NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1621427294|dbj|BBJ47865|]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Tox-HNH-HHH pfam15637
HNH/Endo VII superfamily nuclease toxin with a HHH motif; A predicted toxin of the HNH ...
243-356 3.15e-79

HNH/Endo VII superfamily nuclease toxin with a HHH motif; A predicted toxin of the HNH/Endonuclease VII fold present in bacterial polymorphic toxin systems with characteristic conserved s[GD]xxR and HHH motifs. In bacterial polymorphic toxin systems, the toxin is exported by the type 2, type 5, type 6, type 7 or Photorhabdus virulence cassette (PVC)-type secretion system.


:

Pssm-ID: 317946  Cd Length: 114  Bit Score: 246.22  E-value: 3.15e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1621427294 243 PVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYFWPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAA 322
Cdd:pfam15637   1 PVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYFWPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAA 80
                          90       100       110
                  ....*....|....*....|....*....|....
gi 1621427294 323 YVNDTLEHHHVGQGSRAVPLPSRLHDAYTVFHPQ 356
Cdd:pfam15637  81 YVNDTLEHHHVGQGSRAVPLPSRLHDAYTVFHPQ 114
DUF4157 pfam13699
Domain of unknown function (DUF4157); This presumed domain is functionally uncharacterized. ...
25-102 2.08e-30

Domain of unknown function (DUF4157); This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. This domain contains an HEXXH motif that is characteristic of many families of metallopeptidases. However, no peptidase activity has been shown for this domain.


:

Pssm-ID: 316240  Cd Length: 79  Bit Score: 113.84  E-value: 2.08e-30
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1621427294  25 PLDAGIRQTMEMAFGHDFSQVRVHSDPQAHALTRRMNARALTLGDHIALGQDWYSPDSADELRALAHELAHVVQQRSG 102
Cdd:pfam13699   1 PLPAAVRARMERAFGADFSDVRVHTGSAAARAARALGARAFTVGNDIVFGPGQYQPGSAEGRELLAHELTHVVQQRGG 78
 
Name Accession Description Interval E-value
Tox-HNH-HHH pfam15637
HNH/Endo VII superfamily nuclease toxin with a HHH motif; A predicted toxin of the HNH ...
243-356 3.15e-79

HNH/Endo VII superfamily nuclease toxin with a HHH motif; A predicted toxin of the HNH/Endonuclease VII fold present in bacterial polymorphic toxin systems with characteristic conserved s[GD]xxR and HHH motifs. In bacterial polymorphic toxin systems, the toxin is exported by the type 2, type 5, type 6, type 7 or Photorhabdus virulence cassette (PVC)-type secretion system.


Pssm-ID: 317946  Cd Length: 114  Bit Score: 246.22  E-value: 3.15e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1621427294 243 PVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYFWPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAA 322
Cdd:pfam15637   1 PVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYFWPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAA 80
                          90       100       110
                  ....*....|....*....|....*....|....
gi 1621427294 323 YVNDTLEHHHVGQGSRAVPLPSRLHDAYTVFHPQ 356
Cdd:pfam15637  81 YVNDTLEHHHVGQGSRAVPLPSRLHDAYTVFHPQ 114
DUF4157 pfam13699
Domain of unknown function (DUF4157); This presumed domain is functionally uncharacterized. ...
25-102 2.08e-30

Domain of unknown function (DUF4157); This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. This domain contains an HEXXH motif that is characteristic of many families of metallopeptidases. However, no peptidase activity has been shown for this domain.


Pssm-ID: 316240  Cd Length: 79  Bit Score: 113.84  E-value: 2.08e-30
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1621427294  25 PLDAGIRQTMEMAFGHDFSQVRVHSDPQAHALTRRMNARALTLGDHIALGQDWYSPDSADELRALAHELAHVVQQRSG 102
Cdd:pfam13699   1 PLPAAVRARMERAFGADFSDVRVHTGSAAARAARALGARAFTVGNDIVFGPGQYQPGSAEGRELLAHELTHVVQQRGG 78
 
Name Accession Description Interval E-value
Tox-HNH-HHH pfam15637
HNH/Endo VII superfamily nuclease toxin with a HHH motif; A predicted toxin of the HNH ...
243-356 3.15e-79

HNH/Endo VII superfamily nuclease toxin with a HHH motif; A predicted toxin of the HNH/Endonuclease VII fold present in bacterial polymorphic toxin systems with characteristic conserved s[GD]xxR and HHH motifs. In bacterial polymorphic toxin systems, the toxin is exported by the type 2, type 5, type 6, type 7 or Photorhabdus virulence cassette (PVC)-type secretion system.


Pssm-ID: 317946  Cd Length: 114  Bit Score: 246.22  E-value: 3.15e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1621427294 243 PVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYFWPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAA 322
Cdd:pfam15637   1 PVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYFWPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAA 80
                          90       100       110
                  ....*....|....*....|....*....|....
gi 1621427294 323 YVNDTLEHHHVGQGSRAVPLPSRLHDAYTVFHPQ 356
Cdd:pfam15637  81 YVNDTLEHHHVGQGSRAVPLPSRLHDAYTVFHPQ 114
DUF4157 pfam13699
Domain of unknown function (DUF4157); This presumed domain is functionally uncharacterized. ...
25-102 2.08e-30

Domain of unknown function (DUF4157); This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. This domain contains an HEXXH motif that is characteristic of many families of metallopeptidases. However, no peptidase activity has been shown for this domain.


Pssm-ID: 316240  Cd Length: 79  Bit Score: 113.84  E-value: 2.08e-30
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1621427294  25 PLDAGIRQTMEMAFGHDFSQVRVHSDPQAHALTRRMNARALTLGDHIALGQDWYSPDSADELRALAHELAHVVQQRSG 102
Cdd:pfam13699   1 PLPAAVRARMERAFGADFSDVRVHTGSAAARAARALGARAFTVGNDIVFGPGQYQPGSAEGRELLAHELTHVVQQRGG 78
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH