NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1375022908|ref|NP_001349032|]
View 

Protein Classification

guanine nucleotide exchange factor (domain architecture ID 10153535)

Ras-GEF domain-containing protein functions as a guanine nucleotide exchange factor (GEF) that activates GTPase by mediating the replacement of GDP with GTP

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RasGEF pfam00617
RasGEF domain; Guanine nucleotide exchange factor for Ras-like small GTPases.
234-428 7.82e-57

RasGEF domain; Guanine nucleotide exchange factor for Ras-like small GTPases.


:

Pssm-ID: 395492  Cd Length: 179  Bit Score: 186.62  E-value: 7.82e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 234 VLAQQLTHIELERVNSIRPEDLMQIISHMDSLDNhrcrgdmtKTFSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRMLEF 313
Cdd:pfam00617   1 ELARQLTLIEFELFRKIKPRELLGYAWSKKDKKK--------ASPNIEAMIARFNKLSNWVASEILSEEDPKKRAKVIKK 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 314 FIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVK---TAKFDVLEHHMDPSSNFCNYRTALQGATQRsqtanss 390
Cdd:pfam00617  73 FIKIAEHCRELNNFNSLMAILSGLNSSPISRLKKTWELVSkkyKKLLEELEKLMSPSRNFKNYREALSSASPP------- 145
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 1375022908 391 rekiVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFW 428
Cdd:pfam00617 146 ----CIPFLGLYLKDLTFIEEGNPDFLEDGLINFEKRR 179
REM cd06224
Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal domain (RasGef_N), also ...
57-163 1.50e-20

Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal domain (RasGef_N), also called REM domain (Ras exchanger motif). This domain is common in nucleotide exchange factors for Ras-like small GTPases and is typically found immediately N-terminal to the RasGef (Cdc25-like) domain. REM contacts the GTPase and is assumed to participate in the catalytic activity of the exchange factor. Proteins with the REM domain include Sos1 and Sos2, which relay signals from tyrosine-kinase mediated signalling to Ras, RasGRP1-4, RasGRF1,2, CNrasGEF, and RAP-specific nucleotide exchange factors, to name a few.


:

Pssm-ID: 100121  Cd Length: 122  Bit Score: 87.08  E-value: 1.50e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  57 SLEALMEHLVPTVDYyPDRTYIFTFLLSSRVFMPPHDLLARVGQICLEQRQQLEAGPEKAKLKSFST--KIVQLLKEWTE 134
Cdd:cd06224     1 TLEALIEHLTSTFDM-PDPSFVSTFLLTYRSFTTPTELLEKLIERYEIAPPENLEYNDWDKKKSKPIrlRVLNVLRTWVE 79
                          90       100       110
                  ....*....|....*....|....*....|
gi 1375022908 135 AFPYDFQ-DEKVMAELKAIAHRVTQCDEYL 163
Cdd:cd06224    80 NYPYDFFdDEELLELLEEFLNRLVQEGALL 109
 
Name Accession Description Interval E-value
RasGEF pfam00617
RasGEF domain; Guanine nucleotide exchange factor for Ras-like small GTPases.
234-428 7.82e-57

RasGEF domain; Guanine nucleotide exchange factor for Ras-like small GTPases.


Pssm-ID: 395492  Cd Length: 179  Bit Score: 186.62  E-value: 7.82e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 234 VLAQQLTHIELERVNSIRPEDLMQIISHMDSLDNhrcrgdmtKTFSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRMLEF 313
Cdd:pfam00617   1 ELARQLTLIEFELFRKIKPRELLGYAWSKKDKKK--------ASPNIEAMIARFNKLSNWVASEILSEEDPKKRAKVIKK 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 314 FIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVK---TAKFDVLEHHMDPSSNFCNYRTALQGATQRsqtanss 390
Cdd:pfam00617  73 FIKIAEHCRELNNFNSLMAILSGLNSSPISRLKKTWELVSkkyKKLLEELEKLMSPSRNFKNYREALSSASPP------- 145
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 1375022908 391 rekiVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFW 428
Cdd:pfam00617 146 ----CIPFLGLYLKDLTFIEEGNPDFLEDGLINFEKRR 179
RasGEF smart00147
Guanine nucleotide exchange factor for Ras-like small GTPases;
231-479 7.14e-52

Guanine nucleotide exchange factor for Ras-like small GTPases;


Pssm-ID: 214539  Cd Length: 242  Bit Score: 175.90  E-value: 7.14e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  231 DPLVLAQQLTHIELERVNSIRPEDLMQIISHmdsldnhRCRGDMTKTFSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRM 310
Cdd:smart00147   5 DPKELAEQLTLLDFELFRKIDPSELLGSVWG-------KRSKKSPSPLNLEAFIRRFNEVSNWVATEILKQTTPKDRAEL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  311 LEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKV--KTAK-FDVLEHHMDPSSNFCNYRTALQGATQrsqta 387
Cdd:smart00147  78 LSKFIQVAKHCRELNNFNSLMAIVSALSSSPISRLKKTWEKLpsKYKKlFEELEELLSPERNYKNYREALSSCNL----- 152
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  388 nssreKIVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFWEISRQIHEFMTWTQVECPFEKDKK-IQSYV--LTAPIYS 464
Cdd:smart00147 153 -----PPCIPFLGVLLKDLTFIDEGNPDFLENGLVNFEKRRQIAEILREIRQLQSQPYNLRPNRSdIQSLLqqLLDHLDE 227
                          250
                   ....*....|....*
gi 1375022908  465 EEALFIASFESEGPE 479
Cdd:smart00147 228 EEELYQLSLKIEPRV 242
RasGEF cd00155
Guanine nucleotide exchange factor for Ras-like small GTPases. Small GTP-binding proteins of ...
231-474 9.24e-51

Guanine nucleotide exchange factor for Ras-like small GTPases. Small GTP-binding proteins of the Ras superfamily function as molecular switches in fundamental events such as signal transduction, cytoskeleton dynamics and intracellular trafficking. Guanine-nucleotide-exchange factors (GEFs) positively regulate these GTP-binding proteins in response to a variety of signals. GEFs catalyze the dissociation of GDP from the inactive GTP-binding proteins. GTP can then bind and induce structural changes that allow interaction with effectors.


Pssm-ID: 238087  Cd Length: 237  Bit Score: 172.82  E-value: 9.24e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 231 DPLVLAQQLTHIELERVNSIRPEDLMQIISHMDSLDNHRCRgdmtktfSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRM 310
Cdd:cd00155     5 DPKELAEQLTLLDFELFRKIEPFELLGSLWSKKDKNIHLSP-------NLERFIERFNNLSNWVASEILLCTNPKKRARL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 311 LEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKV--KTAK-FDVLEHHMDPSSNFCNYRTALqgatqrsqtA 387
Cdd:cd00155    78 LSKFIQVAKHCRELNNFNSLMAIVSALSSSPISRLKKTWEVLssKLKKlFEELEELVDPSRNFKNYRKLL---------K 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 388 NSSREKIVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFWEISRQIHEFMTWTQVECPFEKDKKIQSYVLT--APIYSE 465
Cdd:cd00155   149 SVGPNPPCVPFLGVYLKDLTFLHEGNPDFLEGNLVNFEKRRKIAEILREIRQLQSNSYELNRDEDILAFLWKllELILNE 228

                  ....*....
gi 1375022908 466 EALFIASFE 474
Cdd:cd00155   229 DELYELSLE 237
REM cd06224
Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal domain (RasGef_N), also ...
57-163 1.50e-20

Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal domain (RasGef_N), also called REM domain (Ras exchanger motif). This domain is common in nucleotide exchange factors for Ras-like small GTPases and is typically found immediately N-terminal to the RasGef (Cdc25-like) domain. REM contacts the GTPase and is assumed to participate in the catalytic activity of the exchange factor. Proteins with the REM domain include Sos1 and Sos2, which relay signals from tyrosine-kinase mediated signalling to Ras, RasGRP1-4, RasGRF1,2, CNrasGEF, and RAP-specific nucleotide exchange factors, to name a few.


Pssm-ID: 100121  Cd Length: 122  Bit Score: 87.08  E-value: 1.50e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  57 SLEALMEHLVPTVDYyPDRTYIFTFLLSSRVFMPPHDLLARVGQICLEQRQQLEAGPEKAKLKSFST--KIVQLLKEWTE 134
Cdd:cd06224     1 TLEALIEHLTSTFDM-PDPSFVSTFLLTYRSFTTPTELLEKLIERYEIAPPENLEYNDWDKKKSKPIrlRVLNVLRTWVE 79
                          90       100       110
                  ....*....|....*....|....*....|
gi 1375022908 135 AFPYDFQ-DEKVMAELKAIAHRVTQCDEYL 163
Cdd:cd06224    80 NYPYDFFdDEELLELLEEFLNRLVQEGALL 109
RasGEF_N pfam00618
RasGEF N-terminal motif; A subset of guanine nucleotide exchange factor for Ras-like small ...
55-146 8.90e-15

RasGEF N-terminal motif; A subset of guanine nucleotide exchange factor for Ras-like small GTPases appear to possess this motif/domain N-terminal to the RasGef (Cdc25-like) domain.


Pssm-ID: 395493  Cd Length: 104  Bit Score: 70.03  E-value: 8.90e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  55 SGSLEALMEHLVPTvDYYPDRTYIFTFLLSSRVFMPPHDLLARVGQICLEQRQQLEAGPEKAKLKSFST---KIVQLLKE 131
Cdd:pfam00618   4 AGTLEKLVEYLTST-RIMLDDSFLSTFLLTYRSFTTPAELLELLIERYNIPPPLDLSSDSYWISKKTLPiriRVLSVLRH 82
                          90
                  ....*....|....*
gi 1375022908 132 WTEAFPYDFQDEKVM 146
Cdd:pfam00618  83 WVENYFSDFNDDPVL 97
RasGEFN smart00229
Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal motif; A subset of guanine ...
49-158 7.94e-12

Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal motif; A subset of guanine nucleotide exchange factor for Ras-like small GTPases appear to possess this domain N-terminal to the RasGef (Cdc25-like) domain. The recent crystal structureof Sos shows that this domain is alpha-helical and plays a "purely structural role" (Nature 394, 337-343).


Pssm-ID: 214571  Cd Length: 127  Bit Score: 62.35  E-value: 7.94e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908   49 QDGRLTSGSLEALMEHLVPTvDYYPDRTYIFTFLLSSRVFMPPHDLLARVGQ--ICLEQRQQLEAGPEKAKLKSfstKIV 126
Cdd:smart00229   1 DGGLIKGGTLEALIEHLTEA-FDKADPSFVETFLLTYRSFITTQELLQLLLYryNAIPPESWVEEKVNPRRVKN---RVL 76
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1375022908  127 QLLKEWTEAFPYDFQDEKVMAE-LKAIAHRVTQ 158
Cdd:smart00229  77 NILRTWVENYWEDFEDDPKLISfLLEFLELVDD 109
 
Name Accession Description Interval E-value
RasGEF pfam00617
RasGEF domain; Guanine nucleotide exchange factor for Ras-like small GTPases.
234-428 7.82e-57

RasGEF domain; Guanine nucleotide exchange factor for Ras-like small GTPases.


Pssm-ID: 395492  Cd Length: 179  Bit Score: 186.62  E-value: 7.82e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 234 VLAQQLTHIELERVNSIRPEDLMQIISHMDSLDNhrcrgdmtKTFSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRMLEF 313
Cdd:pfam00617   1 ELARQLTLIEFELFRKIKPRELLGYAWSKKDKKK--------ASPNIEAMIARFNKLSNWVASEILSEEDPKKRAKVIKK 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 314 FIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVK---TAKFDVLEHHMDPSSNFCNYRTALQGATQRsqtanss 390
Cdd:pfam00617  73 FIKIAEHCRELNNFNSLMAILSGLNSSPISRLKKTWELVSkkyKKLLEELEKLMSPSRNFKNYREALSSASPP------- 145
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 1375022908 391 rekiVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFW 428
Cdd:pfam00617 146 ----CIPFLGLYLKDLTFIEEGNPDFLEDGLINFEKRR 179
RasGEF smart00147
Guanine nucleotide exchange factor for Ras-like small GTPases;
231-479 7.14e-52

Guanine nucleotide exchange factor for Ras-like small GTPases;


Pssm-ID: 214539  Cd Length: 242  Bit Score: 175.90  E-value: 7.14e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  231 DPLVLAQQLTHIELERVNSIRPEDLMQIISHmdsldnhRCRGDMTKTFSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRM 310
Cdd:smart00147   5 DPKELAEQLTLLDFELFRKIDPSELLGSVWG-------KRSKKSPSPLNLEAFIRRFNEVSNWVATEILKQTTPKDRAEL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  311 LEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKV--KTAK-FDVLEHHMDPSSNFCNYRTALQGATQrsqta 387
Cdd:smart00147  78 LSKFIQVAKHCRELNNFNSLMAIVSALSSSPISRLKKTWEKLpsKYKKlFEELEELLSPERNYKNYREALSSCNL----- 152
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  388 nssreKIVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFWEISRQIHEFMTWTQVECPFEKDKK-IQSYV--LTAPIYS 464
Cdd:smart00147 153 -----PPCIPFLGVLLKDLTFIDEGNPDFLENGLVNFEKRRQIAEILREIRQLQSQPYNLRPNRSdIQSLLqqLLDHLDE 227
                          250
                   ....*....|....*
gi 1375022908  465 EEALFIASFESEGPE 479
Cdd:smart00147 228 EEELYQLSLKIEPRV 242
RasGEF cd00155
Guanine nucleotide exchange factor for Ras-like small GTPases. Small GTP-binding proteins of ...
231-474 9.24e-51

Guanine nucleotide exchange factor for Ras-like small GTPases. Small GTP-binding proteins of the Ras superfamily function as molecular switches in fundamental events such as signal transduction, cytoskeleton dynamics and intracellular trafficking. Guanine-nucleotide-exchange factors (GEFs) positively regulate these GTP-binding proteins in response to a variety of signals. GEFs catalyze the dissociation of GDP from the inactive GTP-binding proteins. GTP can then bind and induce structural changes that allow interaction with effectors.


Pssm-ID: 238087  Cd Length: 237  Bit Score: 172.82  E-value: 9.24e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 231 DPLVLAQQLTHIELERVNSIRPEDLMQIISHMDSLDNHRCRgdmtktfSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRM 310
Cdd:cd00155     5 DPKELAEQLTLLDFELFRKIEPFELLGSLWSKKDKNIHLSP-------NLERFIERFNNLSNWVASEILLCTNPKKRARL 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 311 LEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKV--KTAK-FDVLEHHMDPSSNFCNYRTALqgatqrsqtA 387
Cdd:cd00155    78 LSKFIQVAKHCRELNNFNSLMAIVSALSSSPISRLKKTWEVLssKLKKlFEELEELVDPSRNFKNYRKLL---------K 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908 388 NSSREKIVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFWEISRQIHEFMTWTQVECPFEKDKKIQSYVLT--APIYSE 465
Cdd:cd00155   149 SVGPNPPCVPFLGVYLKDLTFLHEGNPDFLEGNLVNFEKRRKIAEILREIRQLQSNSYELNRDEDILAFLWKllELILNE 228

                  ....*....
gi 1375022908 466 EALFIASFE 474
Cdd:cd00155   229 DELYELSLE 237
REM cd06224
Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal domain (RasGef_N), also ...
57-163 1.50e-20

Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal domain (RasGef_N), also called REM domain (Ras exchanger motif). This domain is common in nucleotide exchange factors for Ras-like small GTPases and is typically found immediately N-terminal to the RasGef (Cdc25-like) domain. REM contacts the GTPase and is assumed to participate in the catalytic activity of the exchange factor. Proteins with the REM domain include Sos1 and Sos2, which relay signals from tyrosine-kinase mediated signalling to Ras, RasGRP1-4, RasGRF1,2, CNrasGEF, and RAP-specific nucleotide exchange factors, to name a few.


Pssm-ID: 100121  Cd Length: 122  Bit Score: 87.08  E-value: 1.50e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  57 SLEALMEHLVPTVDYyPDRTYIFTFLLSSRVFMPPHDLLARVGQICLEQRQQLEAGPEKAKLKSFST--KIVQLLKEWTE 134
Cdd:cd06224     1 TLEALIEHLTSTFDM-PDPSFVSTFLLTYRSFTTPTELLEKLIERYEIAPPENLEYNDWDKKKSKPIrlRVLNVLRTWVE 79
                          90       100       110
                  ....*....|....*....|....*....|
gi 1375022908 135 AFPYDFQ-DEKVMAELKAIAHRVTQCDEYL 163
Cdd:cd06224    80 NYPYDFFdDEELLELLEEFLNRLVQEGALL 109
RasGEF_N pfam00618
RasGEF N-terminal motif; A subset of guanine nucleotide exchange factor for Ras-like small ...
55-146 8.90e-15

RasGEF N-terminal motif; A subset of guanine nucleotide exchange factor for Ras-like small GTPases appear to possess this motif/domain N-terminal to the RasGef (Cdc25-like) domain.


Pssm-ID: 395493  Cd Length: 104  Bit Score: 70.03  E-value: 8.90e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908  55 SGSLEALMEHLVPTvDYYPDRTYIFTFLLSSRVFMPPHDLLARVGQICLEQRQQLEAGPEKAKLKSFST---KIVQLLKE 131
Cdd:pfam00618   4 AGTLEKLVEYLTST-RIMLDDSFLSTFLLTYRSFTTPAELLELLIERYNIPPPLDLSSDSYWISKKTLPiriRVLSVLRH 82
                          90
                  ....*....|....*
gi 1375022908 132 WTEAFPYDFQDEKVM 146
Cdd:pfam00618  83 WVENYFSDFNDDPVL 97
RasGEFN smart00229
Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal motif; A subset of guanine ...
49-158 7.94e-12

Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal motif; A subset of guanine nucleotide exchange factor for Ras-like small GTPases appear to possess this domain N-terminal to the RasGef (Cdc25-like) domain. The recent crystal structureof Sos shows that this domain is alpha-helical and plays a "purely structural role" (Nature 394, 337-343).


Pssm-ID: 214571  Cd Length: 127  Bit Score: 62.35  E-value: 7.94e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1375022908   49 QDGRLTSGSLEALMEHLVPTvDYYPDRTYIFTFLLSSRVFMPPHDLLARVGQ--ICLEQRQQLEAGPEKAKLKSfstKIV 126
Cdd:smart00229   1 DGGLIKGGTLEALIEHLTEA-FDKADPSFVETFLLTYRSFITTQELLQLLLYryNAIPPESWVEEKVNPRRVKN---RVL 76
                           90       100       110
                   ....*....|....*....|....*....|...
gi 1375022908  127 QLLKEWTEAFPYDFQDEKVMAE-LKAIAHRVTQ 158
Cdd:smart00229  77 NILRTWVENYWEDFEDDPKLISfLLEFLELVDD 109
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH