NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|129091|sp|P23267|]
View 

Protein Classification

olfactory receptor (domain architecture ID 11599643)

olfactory receptor is a G-protein coupled receptor (GPCR) that plays a central role in olfaction, the sense of smell; GPCRs transmit physiological signals from the outside of the cell to the inside via G proteins by binding to an extracellular agonist, which induces conformational changes that lead to the activation of heterotrimeric G proteins, which then bind to and activate numerous downstream effector proteins

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_OR cd13954
olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled ...
28-297 3.72e-150

olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


:

Pssm-ID: 320092 [Multi-domain]  Cd Length: 270  Bit Score: 421.89  E-value: 3.72e-150
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd13954   1 ILLFVLFLLIYLLTLLGNLLIILLVRLDSRLHTPMYFFLSNLSFLDICYTSVTVPKMLANLLSGDKTISFSGCLTQLYFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd13954  81 FSLGGTECFLLAVMAYDRYVAICHPLHYPTIMNKRVCILLAAGSWLIGFLNSLIHTVLISQLPFCGSNVINHFFCDIPPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd13954 161 LKLSCSDTSLNELVIFILAGFVGLGSFLLTLVSYIYIISTILKIPSAEGRQKAFSTCASHLTVVSLFYGTIIFMYVRPSS 240
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd13954 241 SYSSDLDKVVSVFYTVVTPMLNPIIYSLRN 270
 
Name Accession Description Interval E-value
7tmA_OR cd13954
olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled ...
28-297 3.72e-150

olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320092 [Multi-domain]  Cd Length: 270  Bit Score: 421.89  E-value: 3.72e-150
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd13954   1 ILLFVLFLLIYLLTLLGNLLIILLVRLDSRLHTPMYFFLSNLSFLDICYTSVTVPKMLANLLSGDKTISFSGCLTQLYFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd13954  81 FSLGGTECFLLAVMAYDRYVAICHPLHYPTIMNKRVCILLAAGSWLIGFLNSLIHTVLISQLPFCGSNVINHFFCDIPPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd13954 161 LKLSCSDTSLNELVIFILAGFVGLGSFLLTLVSYIYIISTILKIPSAEGRQKAFSTCASHLTVVSLFYGTIIFMYVRPSS 240
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd13954 241 SYSSDLDKVVSVFYTVVTPMLNPIIYSLRN 270
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
44-293 3.65e-42

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 145.91  E-value: 3.65e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091      44 GNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGG-VISLAGCATQMYFVFSLGCTEYFLLAVMA 122
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFGLLTLPFWLVYYLLHGDwPFGSALCKLVGALFYVNMYASILLLTAIS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091     123 YDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARlsfCGSRVINHFFCDISPWIVLSCTdtqvvELVS 202
Cdd:pfam00001  81 IDRYLAIVHPLRYRRIRTPRRAKVLILLVWVLALLLSLPPLLFGWT---LTVPEGNVTVCLIDFPEDLVKP-----VSYT 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091     203 FGIAFCVILGSCGITLVSYAYIITTIIKIPSARGR-------HRAFSTCSSHLTVVLIWYGSTIFLHVRTSVESSLDLTK 275
Cdd:pfam00001 153 LLISVLGFLLPLLVILVCYTRIYRTLRKSASKQKSeertqrrRKALKTLAVVVVVFILCWLPYHIVLLLDSLALDCELSR 232
                         250       260
                  ....*....|....*....|....
gi 129091     276 AITVLNTI------VTPVLNPFIY 293
Cdd:pfam00001 233 LLDKALSVtlwlayVNSCLNPIIY 256
 
Name Accession Description Interval E-value
7tmA_OR cd13954
olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled ...
28-297 3.72e-150

olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320092 [Multi-domain]  Cd Length: 270  Bit Score: 421.89  E-value: 3.72e-150
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd13954   1 ILLFVLFLLIYLLTLLGNLLIILLVRLDSRLHTPMYFFLSNLSFLDICYTSVTVPKMLANLLSGDKTISFSGCLTQLYFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd13954  81 FSLGGTECFLLAVMAYDRYVAICHPLHYPTIMNKRVCILLAAGSWLIGFLNSLIHTVLISQLPFCGSNVINHFFCDIPPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd13954 161 LKLSCSDTSLNELVIFILAGFVGLGSFLLTLVSYIYIISTILKIPSAEGRQKAFSTCASHLTVVSLFYGTIIFMYVRPSS 240
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd13954 241 SYSSDLDKVVSVFYTVVTPMLNPIIYSLRN 270
7tmA_OR6C-like cd15912
olfactory receptor subfamily 6C and related proteins, member of the class A family of ...
28-297 7.45e-142

olfactory receptor subfamily 6C and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 6C, 6X, 6J, 6T, 6V, 6M, 9A, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320578  Cd Length: 270  Bit Score: 400.71  E-value: 7.45e-142
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15912   1 ILLFLLLLLTYLLTLLGNLLIITITLVDHRLHTPMYFFLRNFSFLEILFTSVVIPKMLANLLSGKKTISFAGCFAQSFFY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15912  81 FFLGTTEFFLLAVMSFDRYVAICNPLHYPTIMNSRVCLQLVLGSWVGGFLLILPPTILVFQLPFCGPNVINHFFCDSGPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15912 161 LKLSCSDTRLIELLDFILASVVLLGSLLLTIVSYIYIISTILRIPSASGRQKAFSTCASHLTVVSIFYGSCIFMYVRPSQ 240
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15912 241 SSSLDLNKVVALLNTVVTPLLNPFIYTLRN 270
7tmA_OR10A-like cd15225
olfactory receptor subfamily 10A and related proteins, member of the class A family of ...
30-304 1.02e-130

olfactory receptor subfamily 10A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10A, 10C, 10H, 10J, 10V, 10R, 10J, 10W, among others, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320353  Cd Length: 277  Bit Score: 372.94  E-value: 1.02e-130
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15225   3 LFVVFLLIYLVTLLGNLLIILITKVDPALHTPMYFFLRNLSFLEICYTSVIVPKMLVNLLSEDKTISFLGCATQMFFFLF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15225  83 LGGTECFLLAAMAYDRYVAICNPLRYTLIMNRRVCLQLVAGSWLSGILVSLGQTTLIFSLPFCGSNEINHFFCDIPPVLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15225 163 LACADTSLNEIAIFVASVLVILVPFLLILVSYIFIISTILKIPSAEGRRKAFSTCSSHLIVVTLFYGCASFTYLRPKSSY 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15225 243 SPETDKLLSLFYTVVTPMLNPIIYSLRNKEVKGAL 277
7tmA_OR11A-like cd15911
olfactory receptor subfamily 11A and related proteins, member of the class A family of ...
28-297 1.01e-124

olfactory receptor subfamily 11A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 11A and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320577  Cd Length: 270  Bit Score: 357.18  E-value: 1.01e-124
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15911   1 ILLFLLFLVIYIVTMAGNILIIVLVVADRHLHTPMYFFLGNLSCLEICYTSTILPRMLASLLTGDRTISVSGCIVQFYFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15911  81 GSLAATECYLLAVMSYDRYLAICKPLHYASLMNGRLCLQLAAGSWISGFLASTITVILMSQLTFCGPNEIDHFFCDFAPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15911 161 LKLSCSDTSLVELVTFILSSIVTLPPFLLTLTSYICIISTILRIPSTTGRQKAFSTCSSHLIVVTIFYGTLIIVYVVPST 240
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15911 241 NTSRDLNKVFSLFYTVLTPLVNPLIYSLRN 270
7tmA_OR6B-like cd15224
olfactory receptor subfamily 6B and related proteins, member of the class A family of ...
30-297 1.00e-120

olfactory receptor subfamily 6B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 6B, 6A, 6Y, 6P, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320352  Cd Length: 270  Bit Score: 347.35  E-value: 1.00e-120
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15224   3 LFLLFLIAYVLTLLENLLIILTIWLNSQLHKPMYFFLSNLSFLEIWYISVTVPKLLAGFLSQNKSISFVGCMTQLYFFLS 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15224  83 LACTECVLLAVMAYDRYVAICHPLRYPVIMTHQLCVQLAAGSWLSGFLISMIKVYFISQLSFCGPNVINHFFCDISPLLN 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15224 163 LSCTDMSLAELVDFILALIILLVPLLVTVASYICIISTVLRIPSATGRQKAFSTCASHLTVVIIFYSATLFMYARPKAIS 242
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15224 243 SFDSNKLVSVLYTVVTPLLNPIIYCLRN 270
7tmA_OR5-like cd15230
olfactory receptor family 5 and related proteins, member of the class A family of ...
30-297 5.89e-120

olfactory receptor family 5 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 5, some subfamilies from families 8 and 9, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320358  Cd Length: 270  Bit Score: 345.26  E-value: 5.89e-120
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15230   3 LFVLFLLIYLITLVGNLGMIVLIRIDSRLHTPMYFFLSNLSFVDICYSSVITPKMLVNFLSEKKTISFAGCAAQFFFFAV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15230  83 FGTTECFLLAAMAYDRYVAICNPLLYTVIMSKRVCIQLVAGSYLCGFVNSIVHTSSTFSLSFCGSNVINHFFCDIPPLLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15230 163 LSCSDTHINELVLFAFSGFIGLSTLLIILISYLYILITILRIRSAEGRRKAFSTCASHLTAVSLFYGTLIFMYLRPSSSY 242
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15230 243 SLDQDKVVSVFYTVVIPMLNPLIYSLRN 270
7tmA_OR5AP2-like cd15943
olfactory receptor subfamily 5AP2 and related proteins, member of the class A family of ...
15-306 1.48e-114

olfactory receptor subfamily 5AP2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5AP2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320609  Cd Length: 295  Bit Score: 332.41  E-value: 1.48e-114
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    15 FILLGFPGPRSMRIGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGV 94
Cdd:cd15943   2 FILLGLTDNPELQVILFAVFLVIYLITLVGNLGMIVLIRLDSRLHTPMYFFLSHLSFLDLCYSSAITPKMLVNFLAENKT 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    95 ISLAGCATQMYFVFSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGS 174
Cdd:cd15943  82 ISFTGCAAQMYFFVAFATTECFLLAVMAYDRYVAICNPLLYTVIMSPRVCIQLVAGSYLIGFVNALIQTICTFRLPFCGS 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   175 RVINHFFCDISPWIVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIW 254
Cdd:cd15943 162 NVINHFFCDVPPLLKLSCSDTHVNEIVLFAFAIFLGIFTSLEILVSYVYILSAILRIHSSEGRRKAFSTCASHLMAVTIF 241
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|..
gi 129091   255 YGSTIFLHVRTSVESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15943 242 YGTTLFMYLRPSSSYSLDQDKVVSVFYTVVIPMLNPLIYSLRNKEVKDALRR 293
7tmA_OR9K2-like cd15419
olfactory receptor subfamily 9K2 and related proteins, member of the class A family of ...
28-306 1.37e-111

olfactory receptor subfamily 9K2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes transmembrane olfactory receptor subfamily 9K2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320541  Cd Length: 279  Bit Score: 324.26  E-value: 1.37e-111
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15419   1 VLLFLLFLVIYMVTVLGNIGMIIIISTDSRLHTPMYFFLMNLSFLDLCYSSVIAPKALANFLSESKTISYNGCAAQFFFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15419  81 SLFGTTEGFLLAAMAYDRFIAICNPLLYPVIMSRRVCVQLVAGSYLCGCINSIIQTSFTFSLSFCGSNEIDHFFCDVPPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15419 161 LKLSCSDTFINELVMFVLCGLIIVSTILVILVSYAYILSTILRIPSAEGRKKAFSTCASHLTAVSLFYGTVFFMYAQPGA 240
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15419 241 VSSPEQSKVVSVFYTLVIPMLNPLIYSLRNKDVKEALKR 279
7tmA_OR1A-like cd15235
olfactory receptor subfamily 1A and related proteins, member of the class A family of ...
30-304 1.17e-109

olfactory receptor subfamily 1A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 1A, 1B, 1K, 1L, 1Q and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320363  Cd Length: 278  Bit Score: 319.55  E-value: 1.17e-109
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15235   4 LFLLFLAMYLLTLLGNLLIVLLIRSDPRLHTPMYFFLSHLSLVDICFTSTTVPKMLANLLSGSKTISYAGCLAQMYFFIA 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15235  84 FGNTDSFLLAVMAYDRYVAICHPLHYATVMSPKRCLLLVAGSWLLSHLHSLLHTLLMSRLSFCGSNEIPHFFCDLQPLLK 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15235 164 LSCSDTSLNELLIFTEGAVVVLGPFLLIVLSYARILAAVLKVPSAAGRRKAFSTCGSHLTVVALFYGTIIGVYFQPSSSY 243
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15235 244 SADKDRVATVMYTVVTPMLNPFIYSLRNKDVKGAL 278
7tmA_OR8H-like cd15411
olfactory receptor subfamily 8H and related proteins, member of the class A family of ...
28-306 6.80e-109

olfactory receptor subfamily 8H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8H, 8I, 5F and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320533  Cd Length: 279  Bit Score: 317.72  E-value: 6.80e-109
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15411   1 VPLFVLFLVIYVITVMGNLGMILLIRADSQLHTPMYFFLSNLSFVDFCYSSTITPKALENFLSGRKAISFAGCFVQMYFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15411  81 IALATTECFLLGLMAYDRYVAICNPLLYTVVMSRRVCLKLAAGSYAAGFLNSLIHTTLISRLSFCGSNVINHFFCDTPPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15411 161 LKLSCSDTHVNEMLIFILAGLTLVGSLLIILVSYTYILSTILKIRSAEGRRKAFSTCASHLTAVTIFYGTGIFTYLRPSS 240
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15411 241 SYSLGQDKVASVFYTVVIPMLNPLIYSLRNKEVKNALRR 279
7tmA_OR5A1-like cd15417
olfactory receptor subfamily 5A1 and related proteins, member of the class A family of ...
28-306 2.18e-108

olfactory receptor subfamily 5A1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5A1, 5A2, 5AN1, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320539  Cd Length: 279  Bit Score: 316.12  E-value: 2.18e-108
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15417   1 IILFVLFLGIYLVTLLWNLGLIILIRMDSHLHTPMYFFLSNLSFVDICYSSSITPKMLSDFFREQKTISFVGCATQYFVF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15417  81 SGMGLTECFLLAAMAYDRYVAICNPLLYSVIMSPRLCVQLVAGAYLGGFLNSLIQTVSMFQLSFCGPNVIDHFFCDIPPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15417 161 LSLSCSDTFISQVVLFLVAVLFGVFSVLVVLISYGYIISTILKIRSAKGRSKAFNTCASHLTAVTLFYGTGLFVYLRPSS 240
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15417 241 SHSQDQDKVASVFYTVVIPMLNPLIYSLRNKEIKDALKR 279
7tmA_OR5D-like cd15410
olfactory receptor subfamily 5D and related proteins, member of the class A family of ...
15-308 2.12e-107

olfactory receptor subfamily 5D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5D, 5L, 5W, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320532  Cd Length: 294  Bit Score: 314.21  E-value: 2.12e-107
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    15 FILLGFPGPRSMRIGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGV 94
Cdd:cd15410   1 FILLGFTDYPELQVPLFLVFLAIYGITLLGNLGMIVLIKIDPKLHTPMYFFLSHLSFVDFCYSSVIAPKMLVNFLAEDKA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    95 ISLAGCATQMYFVFSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGS 174
Cdd:cd15410  81 ISYSGCMLQFFFFCTFVVTESFLLAVMAYDRYVAICNPLLYTVIMSRKLCVLLVAGSYLWGIVCSLIHTCGLLRLSFCGS 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   175 RVINHFFCDISPWIVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIW 254
Cdd:cd15410 161 NVINHFFCDLPPLLSLSCSDTYLNELLLFIFGSLNEASTLLIILTSYVFIIVTILRIRSAEGRQKAFSTCASHLTAITIF 240
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....
gi 129091   255 YGSTIFLHVRTSVESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRRTV 308
Cdd:cd15410 241 HGTILFMYCRPSSSYSLDTDKVASVFYTVVIPMLNPLIYSLRNKDVKDALRKLI 294
7tmA_OR5V1-like cd15231
olfactory receptor subfamily 5V1 and related proteins, member of the class A family of ...
30-304 8.76e-106

olfactory receptor subfamily 5V1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5V1 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320359  Cd Length: 277  Bit Score: 309.58  E-value: 8.76e-106
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15231   3 LFLIFLIIYLVTLLGNLLIITLVLLDSHLHTPMYFFLSNLSFLDICYTSVTVPKMLVNLLRERKTISYIGCLAQLFFFVS 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15231  83 FVGTECLLLAVMAYDRYVAICNPLHYAVIMSRKVCLQLAAASWLCGFLNSAVHTVLTFRLSFCGSNQISHFFCDIPPLLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15231 163 LSCSDTSLNEVLLLVASVFIGLTPFLFIVISYVYIISTILKIRSAEGRRKAFSTCASHLTVVTLFYGTAIFNYNRPSSGY 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15231 243 SLDKDTLISVLYSIVTPMLNPIIYSLRNKEVKGAL 277
7tmA_OR5AK3-like cd15408
olfactory receptor subfamily 5AK3, 5AU1, and related proteins, member of the class A family of ...
15-301 4.47e-105

olfactory receptor subfamily 5AK3, 5AU1, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5AK3, 5AU1, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320530  Cd Length: 287  Bit Score: 308.10  E-value: 4.47e-105
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    15 FILLGFPGPRSMRIGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGV 94
Cdd:cd15408   1 FILLGFTDQPELQVLLFVVFLLIYVITLVGNLGMILLIRLDSRLHTPMYFFLSHLSFLDICYSSTITPKTLLNLLAERKV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    95 ISLAGCATQMYFVFSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGS 174
Cdd:cd15408  81 ISFTGCLTQLYFYAVFATTECYLLAAMAYDRYVAICNPLLYTVIMSQRVCVSLVAGSYLAGFLNSTVHTGFILRLSFCGS 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   175 RVINHFFCDISPWIVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIW 254
Cdd:cd15408 161 NVINHFFCDGPPLLALSCSDTSLNEMLLFAFVGFNVLTTTLVILISYTYILATILRMRSAEGRHKAFSTCASHLTAVTLF 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*..
gi 129091   255 YGSTIFLHVRTSVESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVK 301
Cdd:cd15408 241 YGSLAFMYLRPSSRYSLDLDKVASVFYTVVIPMLNPLIYSLRNKEVK 287
7tmA_OR8S1-like cd15229
olfactory receptor subfamily 8S1 and related proteins, member of the class A family of ...
30-304 5.81e-105

olfactory receptor subfamily 8S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 8S1 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320357  Cd Length: 277  Bit Score: 307.60  E-value: 5.81e-105
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15229   3 LFLVFLVIYLLTLLGNLLIMLVIRADSHLHTPMYFFLSHLSFLDICYSSVTVPKMLENLLSERKTISVEGCIAQIFFFFF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15229  83 FAGTEAFLLSAMAYDRYAAICHPLHYVQIMSKQVCVQLVGGAWALGFLYALINTLLLLNLHFCGPNEINHFSCELPSLLP 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15229 163 LSCSDTFANKMVLLTSSVIFGLGSFLLTLVSYIHIISTILRIRSAEGRSKAFSTCSSHLTVVGLFYGTGFFRYLRPNSAS 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15229 243 SSVLDRVFSIQYSILTPMLNPIIYSLKNKEVKAAL 277
7tmA_OR14-like cd15227
olfactory receptor family 14 and related proteins, member of the class A family of ...
31-297 7.67e-103

olfactory receptor family 14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 14 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320355  Cd Length: 270  Bit Score: 301.68  E-value: 7.67e-103
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    31 FLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFSL 110
Cdd:cd15227   4 FVLFLLIYLAALTGNLLIITVVTLDHHLHTPMYFFLKNLSFLDLCYISVTVPKSIANSLTNTRSISFLGCVAQVFLFIFF 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   111 GCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIVL 190
Cdd:cd15227  84 AASELALLTVMAYDRYVAICHPLHYEVIMNRGACVQMAAASWLSGLLYGALHTANTFSLPFCGSNVIHQFFCDIPQLLKL 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   191 SCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVESS 270
Cdd:cd15227 164 SCSDTYLNEIGVLVLSVCLGLGCFVFIIVSYVHIFSTVLRIPSAQGRSKAFSTCLPHLIVVSLFLSTGSFAYLKPPSDSP 243
                       250       260
                ....*....|....*....|....*..
gi 129091   271 LDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15227 244 SLLDLLLSVFYSVVPPTLNPIIYSLRN 270
7tmA_OR2-like cd15237
olfactory receptor family 2 and related proteins, member of the class A family of ...
30-297 3.26e-102

olfactory receptor family 2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 2 and 13, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320365  Cd Length: 270  Bit Score: 300.35  E-value: 3.26e-102
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15237   3 LFILFLLIYLLTLLGNGLIILLIWLDSRLHTPMYFFLSNLSLLDICYTTSTVPQMLVHLLSEHKTISFVGCAAQMFFFLA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15237  83 LGVTECVLLAVMAYDRYVAICNPLRYSVIMSRRVCVRLAATSWASGFLNSLVLTSLTLRLPFCGPNHINHFFCEAPAVLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15237 163 LACADTSLNEAVIFVTSVLVLLIPFSLILASYIRILATILRIQSAEGRKKAFSTCASHLTVVTLFYGTAIFMYMRPHSTH 242
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15237 243 SPDQDKMISVFYTIVTPMLNPLIYSLRN 270
7tmA_OR1_7-like cd15918
olfactory receptor families 1, 7, and related proteins, member of the class A family of ...
30-297 2.53e-100

olfactory receptor families 1, 7, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 1 and 7, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320584  Cd Length: 270  Bit Score: 295.29  E-value: 2.53e-100
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15918   3 LFGLFLGMYLVTVLGNLLIILAIGSDSHLHTPMYFFLANLSLVDICFTSTTVPKMLVNIQTQSKSISYAGCLTQMYFFLL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15918  83 FGDLDNFLLAVMAYDRYVAICHPLHYTTIMSPRLCILLVAASWVITNLHSLLHTLLMARLSFCASNEIPHFFCDLNPLLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15918 163 LSCSDTHLNELVILVLGGLVGLVPFLCILVSYVRIVSAVLRIPSAGGKWKAFSTCGSHLSVVSLFYGTVIGVYLSPPSSH 242
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15918 243 SASKDSVAAVMYTVVTPMLNPFIYSLRN 270
7tmA_OR5H-like cd15409
olfactory receptor subfamily 5H and related proteins, member of the class A family of ...
30-306 2.54e-100

olfactory receptor subfamily 5H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5H, 5K, 5AC, 5T and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320531  Cd Length: 279  Bit Score: 295.86  E-value: 2.54e-100
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15409   3 LFLVFLAIYLITLVGNLGLIALIWKDSHLHTPMYFFLGNLAFADACTSSSVTPKMLVNFLSKNKMISFSGCAAQFFFFGF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15409  83 SATTECFLLAAMAYDRYVAICNPLLYPVVMSNRLCVQLITASYIGGFLHSMIHVGLTFRLSFCGSNEINHFFCDIPPLLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15409 163 ISCTDPSINELVLFIFSGSIQVFTILTVLISYSYILFTILKMKSAEGRRKAFSTCGSHLLSVSLFYGSLFFMYVRPSSLY 242
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15409 243 ALDQDMMDSLFYTIVIPLLNPFIYSLRNKEVIDALRK 279
7tmA_OR2F-like cd15429
olfactory receptor subfamily 2F and related proteins, member of the class A family of ...
28-304 2.72e-100

olfactory receptor subfamily 2F and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2F and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320546 [Multi-domain]  Cd Length: 277  Bit Score: 295.85  E-value: 2.72e-100
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15429   1 LGLFVLFLVMYLLTLLGNFLIILLIRLDPRLHTPMYFFLSHLSFLDICYTTSVVPQMLAHFLAEHKTISFASCVAQLFIS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15429  81 LALGGTEFILLAVMAYDRYVAVCHPLRYTVIMSGGLCIQLAAASWTSGFLNSLVQTAFTFRLPFCGHNTINHFSCELLAV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15429 161 VRLACVDTSLNEVAILVSSVVVLLTPCFLVLLSYIHIISAILRIRSSEGRHKAFSTCASHLTVVSLCYGTAIFTYMRPRS 240
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15429 241 GSSALQEKMISLFYAVVTPMLNPLIYSLRNKEVKGAL 277
7tmA_OR5M-like cd15412
olfactory receptor subfamily 5M and related proteins, member of the class A family of ...
30-306 4.31e-99

olfactory receptor subfamily 5M and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5M and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320534  Cd Length: 279  Bit Score: 292.77  E-value: 4.31e-99
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15412   3 LFVLFLVIYLITLLGNLGMILLIRLDSRLHTPMYFFLSHLSFVDLCYSSNVTPKMLVNFLSEKKTISFAGCFTQCYFFIA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15412  83 LVITEYYMLAVMAYDRYMAICNPLLYSVKMSRRVCISLVTFPYIYGFLNGLIQTILTFRLSFCGSNVINHFYCADPPLIK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15412 163 LSCSDTYVKETAMFIVAGFNLSSSLLIILISYLFILIAILRIRSAEGRCKAFSTCGSHLTAVTIFYGTLFCMYLRPPSEE 242
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15412 243 SVEQSKIVAVFYTFVSPMLNPLIYSLRNKDVKQALKK 279
7tmA_OR6N-like cd15914
olfactory receptor OR6N and related proteins, member of the class A family of ...
30-297 1.01e-97

olfactory receptor OR6N and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 6N, 6K, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320580  Cd Length: 270  Bit Score: 288.89  E-value: 1.01e-97
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15914   3 LFILLLLIYLFIITGNLLIFTVVRLDTHLHTPMYFFISILSFLEIWYTTVTIPKMLSNLLSEEKTISFNGCLLQMYFFHS 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15914  83 LGITECYLLTAMAYDRYLAICNPLHYPSIMTPKLCTQLAAGCWLCGFLGPVPEIILISTLPFCGPNQIQHIFCDFPPLLS 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15914 163 LACTDTSLNVLVDFVIHAVIILLTFLLILLSYVKIISVVLKIPSAEGRQKAFSTCAAHLTVVLLFFGSVSFMYLRLSKSY 242
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15914 243 SLDYDRAIAVVYAVLTPFFNPIIYSLRN 270
7tmA_OR5C1-like cd15945
olfactory receptor subfamily 5C1 and related proteins, member of the class A family of ...
15-306 1.79e-96

olfactory receptor subfamily 5C1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5C1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320611  Cd Length: 292  Bit Score: 286.64  E-value: 1.79e-96
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    15 FILLGFPGPRSMRIGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGV 94
Cdd:cd15945   1 FILLGFTDYLSLKVTLFLVFLLVYLLTLVGNVGMIILIRMDSQLHTPMYYFLSNLSFLDLCYSTAIGPKMLVDLLAKRKS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    95 ISLAGCATQMYFVFSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGS 174
Cdd:cd15945  81 IPFYGCALQMFFFAAFADAECLLLAVMAYDRYVAICNPLLYTTAMSRRVCYLLLVGAYLSGMATSLVHTTLTFRLSFCGS 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   175 RVINHFFCDISPWIVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIW 254
Cdd:cd15945 161 NTINHFFCDIPPLLALSCSDTQINELLLFALCGFIQTSTFLAIIISYCYIIITVLKIRSAEGRFKAFSTCASHLTAVGLF 240
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|..
gi 129091   255 YGSTIFLHVRTSVESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15945 241 YGTLLFMYLRPSSSYSLDTDKMTSVFYTLVIPMLNPLIYSLRNKDVKEALKK 292
7tmA_OR13H-like cd15431
olfactory receptor subfamily 13H and related proteins, member of the class A family of ...
28-297 1.70e-95

olfactory receptor subfamily 13H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 13H and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320548 [Multi-domain]  Cd Length: 269  Bit Score: 283.35  E-value: 1.70e-95
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15431   1 IILFVLLLIVYLVTLLGNGLIILLIRVDSQLHTPMYFFLSNLSFLDICYTTSSVPQMLVNCLSDRPTISYSRCLAQMYIS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPAtLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15431  81 LFLGITECLLLAVMAYDRFVAICNPLRYTLIMSWRVCIQLAAGSWVSAFLLTVIPV-LTMPLHFCGPNVINHFFCEVQAL 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15431 160 LKLACSDTSLNEILMFATSIFTLLLPFSFILVSYIRIGVAVLRIRSAEGRRKAFSTCGSHLTVVTIFYGTAIFMYLRPQS 239
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15431 240 KSSSDQDKIISVFYGVVTPMLNPLIYSLRN 269
7tmA_OR5P-like cd15416
olfactory receptor subfamily 5P and related proteins, member of the class A family of ...
30-306 9.13e-95

olfactory receptor subfamily 5P and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5P and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320538  Cd Length: 279  Bit Score: 281.56  E-value: 9.13e-95
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15416   3 LFVLFLVIYSVTLLGNLSIILLIRISSQLHTPMYFFLSHLAFSDICYSSSVTPKMLVNFLVEKTTISYPGCAAQLCSAAT 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15416  83 FGTVECFLLAAMAYDRYVAICNPLLYSTIMSQKVCVLLVAASYLGGCLNALVFTTCVFSLSFCGPNEINHFFCDFPPLLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15416 163 LSCSDIRLAKILPSISSGIIILVTVLTIIISYLYILIAILRIRSTEGRHKAFSTCASHLTAVTLFYGTITFIYVMPNSSY 242
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15416 243 SMDQNKVVSVFYMVVIPMLNPLIYSLRNKEVKGALKR 279
7tmA_OR5G-like cd15414
olfactory receptor subfamily 5G and related proteins, member of the class A family of ...
28-311 1.00e-94

olfactory receptor subfamily 5G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5G and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320536  Cd Length: 285  Bit Score: 282.01  E-value: 1.00e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15414   1 IPLFLLFLLVYLITLLGNLGMIILIQVDSRLHTPMYFFLSHLSFVDLCYSSVVTPKMLSDFFVEKKAISFLGCAAQMWFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15414  81 GLFVAAECFLLASMAYDRYVAICNPLLYTVIMSQRVCVQLVVGPYVVGLLNTTTHTTAAFFLPFCGPNVINHFFCDIPPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15414 161 LSLSCADTQINKWVLFIMAGALGVLSGLIILVSYIYILIAILRIRSAEGRRKAFSTCSSHLTAVSILYGTLFFIYVRPSS 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRRTVKGK 311
Cdd:cd15414 241 SSSLDLDKVVSVFYTAVIPMLNPLIYSLRNKEVKDALRRTIRRK 284
7tmA_OR11G-like cd15913
olfactory receptor OR11G and related proteins, member of the class A family of ...
30-297 1.12e-94

olfactory receptor OR11G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 11G, 11H, and related proteins in other mammals, and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320579  Cd Length: 270  Bit Score: 281.13  E-value: 1.12e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15913   3 LFSFFSVIYILTLLGNGAIICAVWWDRRLHTPMYILLGNFSFLEICYVTSTVPNMLVNFLSETKTISFSGCFLQFYFFFS 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15913  83 LGTTECFFLSVMAFDRYLAICRPLHYPTIMTGQLCGKLVAFCWVCGFLWFLIPVVLISQLPFCGPNIIDHFLCDPGPLLA 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15913 163 LSCVPAPGTELICYTLSSLIIFGTFLFILGSYTLVLRAVLRVPSAAGRHKAFSTCGSHLAVVSLFYGSVMVMYVSPGSGN 242
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15913 243 STGMQKIVTLFYSVVTPLLNPLIYSLRN 270
7tmA_OR8K-like cd15413
olfactory receptor subfamily 8K and related proteins, member of the class A family of ...
30-306 5.42e-93

olfactory receptor subfamily 8K and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8K, 8U, 8J, 5R, 5AL and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320535  Cd Length: 279  Bit Score: 277.28  E-value: 5.42e-93
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15413   3 LFGLFLVIYLTTVMGNLGMIILTRLDSRLQTPMYFFLRHLAFVDLGYSTAVTPKMLVNFVVEQNTISFYACATQLAFFLT 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15413  83 FIISELFLLSAMAYDRYVAICNPLLYTVIMSQRVCIVLVAIPYLYSFFVALFHTIKTFRLSFCGSNVINHFYCDDLPLLA 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15413 163 LSCSDTHEKELIILIFAGFNLISSLLIVLVSYLFILSAILRIRSAEGRQKAFSTCGSHLTVVTIFYGTLIFMYLQPKSSH 242
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15413 243 SLDTDKMASVFYTLVIPMLNPLIYSLRNKEVKDALKK 279
7tmA_OR8D-like cd15406
olfactory receptor subfamily 8D and related proteins, member of the class A family of ...
26-308 1.11e-92

olfactory receptor subfamily 8D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8D and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320528  Cd Length: 290  Bit Score: 276.94  E-value: 1.11e-92
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    26 MRIGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMY 105
Cdd:cd15406   8 LQLPLFLLFLGIYVVTVVGNLGMILLITLSSQLHTPMYYFLSNLSFIDLCYSSVITPKMLVNFVSEKNIISYPECMTQLF 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   106 FVFSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDIS 185
Cdd:cd15406  88 FFCVFAIAECYMLTAMAYDRYVAICNPLLYNVTMSPRVCSLLVAGVYIMGLIGATVHTSCMLRLSFCGDNVINHYFCDIL 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   186 PWIVLSCTDTQVVELVSFGI-AFCVILGSCGItLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVR 264
Cdd:cd15406 168 PLLKLSCSSTYINELLLFIVgGFNVLATTLAI-LISYAFILSSILRIRSAEGRSKAFSTCSSHLAAVGVFYGSIIFMYLK 246
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....
gi 129091   265 TSVESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRRTV 308
Cdd:cd15406 247 PSSSSSMTQEKVSSVFYTTVIPMLNPLIYSLRNKDVKNALKKVL 290
7tmA_OR2T-like cd15421
olfactory receptor subfamily 2T and related proteins, member of the class A family of ...
30-304 2.33e-92

olfactory receptor subfamily 2T and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamilies 2T, 2M, 2L, 2V, 2Z, 2AE, 2AG, 2AK, 2AJ, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320543  Cd Length: 277  Bit Score: 275.58  E-value: 2.33e-92
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15421   3 LFSLILLIFLVALTGNALLILLIWLDSRLHTPMYFLLSQLSLMDLMLISTTVPKMATNFLSGRKSISFVGCGTQIFFFLT 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15421  83 LGGAECLLLALMAYDRYVAICHPLRYPVLMSPRVCLLMAAGSWLGGSLNSLIHTVYTMHFPYCGSREIHHFFCEVPALLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15421 163 LSCADTSAYETVVYVSGVLFLLIPFSLILASYALILLTVLRMRSAEGRKKALATCSSHLTVVSLYYGPAIFTYMRPGSYH 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15421 243 SPEQDKVVSVFYTILTPMLNPLIYSLRNKEVLGAL 277
7tmA_OR2B-like cd15947
olfactory receptor subfamily 2B and related proteins, member of the class A family of ...
30-297 3.42e-92

olfactory receptor subfamily 2B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 2 (subfamilies 2B, 2C, 2G, 2H, 2I, 2J, 2W, 2Y) and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320613  Cd Length: 270  Bit Score: 274.89  E-value: 3.42e-92
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAII--SLVGAHrcLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15947   3 LFVVVLIFYLLTLLGNTAIIllSLLDPR--LHTPMYFFLSNLSFLDLCFTTSIVPQMLVNLWGPDKTISYGGCVTQLYIF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15947  81 LWLGSTECVLLAVMAFDRYVAVCRPLHYTVIMHPRLCVQLAALSWLSGLANSLLQTTLTLQLPLCGHHTLDHFFCEVPAL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15947 161 IKLACVDTTFNELELFVASVFFLLVPLSLILVSYGFIARAVLRIKSAEGRRKAFGTCSSHLLVVSLFYGTAIYMYLQPPS 240
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15947 241 SYSQDQGKFISLFYTVVTPTLNPLIYTLRN 270
7tmA_OR13-like cd15232
olfactory receptor family 13 and related proteins, member of the class A family of ...
30-297 5.94e-92

olfactory receptor family 13 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 13 (subfamilies 13A1 and 13G1) and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320360  Cd Length: 270  Bit Score: 274.14  E-value: 5.94e-92
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMY-FVF 108
Cdd:cd15232   3 LFWLFLFLYAAALTGNSLIILAISTSPKLHTPMYFFLVNLSLVDIICTSTVVPKLLQNLLTERKTISFGGCMAQLYfFTW 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   109 SLGcTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWI 188
Cdd:cd15232  83 SLG-SELLLLTAMAYDRYVAICHPLHYSTIMRKEVCVGLATGVWAIGMLNSAVHTGLMLRLSFCGPNIINHFFCEIPPLL 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   189 VLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVE 268
Cdd:cd15232 162 LLSCSDTSLNEIMAFVADVFFGVGNFLLTLTSYGFIIRSILRIRSTEGKKKAFSTCSSHLIVVSLYYSTVIYTYIRPSSS 241
                       250       260
                ....*....|....*....|....*....
gi 129091   269 SSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15232 242 YSPEKDKVVAVLYSVVTPTLNPLIYSLRN 270
7tmA_OR2W-like cd15434
olfactory receptor subfamily 2W and related proteins, member of the class A family of ...
30-304 1.25e-91

olfactory receptor subfamily 2W and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2W and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320551  Cd Length: 277  Bit Score: 273.49  E-value: 1.25e-91
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15434   3 LSVVVLIFYLLTLVGNTTIILVSCLDSRLHTPMYFFLANLSFLDLCFTTSIIPQMLVNLWGPDKTISYVGCAIQLFIALG 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15434  83 LGGTECVLLAVMAYDRYAAVCQPLHYTVVMHPRLCWKLVAMSWLIGFGNSLVLSPLTLSLPRCGHHRVDHFFCEMPALIK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15434 163 LACVDTTAYEATIFALGVFILLFPLSLILVSYGYIARAVLKIKSAAGRKKAFGTCGSHLTVVSLFYGTIIYMYLQPKNSV 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15434 243 SQDQGKFLTLFYTIVTPSLNPLIYTLRNKDVKGAL 277
7tmA_OR2A-like cd15420
olfactory receptor subfamily 2A and related proteins, member of the class A family of ...
30-304 7.26e-91

olfactory receptor subfamily 2A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2A and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320542 [Multi-domain]  Cd Length: 277  Bit Score: 271.89  E-value: 7.26e-91
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15420   3 LFGLFSLLYIFTLLGNGLILGLIWLDSRLHTPMYFFLSHLAVVDICYASSTVPHMLGNLLKQRKTISFAGCGTQMYLFLA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15420  83 LAHTECVLLAVMSYDRYVAICHPLRYTVIMNWRVCTTLAATSWACGFLLALVHVVLLLRLPFCGPNEVNHFFCEILAVLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15420 163 LACADTWINEILIFAGCVFILLGPFSLILISYLHILAAILKIQSAEGRRKAFSTCSSHLCVVGLFYGTAMFMYMVPGSSN 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15420 243 SAEQEKILSLFYSLFNPMLNPLIYSLRNKQVKGAL 277
7tmA_OR9G-like cd15418
olfactory receptor subfamily 9G and related proteins, member of the class A family of ...
27-307 1.02e-90

olfactory receptor subfamily 9G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 9G and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320540  Cd Length: 281  Bit Score: 271.66  E-value: 1.02e-90
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    27 RIGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYF 106
Cdd:cd15418   1 QLILFVVFLLSYILTLVGNLTLIALICLDSRLHTPMYFFVGNLSFLDLWYSSVYTPKILADCISKDKSISFAGCAAQFFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   107 VFSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISP 186
Cdd:cd15418  81 SAGLAYSECFLLAAMAYDRYVAICNPLLYSSAMSKKLCMGLVAASYLGGFANAIIHTSNTFRLHFCGDNIIDHFFCDLPP 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   187 WIVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTS 266
Cdd:cd15418 161 LVKLACDDTRVYELILYFILGFNVIAPTALILASYTFILAAILRIHSASGRHKAFSTCSAHLTSVTLYYGSILFIYSRPS 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 129091   267 VESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRRT 307
Cdd:cd15418 241 SSHTPDRDKVVALFYTVVNPLLNPLIYSLRNKDVKEALKKL 281
7tmA_OR12D-like cd15915
olfactory receptor subfamily 12D and related proteins, member of the class A family of ...
30-297 1.98e-90

olfactory receptor subfamily 12D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 12D and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320581  Cd Length: 271  Bit Score: 270.33  E-value: 1.98e-90
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15915   3 LFVLFLLLYLASLLGNGAILAVVIAEPRLHSPMYFFLGNLSCLDIFYSSVTVPKMLAGLLSEHKTISFQGCISQLHFFHF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15915  83 LGSSEAMLLAVMAYDRYVAICNPLRYTVIMNPQVCLLLAVACWVTGFFHALMHTVMTSRLPFCGPNKINHFFCDIKPLLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIP-SARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVE 268
Cdd:cd15915 163 LACGDTSLNLWLLNIVTGSIALGTFILTLLSYIYIISFLLLKVrSKEGRHKAFSTCASHLTVVLLLYGPALFTYIRPSSG 242
                       250       260
                ....*....|....*....|....*....
gi 129091   269 SSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15915 243 DSLEQDRIVALLYTVVTPVLNPLIYTLRN 271
7tmA_OR2_unk cd15424
olfactory receptor family 2, unknown subfamily, member of the class A family of ...
30-304 3.12e-89

olfactory receptor family 2, unknown subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents an unknown subfamily, conserved in some mammalia and sauropsids, in family 2 of olfactory receptors. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320544  Cd Length: 277  Bit Score: 267.76  E-value: 3.12e-89
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15424   3 LFVVILIIYLLTILGNLVIIILVQTDSRLHTPMYFFLSHLAGLEICYVTSTLPQMLAHLLAGNGAISFARCTTQMYIALS 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15424  83 LGSTECLLLGAMAYDRYLAICHPLLYAAAMGRWRQLQLALSCWAIGFLLSVINVGCTLRHPFCGPNHINHFFCELPVVLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15424 163 LACADTHITEAIVFGAGVLILLVPLSVILTSYGLILASVLQMQSAAGRHKAFSTCASHLAVVTLFYGTVISMYMRPRSGS 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15424 243 TPDRDKQIAVFYIVITPLLNPIIYTLRNKDVHGAA 277
7tmA_OR7-like cd15234
olfactory receptor family 7 and related proteins, member of the class A family of ...
30-304 3.88e-89

olfactory receptor family 7 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 7 and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320362  Cd Length: 277  Bit Score: 267.14  E-value: 3.88e-89
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15234   3 LFGLFLSMYLVTVLGNLLIILAVSSDSHLHTPMYFFLSNLSFADICFSSTTVPKMLVNIQTQSKSISYTGCLTQMCFFLL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15234  83 FGGLDNFLLAVMAYDRYVAICHPLHYTVIMNPCLCGLLVLLSLLISILDSLLHSLMVLQLSFCTDVEIPHFFCELAQVLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAfcVILGS---CGItLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTS 266
Cdd:cd15234 163 LACSDTLINNILIYLAT--VIFGGiplSGI-IFSYYKIVSSILRIPSSGGKYKAFSTCGSHLSVVSLFYGTGLGVYISSA 239
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 129091   267 VESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15234 240 VTHSSRKTAVASVMYTVVTPMLNPFIYSLRNKDMKGAL 277
7tmA_OR5B-like cd15407
olfactory receptor subfamily 5B and related proteins, member of the class A family of ...
28-306 4.60e-89

olfactory receptor subfamily 5B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5B and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320529  Cd Length: 279  Bit Score: 267.36  E-value: 4.60e-89
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15407   1 IPLFIIFTLIYLITLVGNLGMILLILLDSRLHTPMYFFLSNLSLVDIGYSSAVTPKVMAGLLTGDKVISYNACAAQMFFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15407  81 VVFATVENFLLASMAYDRHAAVCKPLHYTTTMTTKVCACLTIGCYVCGFLNASIHTGNTFRLSFCKSNVINHFFCDIPPV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15407 161 LALSCSDIHISEIVLFFLASFNVFFALLVILISYLFIFITILRMRSAEGHQKAFSTCASHLTAVSIFYGTVIFMYLQPSS 240
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15407 241 SHSMDTDKMASVFYTMVIPMLNPLVYSLRNKEVKSAFKK 279
7tmA_OR13-like cd15430
olfactory receptor family 13 and related proteins, member of the class A family of ...
30-297 1.27e-88

olfactory receptor family 13 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 13 (subfamilies 13C, 13D, 13F, and 13J), some subfamilies from OR family 2 (2K and 2S), and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320547  Cd Length: 270  Bit Score: 265.77  E-value: 1.27e-88
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15430   3 LFVLCLIMYLVILLGNGVLIIITILDSHLHTPMYFFLGNLSFLDICYTSSSVPLMLVNFLSERKTISFSGCAVQMYLSLA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15430  83 MGSTECVLLAVMAYDRYVAICNPLRYPIIMNKRLCVQMAAGSWVTGFLNSLVETVLAMQLPFCGNNVINHFTCEILAVLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15430 163 LACVDISLNEIIMLVGNIIFLVIPLLLICISYIFILSTILRINSAEGRKKAFSTCSAHLTVVIIFYGTILFMYMKPKSKN 242
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15430 243 AQISDKLITLFYGVVTPMLNPIIYSLRN 270
7tmA_OR5AR1-like cd15944
olfactory receptor subfamily 5AR1 and related proteins, member of the class A family of ...
15-308 1.32e-88

olfactory receptor subfamily 5AR1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5AR1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320610  Cd Length: 294  Bit Score: 266.65  E-value: 1.32e-88
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    15 FILLGFPGPRSMRIGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGV 94
Cdd:cd15944   1 FILLGFTQDPQMQIILFVVFLIIYLVNVVGNLGMIILITTDSQLHTPMYFFLCNLSFCDLGYSSAIAPRMLADFLTKHKV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    95 ISLAGCATQMYFVFSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGS 174
Cdd:cd15944  81 ISFSGCATQFAFFVGFVDAECYVLAAMAYDRYVAICNPLLYSTLMSKRVCLQLMAGSYLAGLVNLVIHTTATFSLSFCGS 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   175 RVINHFFCDISPWIVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIW 254
Cdd:cd15944 161 NIINHFFCDVPPLLALSCSDTHINEILLYVFCGFVEMSSLSIILISYLFILVAILRMRSAEGRRKAFSTCASHFTGVTLF 240
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....
gi 129091   255 YGSTIFLHVRTSVESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRRTV 308
Cdd:cd15944 241 YGTVIFMYLRPTSVYSLDQDKWASVFYTVVIPMLNPLIYSLRNKDVKEAFKKLI 294
7tmA_OR2D-like cd15428
olfactory receptor subfamily 2D and related proteins, member of the class A family of ...
28-304 5.75e-88

olfactory receptor subfamily 2D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2D and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320545 [Multi-domain]  Cd Length: 277  Bit Score: 264.34  E-value: 5.75e-88
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15428   1 ILLFILFLIIYLMTVLGNLLLVLLVIVDSHLHTPMYFFLSNLSVLELCYTTTVVPQMLVHLLSERKIISFIRCAAQLYFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15428  81 LSFGITECALLSVMSYDRYVAICLPLRYSLIMTWKVCISLATGSWVGGLLVSAVDTAFTLNLSFGGHNKINHFLCEMPAL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15428 161 LKLASTDTHQAEMAMFIMCVFTLVLPVLLILASYTRIIYTVFGMQSLTGRLKAFSTCSSHLMVVSLFYGSVLSTYMRPKS 240
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15428 241 STSKEYDKMISVFYIIVTPMLNPLIYSLRNKEVKHAL 277
7tmA_OR10G-like cd15916
olfactory receptor subfamily 10G and related proteins, member of the class A family of ...
30-304 6.73e-87

olfactory receptor subfamily 10G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 10G, 10S, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320582  Cd Length: 276  Bit Score: 261.61  E-value: 6.73e-87
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGG-VISLAGCATQMYFVF 108
Cdd:cd15916   3 LFLIFLIIYLLTVLGNLLILLTVWVDSHLHRPMYIFLGHLSFLDMWLSTVTVPKMLAGFLEPGGkVISFGGCVAQLYFFH 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   109 SLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWI 188
Cdd:cd15916  83 FLGSTECFLYTLMAYDRYLAICHPLHYPTIMTGRLCTRLATGTWVAGSLHSAIHTSLTFRLPFCGPNRIDYFFCDIPPLL 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   189 VLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVE 268
Cdd:cd15916 163 KLACADTTINELVIFASIGVVALGCFILILLSYGNIVRAILRIRTAEGRRRAFSTCASHLIVVLCFYVPCVFIYLRPGSK 242
                       250       260       270
                ....*....|....*....|....*....|....*.
gi 129091   269 SSLDltKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15916 243 EALD--GVIAVFYTVVTPLLNPLIYTLRNKEVKTAL 276
7tmA_OR8B-like cd15405
olfactory receptor subfamily 8B and related proteins, member of the class A family of ...
28-304 2.12e-85

olfactory receptor subfamily 8B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8B and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320527  Cd Length: 277  Bit Score: 257.73  E-value: 2.12e-85
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15405   1 IPLFFLFLGIYVVTVVGNLGLITLICLNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLMNFVSEKNTISYAGCMTQLFFF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15405  81 CFFVISECYVLTAMAYDRYVAICNPLLYTVTMSPQVCSLLMLGSYVMGFAGAMAHTGCMLRLTFCDSNIINHYMCDILPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15405 161 LQLSCTSTYVNELVVFVVVGINIIVPSVTIFISYALILSNILHISSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSS 240
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15405 241 VGSVNQGKVSSVFYTNVVPMLNPLIYSLRNKDVKLAL 277
7tmA_OR5J-like cd15415
olfactory receptor subfamily 5J and related proteins, member of the class A family of ...
30-306 3.50e-84

olfactory receptor subfamily 5J and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5J and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320537  Cd Length: 279  Bit Score: 254.65  E-value: 3.50e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15415   3 LFMLFLLIYFITLLGNLGMIVLIRINPQLHTPMYFFLSNLSFVDLCYSSVFAPRLLVNFLVEKKTISYSACIAQHFFFAV 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15415  83 FVTTEGFLLAVMAYDRYVAICNPLLYTVAMTKRVCVQLVAGSYLGGLINSLTHTIGLLKLSFCGPNVINHYFCDIPPLLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15415 163 LSCSDTHINELLLLTFSGVIAMSTLLTIIISYIFILFAILRIRSAEGRRKAFSTCASHLTAVTLFYGSVSFSYIQPSSQY 242
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRR 306
Cdd:cd15415 243 SLEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKDALKR 279
7tmA_OR10D-like cd15228
olfactory receptor subfamily 10D and related proteins, member of the class A family of ...
30-304 2.54e-83

olfactory receptor subfamily 10D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 10D and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320356 [Multi-domain]  Cd Length: 275  Bit Score: 252.35  E-value: 2.54e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15228   3 LFVLFLAFYLCTLLGNLLILSAILSDPRLHTPMYFFLCNLSVFDIGFSSVSTPKMLAYLWGQSRVISLGGCMSQVFFYHF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15228  83 LGSTECLLYTVMAYDRYVAICHPLRYLLIMNRRVCALLAAGTWITSSFHATILTSLTFTLPYCGSNVVDYFFCDIFPVLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15228 163 LACADTSIAETVSFTNVGLVPLTCFLLILASYVRIVISILKMRSAEGRRKAFSTCSSHLTVVTLFFGPCALIYTQPTPSP 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDltKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15228 243 VLV--TPVQIFNNVVTPMLNPLIYTLRNKEVKAAL 275
7tmA_OR2B2-like cd15432
olfactory receptor subfamily 2B2 and related proteins, member of the class A family of ...
30-304 7.36e-83

olfactory receptor subfamily 2B2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes transmembrane olfactory receptor subfamily 2B2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320549  Cd Length: 277  Bit Score: 251.24  E-value: 7.36e-83
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15432   3 LFVVFLIFYILTLLGNLAIILVSRLDPQLHTPMYFFLSNLSLLDLCYTTSTVPQMLVNLRSPQKTISYGGCVAQLFIFLG 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15432  83 LGSTECVLLAVMAFDRFAAICQPLHYSVIMHQRLCQQLAAGAWISGFANSLVQSTLTLKMPRCGRRRVDHFFCEVPALLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15432 163 LSCVDTTANEAELFVISVLLLLIPLGLILISYIFIVRAVLRIRSAEGRRKAFNTCGSHLLVVSLFYGTAISMYLQPPSNS 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15432 243 SHDRGKMVALFYGIITPMLNPLIYTLRNKDVKEAL 277
7tmA_OR1E-like cd15236
olfactory receptor subfamily 1E and related proteins, member of the class A family of ...
31-304 3.93e-82

olfactory receptor subfamily 1E and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 1E, 1J, and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320364  Cd Length: 277  Bit Score: 249.30  E-value: 3.93e-82
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    31 FLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFSL 110
Cdd:cd15236   4 FALFLAMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDVSFSSVTVPKMLMNMQTQDQSIPYAGCISQMYFFIFF 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   111 GCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIVL 190
Cdd:cd15236  84 GCLDSFLLAVMAYDRYVAICHPLHYTAIMRPELCVLLVAGSWVLTCFHALLHTLLLARLSFCADNVIPHFFCDLVALLKL 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   191 SCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVESS 270
Cdd:cd15236 164 SCSSTSLNELVIFTEGGLLFVLPLLLILGSYIRIAATILKVPSTKGICKAFSTCGSHLSVVFLYYGTIIGVYFFPSSNNS 243
                       250       260       270
                ....*....|....*....|....*....|....
gi 129091   271 LDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15236 244 SDKDIVASVMYTVVTPMLNPFIYSLRNRDIKGAL 277
7tmA_OR10G6-like cd15942
olfactory receptor subfamily 10G6 and related proteins, member of the class A family of ...
30-304 1.86e-80

olfactory receptor subfamily 10G6 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10G6 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320608  Cd Length: 275  Bit Score: 245.04  E-value: 1.86e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15942   3 LFLFFLVVYLLTLSGNSLIILVVISDLQLHKPMYWFLCHLSILDMAVSTVVVPKVIAGFLSGGRIISFGGCVTQLFFFHF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15942  83 LGCAECFLYTVMAYDRFLAICKPLHYSTIMNHRACLCLSLGTWLGGCLHSTFQTSLTFRLPYGQKNEVDYIFCDIPAMLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15942 163 LACADTAFNELVTFIDIGLVAMTCFLLILMSYVYIVSAILKIPSAEGQRRAFSTCTAHLTVVVIYYVPLTFIYLRPGSQD 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDltKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15942 243 PLD--GVVAVFYTTVTPLLNPVIYTLRNKEMKDAL 275
7tmA_OR4A-like cd15939
olfactory receptor 4A and related proteins, member of the class A family of ...
30-297 1.95e-78

olfactory receptor 4A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4A, 4C, 4P, 4S, 4X and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320605  Cd Length: 267  Bit Score: 239.81  E-value: 1.95e-78
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15939   3 CFVVFLLIYLATVLGNLLIVVTIKASQTLGSPMYFFLSYLSFIDICYSSTTAPKLIVDLLSERKTISFNGCMTQLFAEHF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15939  83 FGGAEIFLLTVMAYDRYVAICKPLHYTTIMNRRVCGLLVGVAWVGGFLHSTIQILLTLQLPFCGPNVIDHFFCDLFPLLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVEL--VSFGIAFCVIlgSCGITLVSYAyIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15939 163 LACTDTYVIGLlvVANSGLICLL--SFLILLISYI-VILYSLRTHSSEGRRKALSTCGSHITVVVLFFVPCIFIYMRPVT 239
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDltKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15939 240 TFPID--KVVAVFYTIITPMLNPLIYTLRN 267
7tmA_OR4-like cd15226
olfactory receptor family 4 and related proteins, member of the class A family of ...
28-297 3.86e-78

olfactory receptor family 4 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 4 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320354  Cd Length: 267  Bit Score: 239.03  E-value: 3.86e-78
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15226   1 LFLFVFFSLFYVATVLGNLLIVVTVTSDPHLHSPMYFLLANLSFIDLCLSSFATPKMICDLLREHKTISFGGCMAQIFFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15226  81 HFFGGSEMVLLIAMAFDRYVAICKPLHYLTIMSPRMCILLVVASWIIGFIHSLSQLAFVVNLPFCGPNVVDSFFCDLPLV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKiPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15226 161 IKLACTDTYVLELMVVANSGLISLVCFLLLLISYIVILVTVRK-HSSGGSSKALSTCSAHITVVVLFFGPCIFIYVWPFS 239
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDltKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15226 240 TFPVD--KFLAVFYTVITPLLNPIIYTLRN 267
7tmA_OR10S1-like cd15941
olfactory receptor subfamily 10S1 and related proteins, member of the class A family of ...
30-304 1.20e-75

olfactory receptor subfamily 10S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10S1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320607  Cd Length: 277  Bit Score: 232.82  E-value: 1.20e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQT-PMYFFLCNLSFLEIWFTTACVPKTLATF-APRGGVISLAGCATQMYFV 107
Cdd:cd15941   3 FFLLFLLIYLLTVLGNLLILLTIGSDPHLHGlPMYHFLGHLSFLDACLSSVTVPKVLAGLlTLSGRTISFEGCVVQLYAF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15941  83 HFLASTECFLYTVMAYDRYLAICHPLHYPTAMNRRMCAGLAGGTWATGATHAAIHTSLTFRLPYCGPCQIAYFFCDIPPV 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSv 267
Cdd:cd15941 163 LKLACADTTINELVILANIGIVAAGCFLLIVISYIYIVAAVLRIRTAEGRQRAFSTCSAHLTGVLLYYVPSVFIYLQPS- 241
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   268 eSSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15941 242 -SSQAGAGAPAVFYTIVTPMLNPFIYTLRNKEVKRAL 277
7tmA_OR3A-like cd15233
olfactory receptor subfamily 3A3 and related proteins, member of the class A family of ...
30-304 3.89e-75

olfactory receptor subfamily 3A3 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 3A3 and 3A4, and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320361  Cd Length: 277  Bit Score: 231.61  E-value: 3.89e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15233   3 LFVTFLLAYIVTIGGNLSILAAILLEPKLHTPMYFFLGNLSLLDIGCISVTVPQMLVHLLSHKRTISYAACLSQLFFFHL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15233  83 LAGADCFLLTAMAYDRYLAICQPLTYSVRMSWRVQTALVGISCACAFTNALTHTVAMSTLKFCGPNVINHFFCDLPPLFQ 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15233 163 LSCSSTHLNELLLFVFAFFMALAPCVLIVVSYAHVVAAVLRIRSAEGRRKAFSTCGSHLTVVCIFYGTGVFSYMRLGSVY 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15233 243 SSDKDKVIGILNTVLSPMLNPLIYSLRNKDVKGAL 277
7tmA_OR4D-like cd15936
olfactory receptor 4D and related proteins, member of the class A family of ...
30-297 1.49e-74

olfactory receptor 4D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4D and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320602  Cd Length: 267  Bit Score: 229.91  E-value: 1.49e-74
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15936   3 LFLVFLLVYLTTWLGNLLIIITVISDPHLHTPMYFLLANLAFLDISFSSVTAPKMLSDLLSQTKTISFNGCMAQMFFFHF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15936  83 TGGAEVFLLSVMAYDRYIAIHKPLHYLTIMNQGVCTGLVAGSWLGGFAHSIVQVALLLQLPFCGPNVLDNFYCDVPQVIK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAyIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15936 163 LACTDTFLLELLMVSNSGLVTLLIFFILLISYT-VILVKIRTHVTEGKRKALSTCASQITVVTLIFVPCIYIYARPFQTF 241
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDltKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15936 242 PMD--KAVSVLYTVITPMLNPMIYTLRN 267
7tmA_OR4E-like cd15940
olfactory receptor 4E and related proteins, member of the class A family of ...
28-297 2.99e-74

olfactory receptor 4E and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4E and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320606  Cd Length: 267  Bit Score: 228.87  E-value: 2.99e-74
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15940   1 LAFFMLFLVLYLLTLSGNILIMITIVMDPRLHTPMYFFLSNLSFIDICHSSVTVPKMLSDLLSEEKTISFNGCVTQLFFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15940  81 HLFACTEIFLLTIMAYDRYVAICNPLHYPTVMNHKVCLWLVAALWLGGTVHSLAQTFLTIRLPYCGPNEIDSFFCDVPPV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIpSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSV 267
Cdd:cd15940 161 IKLACTDTYLIDILIVSNSGLISLVCFVALLGSYIVILVSLRKR-STEGRRKALSTCASHLTVVTLFFGPCIFIYTRPST 239
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 ESSLDltKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15940 240 SFSED--KVVSVFYTVVTPLLNPIIYTLRN 267
7tmA_OR1330-like cd15946
olfactory receptor 1330 and related proteins, member of the class A family of ...
30-297 1.10e-73

olfactory receptor 1330 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes olfactory receptors 1330 from mouse, Olr859 from rat, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320612  Cd Length: 270  Bit Score: 227.75  E-value: 1.10e-73
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15946   3 LFAVFLLIYLSILLGNGLIITLICLDSRLHTPMYFFLSVLSLLDMSYVTTTVPQMLVHLLSHKKTISFTGCVAQMYIFLA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15946  83 LGITECTLFSVMAYDRYVAICHPLRYKVIMSWGLCILMVAGSWVCGVFSSLLHTFFTMRLPYCGPNEINHYFCEVPAVLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15946 163 LACADTSLNEMVDFVLGVIVLVVPLSLILASYVNIFKAILKIRSTQGRCKAFSTCASHITVVTMFYGPAMFMYMRPGSNY 242
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15946 243 SPERDKKISLFYNVFTALLNPVIYSLRN 270
7tmA_OR2Y-like cd15433
olfactory receptor subfamily 2Y and related proteins, member of the class A family of ...
30-304 1.08e-69

olfactory receptor subfamily 2Y and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2Y, 2I, and related protein in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320550  Cd Length: 277  Bit Score: 217.74  E-value: 1.08e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15433   3 LFVVVLIFYLLTLVGNTIIILLSVRDLRLHTPMYYFLCHLSFVDLCFTTSTVPQLLANLRGPALTITRGGCVAQLFISLA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15433  83 LGSAECVLLAVMAFDRYAAVCRPLHYAALMSPRLCQTLASISWLSGFVNSVAQTGLLAERPLCGHRLLDHFFCEMPVFLK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15433 163 LACGDDETTEVQMFVARVVILLLPAALILGSYGHVAHAVLRIKSSAGRRRAFGTCGSHLMVVFLFYGSAIYTYLQPIHRY 242
                       250       260       270
                ....*....|....*....|....*....|....*
gi 129091   270 SLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15433 243 SQAHGKFVSLFYTVMTPALNPLIYTLRNKDVKGAL 277
7tmA_OR4Q2-like cd15938
olfactory receptor 4Q2 and related proteins, member of the class A family of ...
28-297 1.75e-64

olfactory receptor 4Q2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 4Q2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320604  Cd Length: 265  Bit Score: 203.95  E-value: 1.75e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    28 IGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFV 107
Cdd:cd15938   1 ALLFALFLLAYTMVLVGNLLIMVTVRSDPKLSSPMYFLLGNLSFLDLCYSTVTCPKMLVDFLSQRKAISYEACIAQLFFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   108 FSLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPW 187
Cdd:cd15938  81 HFVGAAEMFLLTVMAYDRYVAICKPLHYTTIMSRRLCWVLVAASWAGGFLHSIVQTLLTIQLPFCGPNQVNNFFCDVPPV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   188 IVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIittIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSv 267
Cdd:cd15938 161 IKLACTDTCVTELLMVSNSGLISTVCFVVLVTSYTTI---LVTIRSTEGRRKALSTCASHLMVVTLFFGPCIFIYARPF- 236
                       250       260       270
                ....*....|....*....|....*....|
gi 129091   268 eSSLDLTKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15938 237 -STFPVDKHVSVLYNVITPMLNPLIYTLRN 265
7tmA_OR4Q3-like cd15935
olfactory receptor 4Q3 and related proteins, member of the class A family of ...
30-297 1.74e-62

olfactory receptor 4Q3 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 4Q3 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320601  Cd Length: 268  Bit Score: 198.83  E-value: 1.74e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAH-RCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVF 108
Cdd:cd15935   3 LFVLVLACYAAILLGNLLIVVTVHADpHLLQSPMYFFLANLSLIDMTLGSVAVPKVLADLLTCGRTISFGGCMAQLFFLH 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   109 SLGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWI 188
Cdd:cd15935  83 FLGGSEMLLLTLMAYDRYVAICHPLRYLAVMNRQLCIKLLAACWAGGFLHSATQAALVLRLPFCGPNELDNFYCDVPQVI 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   189 VLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTiIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVE 268
Cdd:cd15935 163 KLACMDTYVVEVLMVANSGLLSLVCFLVLLVSYGIILTT-LRGRFREGGGKALSTCSSHLTVVSLIFVPCIFVYLRPFSS 241
                       250       260
                ....*....|....*....|....*....
gi 129091   269 SSLDltKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15935 242 SSVD--KVASVFYTLITPALNPLIYTLRN 268
7tmA_OR4N-like cd15937
olfactory receptor 4N, 4M, and related proteins, member of the class A family of ...
30-297 8.61e-62

olfactory receptor 4N, 4M, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4N, 4M, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320603  Cd Length: 267  Bit Score: 197.27  E-value: 8.61e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15937   3 LFVLFLLFYLIILPGNILIILTIQGDPQLGSPMYFFLANLALLDICYSSITPPKMLADFFSERKTISYGGCMAQLFFLHF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15937  83 LGAAEMFLLVAMAYDRYVAICKPLHYTTVVNRRVCCVLVGASWAGGFIHSIIQVALIIRLPFCGPNVLDNFFCDITQVIK 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTiIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVES 269
Cdd:cd15937 163 LACTNTYTVELLMFSNSGLVILLCFLLLLISYAFLLAK-LRTHSSKGKSKAASTCITHIIIVFVMFGPAIYIYARPFRSF 241
                       250       260
                ....*....|....*....|....*...
gi 129091   270 SLDltKAITVLNTIVTPVLNPFIYTLRN 297
Cdd:cd15937 242 PMD--KVVAVFHTVIFPLLNPMIYTLRN 267
7tmA_OR56-like cd15223
olfactory receptor family 56 and related proteins, member of the class A family of ...
30-304 1.91e-61

olfactory receptor family 56 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 56 and related proteins in other mammals, sauropsids, and fishes. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320351  Cd Length: 279  Bit Score: 196.74  E-value: 1.91e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    30 LFLLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFS 109
Cdd:cd15223   3 LSLPFLLLYLVALVANSLLLLIIKLERSLHQPMYILLGILAAVDIVLATTILPKMLAIFWFDANTISLPGCFAQMFFIHF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   110 LGCTEYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIV 189
Cdd:cd15223  83 FTAMESSILLVMALDRYVAICKPLRYPSIITKSFILKLVLFALIRSGLLVLPIVVLASQLSYCSSNVIEHCYCDHMALVS 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   190 LSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHV--RTSV 267
Cdd:cd15223 163 LACGDTTINSIYGLAVAWLIVGSDIILIFFSYALILRAVLRLASGEARSKALNTCGSHLIVILFFYTAVLVSSLtyRFGK 242
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 129091   268 ESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEAL 304
Cdd:cd15223 243 TIPPDVHVLLSVLYILIPPALNPIIYGVRTKEIRQGF 279
7tmA_OR52B-like cd15221
olfactory receptor subfamily 52B and related proteins, member of the class A family of ...
34-298 7.81e-54

olfactory receptor subfamily 52B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor (OR) subfamilies 52B, 52D, 52H and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320349  Cd Length: 275  Bit Score: 176.71  E-value: 7.81e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    34 FLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFSLGCT 113
Cdd:cd15221   7 FCSMYIVALLGNSLLLFVIVTERSLHEPMYLFLSMLAVTDLLLSTTTVPKMLAIFWFGAGEISFDGCLTQMFFVHFVFVT 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   114 EYFLLAVMAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHFFCDISPWIVLSCT 193
Cdd:cd15221  87 ESAILLAMAFDRYVAICYPLRYTTILTHSVIGKIGVAAVARSFCIVFPFVFLLKRLPYCGHNVIPHTYCEHMGIARLACA 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091   194 DTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVESSLDL 273
Cdd:cd15221 167 DITVNIWYGLTVALLTVGLDVVLIAVSYALILRAVFRLPSKDARLKALSTCGSHVCVILMFYTPAFFSFLTHRFGRHIPR 246
                       250       260
                ....*....|....*....|....*..
gi 129091   274 TKAITVLN--TIVTPVLNPFIYTLRNK 298
Cdd:cd15221 247 HVHILLANlyVLVPPMLNPIVYGVKTK 273
7tmA_OR52I-like cd15950
olfactory receptor subfamily 52I and related proteins, member of the class A family of ...
32-300 1.01e-52

olfactory receptor subfamily 52I and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52I and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320616  Cd Length: 275  Bit Score: 174.14  E-value: 1.01e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 129091    32 LLFLVMYLLTVVGNLAIISLVGAHRCLQTPMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFSLG 111
Cdd:cd15950   5 IP<