NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1152248082|emb|SJZ49276|]
View 

Protein Classification

DUF4998 domain-containing protein (domain architecture ID 12177681)

DUF4998 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DUF4998 pfam16389
Domain of unknown function; This family around 200 residues locates in the N-terminal of some ...
20-230 1.12e-87

Domain of unknown function; This family around 200 residues locates in the N-terminal of some uncharacterized proteins in various Bacteroides and Parabacteroides species. The function of this family remains unknown.


:

Pssm-ID: 318580  Cd Length: 198  Bit Score: 257.59  E-value: 1.12e-87
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1152248082  20 CSKMDDTYQQFLDGGEIIYTGRVDSLKVLPGKNRVLLSWYLVSDPKITTCRVYWNQRGDSTEVPVKRTGGTDTIRLILDK 99
Cdd:pfam16389   1 CTKMDDTYKKYLKGGEIVYPGKVDSLKAFSGYNRVKLTWLLVSDPKITKARIFWNNGKDSLEVPVARTAGVDTISVIIDN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1152248082 100 LPENIYTFQVYTYDNAGHSSVKEEAIGNAYGDAYIATLSNRPVRSAKYDaaKKETTIWWFGVNNQ-VQHVEVLYTNSAGV 178
Cdd:pfam16389  81 LPEGSYTFSIVTYDDEGNKSLPSEVTGTVYGDRYQSSLTNRSIKSAEMD--GNNLTINWSPALAEtVVYTEITYTNNDGK 158
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1152248082 179 ETKVvqradSVPENprdplefRASLKLPDYKAGTSFRFRTAYKPVKIAIDTF 230
Cdd:pfam16389 159 VKTV-----TIPPG-------ETETVLEDYKPGTSFKYRTVYLPEETAIDTF 198
 
Name Accession Description Interval E-value
DUF4998 pfam16389
Domain of unknown function; This family around 200 residues locates in the N-terminal of some ...
20-230 1.12e-87

Domain of unknown function; This family around 200 residues locates in the N-terminal of some uncharacterized proteins in various Bacteroides and Parabacteroides species. The function of this family remains unknown.


Pssm-ID: 318580  Cd Length: 198  Bit Score: 257.59  E-value: 1.12e-87
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1152248082  20 CSKMDDTYQQFLDGGEIIYTGRVDSLKVLPGKNRVLLSWYLVSDPKITTCRVYWNQRGDSTEVPVKRTGGTDTIRLILDK 99
Cdd:pfam16389   1 CTKMDDTYKKYLKGGEIVYPGKVDSLKAFSGYNRVKLTWLLVSDPKITKARIFWNNGKDSLEVPVARTAGVDTISVIIDN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1152248082 100 LPENIYTFQVYTYDNAGHSSVKEEAIGNAYGDAYIATLSNRPVRSAKYDaaKKETTIWWFGVNNQ-VQHVEVLYTNSAGV 178
Cdd:pfam16389  81 LPEGSYTFSIVTYDDEGNKSLPSEVTGTVYGDRYQSSLTNRSIKSAEMD--GNNLTINWSPALAEtVVYTEITYTNNDGK 158
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1152248082 179 ETKVvqradSVPENprdplefRASLKLPDYKAGTSFRFRTAYKPVKIAIDTF 230
Cdd:pfam16389 159 VKTV-----TIPPG-------ETETVLEDYKPGTSFKYRTVYLPEETAIDTF 198
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
50-118 1.23e-03

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 36.71  E-value: 1.23e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1152248082  50 GKNRVLLSWYLVSDP--KITTCRVYWNQRGDSTEVPVKRTGGTDTiRLILDKL-PENIYTFQVYTYDNAGHS 118
Cdd:cd00063    13 TSTSVTLSWTPPEDDggPITGYVVEYREKGSGDWKEVEVTPGSET-SYTLTGLkPGTEYEFRVRAVNGGGES 83
 
Name Accession Description Interval E-value
DUF4998 pfam16389
Domain of unknown function; This family around 200 residues locates in the N-terminal of some ...
20-230 1.12e-87

Domain of unknown function; This family around 200 residues locates in the N-terminal of some uncharacterized proteins in various Bacteroides and Parabacteroides species. The function of this family remains unknown.


Pssm-ID: 318580  Cd Length: 198  Bit Score: 257.59  E-value: 1.12e-87
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1152248082  20 CSKMDDTYQQFLDGGEIIYTGRVDSLKVLPGKNRVLLSWYLVSDPKITTCRVYWNQRGDSTEVPVKRTGGTDTIRLILDK 99
Cdd:pfam16389   1 CTKMDDTYKKYLKGGEIVYPGKVDSLKAFSGYNRVKLTWLLVSDPKITKARIFWNNGKDSLEVPVARTAGVDTISVIIDN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1152248082 100 LPENIYTFQVYTYDNAGHSSVKEEAIGNAYGDAYIATLSNRPVRSAKYDaaKKETTIWWFGVNNQ-VQHVEVLYTNSAGV 178
Cdd:pfam16389  81 LPEGSYTFSIVTYDDEGNKSLPSEVTGTVYGDRYQSSLTNRSIKSAEMD--GNNLTINWSPALAEtVVYTEITYTNNDGK 158
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1152248082 179 ETKVvqradSVPENprdplefRASLKLPDYKAGTSFRFRTAYKPVKIAIDTF 230
Cdd:pfam16389 159 VKTV-----TIPPG-------ETETVLEDYKPGTSFKYRTVYLPEETAIDTF 198
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
50-118 1.23e-03

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 36.71  E-value: 1.23e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1152248082  50 GKNRVLLSWYLVSDP--KITTCRVYWNQRGDSTEVPVKRTGGTDTiRLILDKL-PENIYTFQVYTYDNAGHS 118
Cdd:cd00063    13 TSTSVTLSWTPPEDDggPITGYVVEYREKGSGDWKEVEVTPGSET-SYTLTGLkPGTEYEFRVRAVNGGGES 83
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH