NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1720430108|ref|XP_030099892|]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FXYD2 cd20318
FXYD domain-containing ion transport regulator 2; FXYD domain-containing ion transport ...
8-50 5.18e-26

FXYD domain-containing ion transport regulator 2; FXYD domain-containing ion transport regulator 2 (FXYD2), also known as sodium/potassium-transporting ATPase subunit gamma, or Na(+)/K(+) ATPase subunit gamma, or sodium pump gamma chain, is the regulatory subunit of the sodium/potassium-transporting ATPase (Na,K-ATPase). Na+,K+-ATPase is a heteromeric complex consisting of a large alpha-subunit, which is responsible for ATP hydrolysis, ion transport, and CTS binding, and a beta-subunit, acting as a chaperone. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Mutations in this gene have been associated with renal hypomagnesaemia.


:

Pssm-ID: 410557  Cd Length: 43  Bit Score: 89.09  E-value: 5.18e-26
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|...
gi 1720430108  8 GSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRC 50
Cdd:cd20318    1 GSPEGSEDPFTYDYETVRNGGLIFAAVAFVVGLLIILSKRFRC 43
 
Name Accession Description Interval E-value
FXYD2 cd20318
FXYD domain-containing ion transport regulator 2; FXYD domain-containing ion transport ...
8-50 5.18e-26

FXYD domain-containing ion transport regulator 2; FXYD domain-containing ion transport regulator 2 (FXYD2), also known as sodium/potassium-transporting ATPase subunit gamma, or Na(+)/K(+) ATPase subunit gamma, or sodium pump gamma chain, is the regulatory subunit of the sodium/potassium-transporting ATPase (Na,K-ATPase). Na+,K+-ATPase is a heteromeric complex consisting of a large alpha-subunit, which is responsible for ATP hydrolysis, ion transport, and CTS binding, and a beta-subunit, acting as a chaperone. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Mutations in this gene have been associated with renal hypomagnesaemia.


Pssm-ID: 410557  Cd Length: 43  Bit Score: 89.09  E-value: 5.18e-26
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|...
gi 1720430108  8 GSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRC 50
Cdd:cd20318    1 GSPEGSEDPFTYDYETVRNGGLIFAAVAFVVGLLIILSKRFRC 43
ATP1G1_PLM_MAT8 pfam02038
ATP1G1/PLM/MAT8 family;
12-57 8.50e-21

ATP1G1/PLM/MAT8 family;


Pssm-ID: 396568  Cd Length: 46  Bit Score: 76.06  E-value: 8.50e-21
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 1720430108 12 GTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHR 57
Cdd:pfam02038  1 EEDDPFYYDYETLRIGGLIFAGVLFIVGILIILSGKCKCKFNQKPR 46
 
Name Accession Description Interval E-value
FXYD2 cd20318
FXYD domain-containing ion transport regulator 2; FXYD domain-containing ion transport ...
8-50 5.18e-26

FXYD domain-containing ion transport regulator 2; FXYD domain-containing ion transport regulator 2 (FXYD2), also known as sodium/potassium-transporting ATPase subunit gamma, or Na(+)/K(+) ATPase subunit gamma, or sodium pump gamma chain, is the regulatory subunit of the sodium/potassium-transporting ATPase (Na,K-ATPase). Na+,K+-ATPase is a heteromeric complex consisting of a large alpha-subunit, which is responsible for ATP hydrolysis, ion transport, and CTS binding, and a beta-subunit, acting as a chaperone. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Mutations in this gene have been associated with renal hypomagnesaemia.


Pssm-ID: 410557  Cd Length: 43  Bit Score: 89.09  E-value: 5.18e-26
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|...
gi 1720430108  8 GSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRC 50
Cdd:cd20318    1 GSPEGSEDPFTYDYETVRNGGLIFAAVAFVVGLLIILSKRFRC 43
ATP1G1_PLM_MAT8 pfam02038
ATP1G1/PLM/MAT8 family;
12-57 8.50e-21

ATP1G1/PLM/MAT8 family;


Pssm-ID: 396568  Cd Length: 46  Bit Score: 76.06  E-value: 8.50e-21
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 1720430108 12 GTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHR 57
Cdd:pfam02038  1 EEDDPFYYDYETLRIGGLIFAGVLFIVGILIILSGKCKCKFNQKPR 46
FXYD1 cd20317
FXYD domain-containing ion transport regulator 1; FXYD domain-containing ion transport ...
16-50 8.05e-16

FXYD domain-containing ion transport regulator 1; FXYD domain-containing ion transport regulator 1 (FXYD1), also known as phospholemman (PLM), or sodium/potassium-transporting ATPase subunit FXYD1, associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na+ out of the cell and K+ into the cell. It is a plasma membrane substrate for several kinases, including protein kinase A, protein kinase C, NIMA kinase, and myotonic dystrophy kinase. It is thought to form an ion channel or regulate ion channel activity. Transcript variants with different 5' UTR sequences have been described in the literature.


Pssm-ID: 410556  Cd Length: 64  Bit Score: 63.88  E-value: 8.05e-16
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 1720430108 16 PFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRC 50
Cdd:cd20317    6 PFTYDYQSLRIGGLIIAGILFILGILIILSRRCRC 40
FXYD6 cd20324
FXYD domain-containing ion transport regulator 6; FXYD domain-containing ion transport ...
14-50 7.50e-14

FXYD domain-containing ion transport regulator 6; FXYD domain-containing ion transport regulator 6 (FXYD6 encodes the protein phosphohippolin and is located at the 11q23.3. It can be found in all human tissues except blood. FXYD6 in humans is primarily in the brain, with highest levels of expression found in the prefrontal cortex, amygdala, hypothalamus, and occipital lobe. FXYD6 is up-regulated in hepatocellular carcinoma (HCC) and it enhances the migration and proliferation of HCC cells. Therapy targeting FXYD6 could potentially benefit the clinical treatment toward HCC patients. FXYD6 is also associated with mental diseases. Mutations in the FXYD6 gene, or in sequences close to this gene, can predispose to schizophrenia which is known to be strongly heritable. FXYD6 was also found to be significantly downregulated in a Tg2576 mouse model of Alzheimer's disease (AD) brain and hippocampus. FXYD6 is a novel regulator of Na,K-ATPase expressed in the inner ear.


Pssm-ID: 410560  Cd Length: 66  Bit Score: 59.05  E-value: 7.50e-14
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 1720430108 14 ENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRC 50
Cdd:cd20324   26 DSPFHYDYESLRIGGLVFAVVLFLLGILLILSRKCRC 62
FXYD7 cd20325
FXYD domain-containing ion transport regulator 7; FXYD domain-containing ion transport ...
15-50 3.10e-13

FXYD domain-containing ion transport regulator 7; FXYD domain-containing ion transport regulator 7 (FXYD7) has a potential splice variant with an additional 3 residues. In rats, expression of FXYD7 was restricted to the brain, with highest levels in the cerebrum, followed by brainstem, and hippocampus, and relatively weak expression in the hypothalamus. Immunofluorescence microscopy demonstrated colocalization with synaptophysin and modest colocalization with glial fibrillary acidic protein, indicating predominant expression in neurons and lower expression in astroglial cells. The FXYD7 gene maps to chromosome 19.


Pssm-ID: 410561  Cd Length: 51  Bit Score: 57.18  E-value: 3.10e-13
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 1720430108 15 NPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRC 50
Cdd:cd20325    5 SPFEYDYETLRTTGVILAVVMFVLGILIALSKKFKC 40
FXYD_FXYD5 cd20323
FXYD domain of FXYD domain-containing ion transport regulator 5; FXYD domain-containing ion ...
14-50 9.71e-11

FXYD domain of FXYD domain-containing ion transport regulator 5; FXYD domain-containing ion transport regulator 5 (FXYD5) is also called dysadherin in humans or related to ion channel (RIC) in mice. Two transcript variants have been found for this gene, and they are both predicted to encode the same protein. Dysadherin is the gamma subunit the human Na,K-ATPase and is the only member that has a large extracellular sequence of 140 amino acids. Dysadherin has been observed to be over-expressed on the surface of cells that have down regulated levels of surface E-cadherin. CCL2 (bone homing cytokine) is a protein that is highly affected by silencing dysadherin expression. Dysadherin interferes with cell adhesion via beta1 subunit interactions and is a target for an extracellular antibody drug conjugate where the antibody to dysadherin is attached to a cardiac glycoside. FXYD5 expression in mouse is mainly in the kidney, intestine, spleen, and lung. Confocal immunofluorescence microscopy of mouse kidney detected FXYD5 on basolateral membranes of connecting tubules, collecting tubules, intercalated cells of collecting duct, and on apical membranes in long thin limb of Henle loop.


Pssm-ID: 410559  Cd Length: 48  Bit Score: 50.52  E-value: 9.71e-11
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 1720430108 14 ENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRC 50
Cdd:cd20323    5 DEPFTYDYETLRKAGLIIAAVLFITGILVLTCGKVCR 41
FXYD cd20277
phenylalanine-X-tyrosine-aspartate (FXYD) family; FXYDs are small single-transmembrane ...
17-46 1.99e-10

phenylalanine-X-tyrosine-aspartate (FXYD) family; FXYDs are small single-transmembrane proteins that act as novel regulators of Na+/K+-ATPase (NKA). The transmembrane domain and the conserved Phe-X-Tyr-Asp motif of FXYD play a role in the binding of FXYD to the alpha- and beta-subunits of NKA. PFXYD (proline-phenylalanine-X-tyrosine-aspartate) at the beginning of the signature sequence is invariant in all known examples in mammals and identical except for the proline in other vertebrates; X is usually Y (tyrosine), but can also be E, T, or H (glutamate, threonine, or histidine). The FXYD protein family contains at least twelve members that have the extracellular FXYD motif, transmembrane domain, and intracellular domain. Members share a 35-amino acid signature sequence domain, beginning with PFXYD and containing 7 invariant and 6 highly conserved amino acids. In mammals, members of the FXYD family include FXYD1 (phospholemman, PLM), FXYD2 (the gamma-subunit of NKA), FXYD3 (mammary tumor marker Mat-8), FXYD4 (corticosteroid hormone-induced factor, CHIF), FXYD5 (dysadherin), FXYD6 (phosphohippolin), and FXYD7. In elasmobranchs, FXYD10 (phospholemman-like protein from shark, PLMS) was first identified in the rectal glands of Squalus acanthias. In addition, studies on sharks reported that the functions of FXYD10 via its C-terminal cysteine residue interactions were associated with negative regulation of shark NKA activity. Teleostean FXYD proteins (FXYD2, 5-9, 11, and 12) have been reported in certain teleosts such as the Tetraodon nigroviridis, Salmo salar, Danio rerio, and Oryzias dancena. Recent studies have demonstrated that several teleost FXYD isoforms are expressed in the gills and kidneys of the fish, and their expression levels are altered in response to salinity changes, suggesting that these FXYDs may regulate electrolyte homeostasis and body fluid of the fish.


Pssm-ID: 410555  Cd Length: 30  Bit Score: 49.45  E-value: 1.99e-10
                         10        20        30
                 ....*....|....*....|....*....|
gi 1720430108 17 FEYDYETVRKGGLIFAGLAFVVGLLIILSK 46
Cdd:cd20277    1 FYYDYETLRIGGLVFAAVLFIVGILILLSG 30
FXYD12 cd20330
FXYD domain-containing ion transport regulator 12; The FXYD domain-containing ion transport ...
17-62 2.31e-09

FXYD domain-containing ion transport regulator 12; The FXYD domain-containing ion transport regulator 12 (FXYD12) mRNA is mainly distributed in kidneys and intestines of fish. In co-immunoprecipitation experiments, FXYD12 was shown to associate with the Na(+)/(K+)-ATPase (NKA) alpha-subunit in the intestines of two closely related medakas, Oryzias dancena and O. latipes. These results suggests that FXYD12 may play a role in modulating NKA activity in the intestines following salinity changes in the maintenance of internal homeostasis.


Pssm-ID: 410565  Cd Length: 53  Bit Score: 47.28  E-value: 2.31e-09
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 1720430108 17 FEYDYETVRKGGLIFAGlaFVVGLLIIL---SKRFRCGGGKKhRQVNED 62
Cdd:cd20330    8 FVYDYETLRIGGLIFAG--VIVFLSVLLlagNKIRRCGKPKP-KPVEED 53
FXYD3-like cd20328
FXYD domain-containing ion transport regulator 3 and similar proteins; This subfamily includes ...
13-57 1.19e-08

FXYD domain-containing ion transport regulator 3 and similar proteins; This subfamily includes FXYD domain-containing ion transport regulator 3 (FXYD3), FXYD9, and FXYD10, also called PLMS/Phospholemman-like protein. FXYD3, also known as mammary tumor 8 kDa protein (MAT-8), or chloride conductance inducer protein Mat-8, or phospholemman-like (PLML), may function as a chloride channel or as a chloride channel regulator. It associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na+ out of the cell and K+ into the cell. Two transcript variants encode two different isoforms of the protein; in addition, transcripts utilizing alternative polyA signals have been described in the literature. Members here include mammalians and reptiles. FXYD9 is present in teleosts including: Danio rerio, Atlantic salmon, and Japanese Medaka fish. In general, the FXYD9 isoform has the highest degree of conservation among the examined teleost species, indicating that it may be involved in physiological processes that are not evolving within this group of vertebrates. FXYD10, present in shark, associates with and modifies the activity of Na,K-ATPase in vitro through interactions mediated by its transmembrane and cytoplasmic C-terminal domains. It is important in the phosphorylation and potassium deocclusion reactions, which are known to be controlled by A domain movements. It is thought that FXYD10 interacts with the A domain of the shark Na,K-ATPase alpha-subunit.


Pssm-ID: 410563  Cd Length: 51  Bit Score: 45.58  E-value: 1.19e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
gi 1720430108 13 TENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHR 57
Cdd:cd20328    7 KDSPFYYDWHRLRVGGLICAAVLCAIGIIVLLSGKCKCKFNQKKR 51
FXYD11 cd20329
FXYD domain-containing ion transport regulator 11; FXYD domain-containing ion transport ...
15-56 8.26e-08

FXYD domain-containing ion transport regulator 11; FXYD domain-containing ion transport regulator 11 (FXYD11) is a putative regulatory subunit of the Na(+)/K(+)-ATPase (NKA) pump. FXYD11 is expressed predominantly in the gills of euryhaline teleosts, such as the spotted scat, Scatophagus argus. It regulates NKA activity through protein-protein interactions. The regulation of NKA and FXYD11 is of critical importance for osmotic homeostasis. The expression and activity of NKA, as well as FXYD11 mRNA expression in gills have been shown to respond to different environmental salinity by dual-labeling immunohistochemistry and quantitative PCR (RT-qPCR) methods, indicating that there is an interaction between NKA and FXYD.


Pssm-ID: 410564  Cd Length: 64  Bit Score: 43.81  E-value: 8.26e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|..
gi 1720430108 15 NPFEYDYETVRKGGLIFAGLAFVVGLLIILSKrfRCGGGKKH 56
Cdd:cd20329   23 NPFVYNYERLRIGGLVFACLLVAGGISVLLYN--KCSRKNKK 62
FXYD4 cd20322
FXYD domain-containing ion transport regulator 4; FXYD domain-containing ion transport ...
14-55 8.77e-08

FXYD domain-containing ion transport regulator 4; FXYD domain-containing ion transport regulator 4 (FXYD4), also known as CHIF (channel-inducing factor or corticosteroid hormone-induced factor), evokes K+ conductance in oocytes and is localized in the distal parts of the nephron and in the colon. CHIF, a putative K channel regulator, is regulated by aldosterone in the colon and by K+ intake in the kidney.


Pssm-ID: 410558  Cd Length: 48  Bit Score: 43.37  E-value: 8.77e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|..
gi 1720430108 14 ENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKK 55
Cdd:cd20322    7 DSPFYYDWESLQLGGMICAGLLCIAGIAFALSGKCKCKHSQK 48
FXYD8 cd20327
FXYD domain-containing ion transport regulator 8; FXYD domain-containing ion transport ...
6-63 4.71e-07

FXYD domain-containing ion transport regulator 8; FXYD domain-containing ion transport regulator 8 (FXYD8), also known as FXYD domain containing ion transport regulator 6 pseudogene 3 (FXYD6P3), is a member of the FXYD protein family that is involved in the modulation of NKA activity in the kidneys. The human FXYD8 gene is located on the X chromosome. However, the gene is located on chromosome 9 in the mouse and chromosome 8 in the rat.


Pssm-ID: 410562  Cd Length: 93  Bit Score: 42.69  E-value: 4.71e-07
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720430108  6 LGGSAKGTE--NPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHRQVNEDE 63
Cdd:cd20327   16 LASAAKKEKeiDPFHYNYQTLRIGGLVFDMVLFLVLSLHLLSHRCKCSFNQKPQDPGDEE 75
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH