFLQGLASAAVWPAAMALIADIAPPEE 117
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 190 SSLYIGILFSTLVFGPACGFILGSVCTNFYvdalfidttqlnitpddprwigAWWGGFLICGALLFFSALFMFGFPqslp 269
Cdd:cd17325  118 RGRAMGIFSSAIGLGFLIGPLLGGLLADAL----------------------GYRAPFLVCAALALLALVLALLLL---- 171
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 270 skemegvpeseqamlpaslsQDFEKSKPSNGVvqnyqpnsnslsccQQLRVIPKVTKHLLSNPVFTCIVLAACMEIAvVA 349
Cdd:cd17325  172 --------------------PEPRPPPNKRAV--------------SAARLRSGLRLLLRDRRLLALFLAIFVLAFA-FG 216
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 113681162 350 GFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKklnlsaLGAIRMAMLVNLISTACYVSFLF 423
Cdd:cd17325  217 ALEPFLPLYAAELGGLSPAQIGLLFGAQGLASALSQPPAGKLSDR------IGRKPLILIGLLLSAVALLLLPL 284
KAZAL_FS cd00104
Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit ...
461-485 1.69e-05

Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the cognate enzyme as substrate. The reactive site peptide bond is a combining loop which has an identical conformation in all Kazal inhibitors and in all enzyme/inhibitor complexes. These Kazal domains (small hydrophobic core of alpha/beta structure with 3 to 4 disulfide bonds) often occur in tandem arrays. Similar domains are also present in follistatin (FS) and follistatin-like family members, which play an important role in tissue specific regulation. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a Kazal-like domain and has five disulfide bonds. Although the Kazal-like FS substructure is similar to Kazal proteinase inhibitors, no FS domain has yet been shown to be a proteinase inhibitor. Follistatin-like family members include SPARC, also known as, BM-40 or osteonectin, the Gallus gallus Flik protein, as well as, agrin which has a long array of FS domains. The kazal-type inhibitor domain has also been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The distant homolog, Ascidian trypsin inhibitor, is included in this CD.


Pssm-ID: 238052  Cd Length: 41  Bit Score: 42.26  E-value: 1.69e-05
                         10        20
                 ....*....|....*....|....*
gi 113681162 461 TSSVSPVCGSNGVTYLSSCFAGCTR 485
Cdd:cd00104    2 PKEYDPVCGSDGKTYSNECHLGCAA 26
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
455-504 3.25e-05

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 400135  Cd Length: 50  Bit Score: 41.71  E-value: 3.25e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 113681162  455 SHCNCYTSSVSPVCGSNGVTYLSSC---FAGCTRAISTGLPAPLSQnlsgCAC 504
Cdd:pfam07648   2 CNCQCPKTEYEPVCGSDGVTYPSPCalcAAGCKLGKEVKEEKVKYD----GSC 50
MFS_NepI_like cd17324
Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator ...
36-425 1.53e-04

Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily; This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340882 [Multi-domain]  Cd Length: 370  Bit Score: 44.46  E-value: 1.53e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  36 ALMLAQGTVGA---YLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMALGALLSA 112
Cdd:cd17324    3 ALALAAFAIGTteyVIQGLLPDIARDFGVSVAQAGLLVSAYALGYALGALLLGPLSDRIERRRLLLVLLLLFILGNLLAA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 113 LpeflasqykitdTWSkdqgrdvcsntskadepcgnrantnmmYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRKKDSSL 192
Cdd:cd17324   83 L------------APS---------------------------FALLLLARALAGLAHGGFWAIAAAYAADLVPPEKRGR 123
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 193 YIGILFSTLVFGPACGFILGSvctnfyvdalfidttqlnitpddprWIGAWWG---GFLICGAL-LFFSALFMFGFPQSL 268
Cdd:cd17324  124 AIGLVFSGLTLGLVLGRPLGG-------------------------LLGQLLGwraAFLAIAVLaLLAALLLWRLLPSLP 178
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 269 PSKEMEGVPESEQamlpaslsqdfekskpsngvvqnyqpnsnslsccqqlrvipkvtKHLLSNP-VFTCIVLAACMEIAV 347
Cdd:cd17324  179 PKKPGSLGLLSSL--------------------------------------------LLLLRNPrLRLAYLITFLLFGGF 214
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 113681162 348 VAGFaAFLGKYLEQQFNLTTSSANQLLGMTAIPCAcLGIFLGGLLVKKlnlsalGAIRMAMLVNLISTACYVSFLFLG 425
Cdd:cd17324  215 FALY-TYLAPFLTDVPGFSSSAIIGLLLLFGVAGV-VGSPLAGRLADR------GGRRALLIALLLLAAALLLLTLLG 284
KAZAL smart00280
Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and ...
457-488 7.89e-04

Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and follistatin-like domains.


Pssm-ID: 197624  Cd Length: 46  Bit Score: 37.66  E-value: 7.89e-04
                           10        20        30
                   ....*....|....*....|....*....|..
gi 113681162   457 CNCyTSSVSPVCGSNGVTYLSSCFAGCTRAIS 488
Cdd:smart00280   4 EAC-PREYDPVCGSDGVTYSNECHLCKAACES 34
MFS_MMR_MDR_like cd17504
Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) ...
30-219 6.21e-03

Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This subfamily is composed of putative multidrug resistance (MDR) transporters including Chlamydia trachomatis antiseptic resistance protein QacA_2, and Serratia sp. DD3 Bmr3. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341047 [Multi-domain]  Cd Length: 371  Bit Score: 39.48  E-value: 6.21e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162  30 FLVAECALMLAQgtvgAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAKAHRPRLIGCGGIVMALGAL 109
Cdd:cd17504    1 LALAALAVMLVE----TMLSPALPTIQREFGTSAAAVSWVLTAYLLVGAVSTPILGRLGDLYGRKKVLLIVLAIYTAGSL 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113681162 110 LSALpeflasqykitdtwskdqgrdvcsntskadepcgnrANTnmmYLLLIGAQVLLGIGaTPVQPLGVSYIDDHVRKKD 189
Cdd:cd17504   77 LAAF------------------------------------APN---LPVLIAGRALQGIG-GAVFPLAFALVREEFPPER 116
                        170       180       190
                 ....*....|....*....|....*....|
gi 113681162 190 SSLYIGILFSTLVFGPACGFILGSVCTNFY 219
Cdd:cd17504  117 VPVAQGILSATFGIGAGIGLPLGGWIVQHL 146
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH