NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|165973970|ref|NP_001107193|]
View 

stress-associated endoplasmic reticulum protein 2 [Bos taurus]

Protein Classification

RAMP4 family protein (domain architecture ID 10535141)

RAMP4 family protein similar to human stress-associated endoplasmic reticulum protein 1 (SERP1), also called ribosome-attached membrane protein 4 (RAMP4), that interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum, and protects unfolded target proteins against degradation during ER stress

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RAMP4 pfam06624
Ribosome associated membrane protein RAMP4; This family consists of several ribosome ...
3-58 2.37e-30

Ribosome associated membrane protein RAMP4; This family consists of several ribosome associated membrane protein RAMP4 (or SERP1) sequences. Stabilisation of membrane proteins in response to stress involves the concerted action of a rescue unit in the ER membrane comprised of SERP1/RAMP4, other components of the translocon, and molecular chaperones in the ER.


:

Pssm-ID: 429040  Cd Length: 57  Bit Score: 100.29  E-value: 2.37e-30
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 165973970   3 AKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQII 58
Cdd:pfam06624  2 QTRRMRRANEKFAKNITKRGKVPKSLKKKEKKSPVGPWLLGLFIFVVCGSAIFQII 57
 
Name Accession Description Interval E-value
RAMP4 pfam06624
Ribosome associated membrane protein RAMP4; This family consists of several ribosome ...
3-58 2.37e-30

Ribosome associated membrane protein RAMP4; This family consists of several ribosome associated membrane protein RAMP4 (or SERP1) sequences. Stabilisation of membrane proteins in response to stress involves the concerted action of a rescue unit in the ER membrane comprised of SERP1/RAMP4, other components of the translocon, and molecular chaperones in the ER.


Pssm-ID: 429040  Cd Length: 57  Bit Score: 100.29  E-value: 2.37e-30
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 165973970   3 AKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQII 58
Cdd:pfam06624  2 QTRRMRRANEKFAKNITKRGKVPKSLKKKEKKSPVGPWLLGLFIFVVCGSAIFQII 57
 
Name Accession Description Interval E-value
RAMP4 pfam06624
Ribosome associated membrane protein RAMP4; This family consists of several ribosome ...
3-58 2.37e-30

Ribosome associated membrane protein RAMP4; This family consists of several ribosome associated membrane protein RAMP4 (or SERP1) sequences. Stabilisation of membrane proteins in response to stress involves the concerted action of a rescue unit in the ER membrane comprised of SERP1/RAMP4, other components of the translocon, and molecular chaperones in the ER.


Pssm-ID: 429040  Cd Length: 57  Bit Score: 100.29  E-value: 2.37e-30
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 165973970   3 AKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQII 58
Cdd:pfam06624  2 QTRRMRRANEKFAKNITKRGKVPKSLKKKEKKSPVGPWLLGLFIFVVCGSAIFQII 57
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH