NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|126215547|ref|NP_001075215|]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
106-235 4.89e-04

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15094:

Pssm-ID: 421689 [Multi-domain]  Cd Length: 282  Bit Score: 40.92  E-value: 4.89e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126215547 106 LTLTLMALNTYLAICYPLNSPSFVDSAKYRIL-AGTWTTVILKNVGLFLIegTSPTPASVFQSaplCPVI------LNGM 178
Cdd:cd15094   88 FTLTVMSADRYLAVCHPIRSMRYRTPFIAKVVcATTWSISFLVMLPIILY--ASTVPDSGRYS---CTIVwpdssaVNGQ 162
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 126215547 179 PARVIGMFSLAFL--LSVILVSYCLIYREGKWAGHFNKSNIKARR----TVLVhLLQISLHVI 235
Cdd:cd15094  163 KAFTLYTFLLGFAipLLLISVFYTLVILRLRTVGPKNKSKEKRRShrkvTRLV-LTVISVYII 224
 
Name Accession Description Interval E-value
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
106-235 4.89e-04

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222 [Multi-domain]  Cd Length: 282  Bit Score: 40.92  E-value: 4.89e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126215547 106 LTLTLMALNTYLAICYPLNSPSFVDSAKYRIL-AGTWTTVILKNVGLFLIegTSPTPASVFQSaplCPVI------LNGM 178
Cdd:cd15094   88 FTLTVMSADRYLAVCHPIRSMRYRTPFIAKVVcATTWSISFLVMLPIILY--ASTVPDSGRYS---CTIVwpdssaVNGQ 162
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 126215547 179 PARVIGMFSLAFL--LSVILVSYCLIYREGKWAGHFNKSNIKARR----TVLVhLLQISLHVI 235
Cdd:cd15094  163 KAFTLYTFLLGFAipLLLISVFYTLVILRLRTVGPKNKSKEKRRShrkvTRLV-LTVISVYII 224
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
106-228 8.82e-04

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 39.98  E-value: 8.82e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126215547  106 LTLTLMALNTYLAICYPLNSPSFVDSAK-YRILAGTWTTVILKNVGLFLIEGTSPTP-ASVFQSAPLCPVILNGMPARVI 183
Cdd:pfam00001  74 LLLTAISIDRYLAIVHPLRYRRIRTPRRaKVLILLVWVLALLLSLPPLLFGWTLTVPeGNVTVCLIDFPEDLVKPVSYTL 153
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 126215547  184 GMFSLAFL--LSVILVSYCLIYRE------GKWAGHFNKSNIKARRTVLVHLL 228
Cdd:pfam00001 154 LISVLGFLlpLLVILVCYTRIYRTlrksasKQKSEERTQRRRKALKTLAVVVV 206
 
Name Accession Description Interval E-value
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
106-235 4.89e-04

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222 [Multi-domain]  Cd Length: 282  Bit Score: 40.92  E-value: 4.89e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126215547 106 LTLTLMALNTYLAICYPLNSPSFVDSAKYRIL-AGTWTTVILKNVGLFLIegTSPTPASVFQSaplCPVI------LNGM 178
Cdd:cd15094   88 FTLTVMSADRYLAVCHPIRSMRYRTPFIAKVVcATTWSISFLVMLPIILY--ASTVPDSGRYS---CTIVwpdssaVNGQ 162
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 126215547 179 PARVIGMFSLAFL--LSVILVSYCLIYREGKWAGHFNKSNIKARR----TVLVhLLQISLHVI 235
Cdd:cd15094  163 KAFTLYTFLLGFAipLLLISVFYTLVILRLRTVGPKNKSKEKRRShrkvTRLV-LTVISVYII 224
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
106-228 8.82e-04

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 39.98  E-value: 8.82e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126215547  106 LTLTLMALNTYLAICYPLNSPSFVDSAK-YRILAGTWTTVILKNVGLFLIEGTSPTP-ASVFQSAPLCPVILNGMPARVI 183
Cdd:pfam00001  74 LLLTAISIDRYLAIVHPLRYRRIRTPRRaKVLILLVWVLALLLSLPPLLFGWTLTVPeGNVTVCLIDFPEDLVKPVSYTL 153
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 126215547  184 GMFSLAFL--LSVILVSYCLIYRE------GKWAGHFNKSNIKARRTVLVHLL 228
Cdd:pfam00001 154 LISVLGFLlpLLVILVCYTRIYRTlrksasKQKSEERTQRRRKALKTLAVVVV 206
7tmA_GPRnna14-like cd15001
GPRnna14 and related proteins, member of the class A family of seven-transmembrane G ...
105-208 1.17e-03

GPRnna14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the orphan G-protein coupled receptor GPRnna14 found in body louse (Pediculus humanus humanus) as well as its closely related proteins of unknown function. These receptors are members of the class A rhodopsin-like G-protein coupled receptors. As an obligatory parasite of humans, the body louse is an important vector for human diseases, including epidemic typhus, relapsing fever, and trench fever. GPRnna14 shares significant sequence similarity with the members of the neurotensin receptor family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320132 [Multi-domain]  Cd Length: 266  Bit Score: 39.57  E-value: 1.17e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126215547 105 LLTLTLMALNTYLAICYPLNSPSF--VDSAKyRILAGTWTTVILKNVGLFLIEGTSPTPASVFQSAPLCPVILNGM---P 179
Cdd:cd15001   87 VLTLTAISIERYYVILHPMKAKSFctIGRAR-KVALLIWILSAILASPVLFGQGLVRYESENGVTVYHCQKAWPSTlysR 165
                         90       100
                 ....*....|....*....|....*....
gi 126215547 180 ARVIGMFSLAFLLSVILVSYCLIYREGKW 208
Cdd:cd15001  166 LYVVYLAIVIFFIPLIVMTFAYARDTRKQ 194
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
89-205 1.46e-03

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 39.58  E-value: 1.46e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126215547  89 LCWLVFGAQLSVGEGILLTLTLMALNTYLAICYPLNSPSFVDSAKYRIL-AGTWTTVILKNVGLFLIEGTSPTPASVFQs 167
Cdd:cd00637   70 LCKLLGFLQSVSLLASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLLiALIWLLSLLLALPPLLGWGVYDYGGYCCC- 148
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 126215547 168 aPLCPVILNGMPARVIGMFSLAFL--LSVILVSYCLIYRE 205
Cdd:cd00637  149 -CLCWPDLTLSKAYTIFLFVLLFLlpLLVIIVCYVRIFRK 187
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH