NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157058300|ref|NP_033161|]
View 

Protein Classification

Ion_trans and Na_channel_gate domain-containing protein (domain architecture ID 11998195)

protein containing domains Na_trans_assoc, Ion_trans, and Na_channel_gate

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
933-1204 1.97e-46

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 167.06  E-value: 1.97e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   933 NSWFECFIGLVTLLCTGTLALEDIYIDQRKTTKILlEYADMIFAYIFILEMLLKWVAYGF-KAFFSNNWYKLDFMVVIVF 1011
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLTTVL-EILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1012 CLSLIGKTREDLNPLTSIKFLRALRVL---SQFERMKVVLRALIKTTLPTVSVFLVCLMIWLLFSVIGVQLFAGKFYECI 1088
Cdd:pfam00520   80 LISLVLSSVGSLSGLRVLRLLRLLRLLrliRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWE 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1089 DPtkgerfpvfevmnksqcekllfnesmpwENAKLNFDNVGNGFLSLLQVATFNGWISIMNSAIDSVGvnmqpsfeyNLY 1168
Cdd:pfam00520  160 NP----------------------------DNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG---------EFW 202
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 157058300  1169 MYSYFIIFVIFGLFLPLCMLIGVIIRNFNKQKIKQG 1204
Cdd:pfam00520  203 AYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
505-739 6.74e-40

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 148.57  E-value: 6.74e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   505 HPLADLFLVICIVLNICFLALEH-FPMSEELRSLLHVGNLVFIGIYTIEMILKIIAMHP-YGYFQISWNIFDSILVVLEL 582
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   583 TEILLADVEGLAVLITVPLIFI----KLGKYGPPFKSLMRILGSSLMALKDLVLLLCIFVYFSAVFGMKLFGRSYKdcvc 658
Cdd:pfam00520   81 ISLVLSSVGSLSGLRVLRLLRLlrllRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLK---- 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   659 hIKEDCQPQRWHMSDFLHAYMTVFRILCGE-WIETLWECMEVAGQAWCIPFYMMVILIGNLLILYLFVTLV-SSFSYYDA 736
Cdd:pfam00520  157 -TWENPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIiDNFQELTE 235

                   ...
gi 157058300   737 TSE 739
Cdd:pfam00520  236 RTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
118-405 3.59e-34

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 132.01  E-value: 3.59e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   118 HPLFRLLILISVLTDSILMCMSNLPE-------WILAIENTLLGIYAFEILVKVIARGIWagsFSFLGDLWNWLDFSVTL 190
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQpeeplttVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   191 FELIT----RFSPLSSFLMLKTIRTFRILKIIPLNHGLQSIVMTLAQCLKKLFGAIALALFFLAVFSLLGMGLFMGNLKH 266
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   267 kclrwpeenenetlhnrtgslnysperinfyymegakyallcgnrtdagqcpegyvcvkeGTNPDNGFTSFDNFGWSLLA 346
Cdd:pfam00520  158 ------------------------------------------------------------WENPDNGRTNFDNFPNAFLW 177
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   347 MFRLMTQD-YPELLYHQILYASGKVYMIFFVMISFWFAFYLTSLFLGILTMTYEKEKQRA 405
Cdd:pfam00520  178 LFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERT 237
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1250-1497 6.75e-31

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 122.38  E-value: 6.75e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1250 HRVFNVIIILLICFQATTIMIQK-DEQSPQMETAIFWMNSIFVMLFTLECILKLTA--FRCHYFTSAWNVHDFMVVIFSI 1326
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAagFKKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1327 TGLLLPLtigqyFVPPSLVQLILLSRVIHILRPGKGPKVFHDLMLPLILALPALLNISLLIFLVMFIYAIFGMYNFAYV- 1405
Cdd:pfam00520   81 ISLVLSS-----VGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKl 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1406 -KKEAGINDVSNFETFGSSMLCLFQVTTFSGWDGMLDAIFNSQwsdcdpdkinpgtqvkgdcgSPSVGISYFVSYILISW 1484
Cdd:pfam00520  156 kTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK--------------------GEFWAYIYFVSFIILGG 215
                          250
                   ....*....|...
gi 157058300  1485 LIIVNMYIVLIME 1497
Cdd:pfam00520  216 FLLLNLFIAVIID 228
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1195-1246 1.70e-22

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


:

Pssm-ID: 240441  Cd Length: 54  Bit Score: 91.86  E-value: 1.70e-22
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 157058300 1195 NFNKQKIKQGGS-NIFITVKQKKQYRALKKLLYADVQKPTPRPRNKFQGFLFD 1246
Cdd:cd13433     2 NFNQLKKKYGGGlDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
Na_trans_assoc super family cl05828
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
743-927 1.06e-16

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


The actual alignment was detected with superfamily member pfam06512:

Pssm-ID: 399489  Cd Length: 201  Bit Score: 80.10  E-value: 1.06e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   743 EAKNLQLAMARIKSGIN---SMLLKLMC------TERSVPTEATDQICDPSVKEN-ISGHTLselsntqtflRYKDQSSS 812
Cdd:pfam06512    3 EMNNLQIALARIQRGIRfvkRTLRDFCCrlcllePQKLPEKKPLDESKDASKKTNqIANHTS----------APKELKKA 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   813 TEKTPVTESESQSLIASPSASETVPIASGESDIENLDNKETRS-KSGNGGSKE-----KMKQSSSSECSTVDIAISeeee 886
Cdd:pfam06512   73 PGGKYGVDEDHMSFITNPNLTVCVPIAEGESDLENEEDEDESSqSSDEEKSKQqeqlqQVDDSSSSEGSTVDLTDP---- 148
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 157058300   887 mvYEHEKSKLHKN------------GYERKSSTGQISRESRNGKIWKNIRKTC 927
Cdd:pfam06512  149 --EEELEQIPEEAedlkepedcfpeGCVRRFPCCAVDITKGPWKIWWNLRKTC 199
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
933-1204 1.97e-46

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 167.06  E-value: 1.97e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   933 NSWFECFIGLVTLLCTGTLALEDIYIDQRKTTKILlEYADMIFAYIFILEMLLKWVAYGF-KAFFSNNWYKLDFMVVIVF 1011
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLTTVL-EILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1012 CLSLIGKTREDLNPLTSIKFLRALRVL---SQFERMKVVLRALIKTTLPTVSVFLVCLMIWLLFSVIGVQLFAGKFYECI 1088
Cdd:pfam00520   80 LISLVLSSVGSLSGLRVLRLLRLLRLLrliRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWE 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1089 DPtkgerfpvfevmnksqcekllfnesmpwENAKLNFDNVGNGFLSLLQVATFNGWISIMNSAIDSVGvnmqpsfeyNLY 1168
Cdd:pfam00520  160 NP----------------------------DNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG---------EFW 202
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 157058300  1169 MYSYFIIFVIFGLFLPLCMLIGVIIRNFNKQKIKQG 1204
Cdd:pfam00520  203 AYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
505-739 6.74e-40

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 148.57  E-value: 6.74e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   505 HPLADLFLVICIVLNICFLALEH-FPMSEELRSLLHVGNLVFIGIYTIEMILKIIAMHP-YGYFQISWNIFDSILVVLEL 582
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   583 TEILLADVEGLAVLITVPLIFI----KLGKYGPPFKSLMRILGSSLMALKDLVLLLCIFVYFSAVFGMKLFGRSYKdcvc 658
Cdd:pfam00520   81 ISLVLSSVGSLSGLRVLRLLRLlrllRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLK---- 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   659 hIKEDCQPQRWHMSDFLHAYMTVFRILCGE-WIETLWECMEVAGQAWCIPFYMMVILIGNLLILYLFVTLV-SSFSYYDA 736
Cdd:pfam00520  157 -TWENPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIiDNFQELTE 235

                   ...
gi 157058300   737 TSE 739
Cdd:pfam00520  236 RTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
118-405 3.59e-34

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 132.01  E-value: 3.59e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   118 HPLFRLLILISVLTDSILMCMSNLPE-------WILAIENTLLGIYAFEILVKVIARGIWagsFSFLGDLWNWLDFSVTL 190
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQpeeplttVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   191 FELIT----RFSPLSSFLMLKTIRTFRILKIIPLNHGLQSIVMTLAQCLKKLFGAIALALFFLAVFSLLGMGLFMGNLKH 266
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   267 kclrwpeenenetlhnrtgslnysperinfyymegakyallcgnrtdagqcpegyvcvkeGTNPDNGFTSFDNFGWSLLA 346
Cdd:pfam00520  158 ------------------------------------------------------------WENPDNGRTNFDNFPNAFLW 177
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   347 MFRLMTQD-YPELLYHQILYASGKVYMIFFVMISFWFAFYLTSLFLGILTMTYEKEKQRA 405
Cdd:pfam00520  178 LFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERT 237
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1250-1497 6.75e-31

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 122.38  E-value: 6.75e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1250 HRVFNVIIILLICFQATTIMIQK-DEQSPQMETAIFWMNSIFVMLFTLECILKLTA--FRCHYFTSAWNVHDFMVVIFSI 1326
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAagFKKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1327 TGLLLPLtigqyFVPPSLVQLILLSRVIHILRPGKGPKVFHDLMLPLILALPALLNISLLIFLVMFIYAIFGMYNFAYV- 1405
Cdd:pfam00520   81 ISLVLSS-----VGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKl 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1406 -KKEAGINDVSNFETFGSSMLCLFQVTTFSGWDGMLDAIFNSQwsdcdpdkinpgtqvkgdcgSPSVGISYFVSYILISW 1484
Cdd:pfam00520  156 kTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK--------------------GEFWAYIYFVSFIILGG 215
                          250
                   ....*....|...
gi 157058300  1485 LIIVNMYIVLIME 1497
Cdd:pfam00520  216 FLLLNLFIAVIID 228
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1195-1246 1.70e-22

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 91.86  E-value: 1.70e-22
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 157058300 1195 NFNKQKIKQGGS-NIFITVKQKKQYRALKKLLYADVQKPTPRPRNKFQGFLFD 1246
Cdd:cd13433     2 NFNQLKKKYGGGlDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
743-927 1.06e-16

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 399489  Cd Length: 201  Bit Score: 80.10  E-value: 1.06e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   743 EAKNLQLAMARIKSGIN---SMLLKLMC------TERSVPTEATDQICDPSVKEN-ISGHTLselsntqtflRYKDQSSS 812
Cdd:pfam06512    3 EMNNLQIALARIQRGIRfvkRTLRDFCCrlcllePQKLPEKKPLDESKDASKKTNqIANHTS----------APKELKKA 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   813 TEKTPVTESESQSLIASPSASETVPIASGESDIENLDNKETRS-KSGNGGSKE-----KMKQSSSSECSTVDIAISeeee 886
Cdd:pfam06512   73 PGGKYGVDEDHMSFITNPNLTVCVPIAEGESDLENEEDEDESSqSSDEEKSKQqeqlqQVDDSSSSEGSTVDLTDP---- 148
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 157058300   887 mvYEHEKSKLHKN------------GYERKSSTGQISRESRNGKIWKNIRKTC 927
Cdd:pfam06512  149 --EEELEQIPEEAedlkepedcfpeGCVRRFPCCAVDITKGPWKIWWNLRKTC 199
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
933-1204 1.97e-46

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 167.06  E-value: 1.97e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   933 NSWFECFIGLVTLLCTGTLALEDIYIDQRKTTKILlEYADMIFAYIFILEMLLKWVAYGF-KAFFSNNWYKLDFMVVIVF 1011
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLTTVL-EILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1012 CLSLIGKTREDLNPLTSIKFLRALRVL---SQFERMKVVLRALIKTTLPTVSVFLVCLMIWLLFSVIGVQLFAGKFYECI 1088
Cdd:pfam00520   80 LISLVLSSVGSLSGLRVLRLLRLLRLLrliRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWE 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1089 DPtkgerfpvfevmnksqcekllfnesmpwENAKLNFDNVGNGFLSLLQVATFNGWISIMNSAIDSVGvnmqpsfeyNLY 1168
Cdd:pfam00520  160 NP----------------------------DNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG---------EFW 202
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 157058300  1169 MYSYFIIFVIFGLFLPLCMLIGVIIRNFNKQKIKQG 1204
Cdd:pfam00520  203 AYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
505-739 6.74e-40

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 148.57  E-value: 6.74e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   505 HPLADLFLVICIVLNICFLALEH-FPMSEELRSLLHVGNLVFIGIYTIEMILKIIAMHP-YGYFQISWNIFDSILVVLEL 582
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   583 TEILLADVEGLAVLITVPLIFI----KLGKYGPPFKSLMRILGSSLMALKDLVLLLCIFVYFSAVFGMKLFGRSYKdcvc 658
Cdd:pfam00520   81 ISLVLSSVGSLSGLRVLRLLRLlrllRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLK---- 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   659 hIKEDCQPQRWHMSDFLHAYMTVFRILCGE-WIETLWECMEVAGQAWCIPFYMMVILIGNLLILYLFVTLV-SSFSYYDA 736
Cdd:pfam00520  157 -TWENPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIiDNFQELTE 235

                   ...
gi 157058300   737 TSE 739
Cdd:pfam00520  236 RTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
118-405 3.59e-34

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 132.01  E-value: 3.59e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   118 HPLFRLLILISVLTDSILMCMSNLPE-------WILAIENTLLGIYAFEILVKVIARGIWagsFSFLGDLWNWLDFSVTL 190
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQpeeplttVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   191 FELIT----RFSPLSSFLMLKTIRTFRILKIIPLNHGLQSIVMTLAQCLKKLFGAIALALFFLAVFSLLGMGLFMGNLKH 266
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   267 kclrwpeenenetlhnrtgslnysperinfyymegakyallcgnrtdagqcpegyvcvkeGTNPDNGFTSFDNFGWSLLA 346
Cdd:pfam00520  158 ------------------------------------------------------------WENPDNGRTNFDNFPNAFLW 177
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   347 MFRLMTQD-YPELLYHQILYASGKVYMIFFVMISFWFAFYLTSLFLGILTMTYEKEKQRA 405
Cdd:pfam00520  178 LFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTERT 237
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1250-1497 6.75e-31

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 122.38  E-value: 6.75e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1250 HRVFNVIIILLICFQATTIMIQK-DEQSPQMETAIFWMNSIFVMLFTLECILKLTA--FRCHYFTSAWNVHDFMVVIFSI 1326
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAagFKKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1327 TGLLLPLtigqyFVPPSLVQLILLSRVIHILRPGKGPKVFHDLMLPLILALPALLNISLLIFLVMFIYAIFGMYNFAYV- 1405
Cdd:pfam00520   81 ISLVLSS-----VGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKl 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1406 -KKEAGINDVSNFETFGSSMLCLFQVTTFSGWDGMLDAIFNSQwsdcdpdkinpgtqvkgdcgSPSVGISYFVSYILISW 1484
Cdd:pfam00520  156 kTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK--------------------GEFWAYIYFVSFIILGG 215
                          250
                   ....*....|...
gi 157058300  1485 LIIVNMYIVLIME 1497
Cdd:pfam00520  216 FLLLNLFIAVIID 228
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1195-1246 1.70e-22

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 91.86  E-value: 1.70e-22
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 157058300 1195 NFNKQKIKQGGS-NIFITVKQKKQYRALKKLLYADVQKPTPRPRNKFQGFLFD 1246
Cdd:cd13433     2 NFNQLKKKYGGGlDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
743-927 1.06e-16

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 399489  Cd Length: 201  Bit Score: 80.10  E-value: 1.06e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   743 EAKNLQLAMARIKSGIN---SMLLKLMC------TERSVPTEATDQICDPSVKEN-ISGHTLselsntqtflRYKDQSSS 812
Cdd:pfam06512    3 EMNNLQIALARIQRGIRfvkRTLRDFCCrlcllePQKLPEKKPLDESKDASKKTNqIANHTS----------APKELKKA 72
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300   813 TEKTPVTESESQSLIASPSASETVPIASGESDIENLDNKETRS-KSGNGGSKE-----KMKQSSSSECSTVDIAISeeee 886
Cdd:pfam06512   73 PGGKYGVDEDHMSFITNPNLTVCVPIAEGESDLENEEDEDESSqSSDEEKSKQqeqlqQVDDSSSSEGSTVDLTDP---- 148
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 157058300   887 mvYEHEKSKLHKN------------GYERKSSTGQISRESRNGKIWKNIRKTC 927
Cdd:pfam06512  149 --EEELEQIPEEAedlkepedcfpeGCVRRFPCCAVDITKGPWKIWWNLRKTC 199
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
1289-1497 3.53e-04

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 400395  Cd Length: 424  Bit Score: 45.03  E-value: 3.53e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1289 IFVMLFTLECILKLTAFRCHYFTSAWNVHDFMVVIFSItgLLLPLTIGQYFVPPSLVQLIL-----------LSRVIHIL 1357
Cdd:pfam08016  218 VFFLYFVVEEILKIRKHRPSYLRSVWNLLDLAIVILSV--VLIVLNIYRDFLVDRLIKSVEaspvtfidfdrVAQLDNLY 295
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157058300  1358 RPGKG----------------PKVFHDLMLPLILALPALLNISLLIFLVMFIYAIFGMYNFAyvkkeagiNDVSNFETFG 1421
Cdd:pfam08016  296 RIILAflvfltwlklfkvlrfNKTMSLFTKTLSRAWKDLAGFALMFVIFFFAYAQFGYLLFG--------TQAPNFSNFV 367
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 157058300  1422 SSMLCLFQVttfsgwdgMLDAIfnsQWSDcdpdkINPGTQVkgdcgspsVGISYFVSYILISWLIIVNMYIVLIME 1497
Cdd:pfam08016  368 KSILTLFRT--------ILGDF---GYNE-----IFSGNRV--------LGPLLFLTFVFLVIFILLNLFLAIIND 419
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH