NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1395168534|ref|NP_001350923|]
View 

Protein Classification

calreticulin family protein (domain architecture ID 10446997)

calreticulin family protein similar to calnexin which is a calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Calreticulin pfam00262
Calreticulin family;
106-475 0e+00

Calreticulin family;


:

Pssm-ID: 395201  Cd Length: 369  Bit Score: 692.38  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 106 FADSFDRGTL-SGWILSKAKKDDTDDEIAKYDGKWEVEEMKESK-LPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIV 183
Cdd:pfam00262   1 FFEQFDDYDWeSRWIPSKAKKDDEDDEIAKYDGKWSVEEPTVYPgFEGDKGLVLKSKAKHHAISAKLDKPIDFKNKTLVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 184 QYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDAdlkt 263
Cdd:pfam00262  81 QYEVKLQNGLECGGAYIKLLSETNDLDLEEFSDKTPYTIMFGPDKCGSTNKVHFIFRHKNPKTGEYEEKHLKKPPK---- 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 264 YFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDA 343
Cdd:pfam00262 157 IRTDKLTHLYTLILRPDNTFEIRIDGEVVKSGNLLEDFKPPVNPPKEIDDPNDKKPEDWDDREKIPDPNAVKPDDWDEDA 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 344 PAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMI 423
Cdd:pfam00262 237 PEFIPDPDATKPEGWLEDEPEYIPDPEATKPEDWDEEEDGEWEAPLIPNPKCEEAPGCGPWKPPMIKNPKYKGKWKPPMI 316
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|...
gi 1395168534 424 DNPSYQGIWKPRKIPNPDFFEDLEPFR-MTPFSAIGLELWSMTSDIFFDNFII 475
Cdd:pfam00262 317 DNPNYKGEWKPRKIPNPDYFEDKHPFSnLEPIGAIGFELWSMSKDILFDNIYI 369
 
Name Accession Description Interval E-value
Calreticulin pfam00262
Calreticulin family;
106-475 0e+00

Calreticulin family;


Pssm-ID: 395201  Cd Length: 369  Bit Score: 692.38  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 106 FADSFDRGTL-SGWILSKAKKDDTDDEIAKYDGKWEVEEMKESK-LPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIV 183
Cdd:pfam00262   1 FFEQFDDYDWeSRWIPSKAKKDDEDDEIAKYDGKWSVEEPTVYPgFEGDKGLVLKSKAKHHAISAKLDKPIDFKNKTLVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 184 QYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDAdlkt 263
Cdd:pfam00262  81 QYEVKLQNGLECGGAYIKLLSETNDLDLEEFSDKTPYTIMFGPDKCGSTNKVHFIFRHKNPKTGEYEEKHLKKPPK---- 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 264 YFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDA 343
Cdd:pfam00262 157 IRTDKLTHLYTLILRPDNTFEIRIDGEVVKSGNLLEDFKPPVNPPKEIDDPNDKKPEDWDDREKIPDPNAVKPDDWDEDA 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 344 PAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMI 423
Cdd:pfam00262 237 PEFIPDPDATKPEGWLEDEPEYIPDPEATKPEDWDEEEDGEWEAPLIPNPKCEEAPGCGPWKPPMIKNPKYKGKWKPPMI 316
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|...
gi 1395168534 424 DNPSYQGIWKPRKIPNPDFFEDLEPFR-MTPFSAIGLELWSMTSDIFFDNFII 475
Cdd:pfam00262 317 DNPNYKGEWKPRKIPNPDYFEDKHPFSnLEPIGAIGFELWSMSKDILFDNIYI 369
 
Name Accession Description Interval E-value
Calreticulin pfam00262
Calreticulin family;
106-475 0e+00

Calreticulin family;


Pssm-ID: 395201  Cd Length: 369  Bit Score: 692.38  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 106 FADSFDRGTL-SGWILSKAKKDDTDDEIAKYDGKWEVEEMKESK-LPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIV 183
Cdd:pfam00262   1 FFEQFDDYDWeSRWIPSKAKKDDEDDEIAKYDGKWSVEEPTVYPgFEGDKGLVLKSKAKHHAISAKLDKPIDFKNKTLVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 184 QYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDAdlkt 263
Cdd:pfam00262  81 QYEVKLQNGLECGGAYIKLLSETNDLDLEEFSDKTPYTIMFGPDKCGSTNKVHFIFRHKNPKTGEYEEKHLKKPPK---- 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 264 YFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDA 343
Cdd:pfam00262 157 IRTDKLTHLYTLILRPDNTFEIRIDGEVVKSGNLLEDFKPPVNPPKEIDDPNDKKPEDWDDREKIPDPNAVKPDDWDEDA 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1395168534 344 PAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMI 423
Cdd:pfam00262 237 PEFIPDPDATKPEGWLEDEPEYIPDPEATKPEDWDEEEDGEWEAPLIPNPKCEEAPGCGPWKPPMIKNPKYKGKWKPPMI 316
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|...
gi 1395168534 424 DNPSYQGIWKPRKIPNPDFFEDLEPFR-MTPFSAIGLELWSMTSDIFFDNFII 475
Cdd:pfam00262 317 DNPNYKGEWKPRKIPNPDYFEDKHPFSnLEPIGAIGFELWSMSKDILFDNIYI 369
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH