NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1783658069|ref|NP_001364044|]
View 

Protein Classification

KRAB domain-containing zinc finger protein (domain architecture ID 12016853)

KRAB (Kruppel-associated box) domain-containing zinc finger protein (KRAB-ZFP) plays important roles in cell differentiation and organ development and in regulating viral replication and transcription

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
KRAB pfam01352
KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc ...
22-62 9.55e-20

KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.


:

Pssm-ID: 396083  Cd Length: 42  Bit Score: 80.14  E-value: 9.55e-20
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1783658069  22 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIG 62
Cdd:pfam01352   2 VTFEDVAVDFTQEEWELLDPAQRELYRDVMLENYRNLVSLG 42
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
119-271 9.42e-09

FOG: Zn-finger [General function prediction only];


:

Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 55.86  E-value: 9.42e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 119 KPYECNQCGKAFSQHSRLQYHKRS--HTGE--KPYKC--NQCGKAYGHHSSLQYHKRRHTGEKPYHC--NQCDKAFS--- 187
Cdd:COG5048   288 LPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCpySLCGKLFSRNDALKRHILLHTSISPAKEklLNSSSKFSpll 367
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 188 --EHSSLEYHKITHLGEKPYECD--QCGKAFAWQSSLNIHKRTHSGEKPYECN--ECGKAFTHHASLQSHKRIHTGEKPY 261
Cdd:COG5048   368 nnEPPQSLQQYKDLKNDKKSETLsnSCIRNFKRDSNLSLHIITHLSFRPYNCKnpPCSKSFNRHYNLIPHKKIHTNHAPL 447
                         170
                  ....*....|
gi 1783658069 262 QCDQCGKAFA 271
Cdd:COG5048   448 LCSILKSFRR 457
 
Name Accession Description Interval E-value
KRAB pfam01352
KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc ...
22-62 9.55e-20

KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.


Pssm-ID: 396083  Cd Length: 42  Bit Score: 80.14  E-value: 9.55e-20
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1783658069  22 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIG 62
Cdd:pfam01352   2 VTFEDVAVDFTQEEWELLDPAQRELYRDVMLENYRNLVSLG 42
KRAB smart00349
krueppel associated box;
22-64 3.97e-17

krueppel associated box;


Pssm-ID: 214630  Cd Length: 61  Bit Score: 73.78  E-value: 3.97e-17
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 1783658069   22 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIGYK 64
Cdd:smart00349   1 VTFEDVAVYFTQEEWEQLDPAQKNLYRDVMLENYSNLVSLGFQ 43
KRAB_A-box cd07765
KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression ...
22-59 1.06e-14

KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression module, found in a subgroup of the zinc finger proteins (ZFPs) of the C2H2 family, KRAB-ZFPs. KRAB-ZFPs comprise the largest group of transcriptional regulators in mammals, and are only found in tetrapods. These proteins have been shown to play important roles in cell differentiation and organ development, and in regulating viral replication and transcription. A KRAB domain may consist of an A-box, or of an A-box plus either a B-box, a divergent B-box (b), or a C-box. Only the A-box is included in this model. The A-box is needed for repression, the B- and C- boxes are not. KRAB-ZFPs have one or two KRAB domains at their amino-terminal end, and multiple C2H2 zinc finger motifs at their C-termini. Some KRAB-ZFPs also contain a SCAN domain which mediates homo- and hetero-oligomerization. The KRAB domain is a protein-protein interaction module which represses transcription through recruiting corepressors. A key mechanism appears to be the following: KRAB-AFPs tethered to DNA recruit, via their KRAB domain, the repressor KAP1 (KRAB-associated protein-1, also known as transcription intermediary factor 1 beta , KRAB-A interacting protein , and tripartite motif protein 28). The KAP1/ KRAB-AFP complex in turn recruits the heterochromatin protein 1 (HP1) family, and other chromatin modulating proteins, leading to transcriptional repression through heterochromatin formation.


Pssm-ID: 143639  Cd Length: 40  Bit Score: 66.42  E-value: 1.06e-14
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 1783658069  22 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNIT 59
Cdd:cd07765     1 VTFEDVAVYFSQEEWELLDPAQRDLYRDVMLENYENLV 38
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
119-271 9.42e-09

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 55.86  E-value: 9.42e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 119 KPYECNQCGKAFSQHSRLQYHKRS--HTGE--KPYKC--NQCGKAYGHHSSLQYHKRRHTGEKPYHC--NQCDKAFS--- 187
Cdd:COG5048   288 LPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCpySLCGKLFSRNDALKRHILLHTSISPAKEklLNSSSKFSpll 367
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 188 --EHSSLEYHKITHLGEKPYECD--QCGKAFAWQSSLNIHKRTHSGEKPYECN--ECGKAFTHHASLQSHKRIHTGEKPY 261
Cdd:COG5048   368 nnEPPQSLQQYKDLKNDKKSETLsnSCIRNFKRDSNLSLHIITHLSFRPYNCKnpPCSKSFNRHYNLIPHKKIHTNHAPL 447
                         170
                  ....*....|
gi 1783658069 262 QCDQCGKAFA 271
Cdd:COG5048   448 LCSILKSFRR 457
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
6-228 1.09e-06

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 49.33  E-value: 1.09e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069   6 DINTTQGFRVIGLQDAVTYDDVRVNFTEEEWD--LLDPSQKS---LYEEVMLETYQNITaigykwEDHHIEEYcqsSRRH 80
Cdd:COG5189   235 DIGHMMDTHQFYLEDVDLMDDDILGPSNEEMLykYISPSQGSaelFEESSLGFDYEFIH------KSVGNKEI---RGGI 305
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069  81 ERHERIHIGEKPYERNQCGKAFASDNHLQIhkrtnteekpyecnqcgkafSQHSRLQYHKrshtGEKPYKCN--QCGKAY 158
Cdd:COG5189   306 STGEMIDVRKLPCTNSSSNGKLAHGGERNI--------------------DTPSRMLKVK----DGKPYKCPveGCNKKY 361
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 159 GHHSSLQYHKrrhtgeKPYHCNQcdkAFSEHSSLEYHKITHLGEKPYECDQCGKAFAWQSSLNIHkRTHS 228
Cdd:COG5189   362 KNQNGLKYHM------LHGHQNQ---KLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYH-RKHS 421
zf-H2C2_2 pfam13465
Zinc-finger double domain;
247-272 8.99e-05

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 38.87  E-value: 8.99e-05
                          10        20
                  ....*....|....*....|....*.
gi 1783658069 247 SLQSHKRIHTGEKPYQCDQCGKAFAH 272
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
 
Name Accession Description Interval E-value
KRAB pfam01352
KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc ...
22-62 9.55e-20

KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.


Pssm-ID: 396083  Cd Length: 42  Bit Score: 80.14  E-value: 9.55e-20
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1783658069  22 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIG 62
Cdd:pfam01352   2 VTFEDVAVDFTQEEWELLDPAQRELYRDVMLENYRNLVSLG 42
KRAB smart00349
krueppel associated box;
22-64 3.97e-17

krueppel associated box;


Pssm-ID: 214630  Cd Length: 61  Bit Score: 73.78  E-value: 3.97e-17
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 1783658069   22 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIGYK 64
Cdd:smart00349   1 VTFEDVAVYFTQEEWEQLDPAQKNLYRDVMLENYSNLVSLGFQ 43
KRAB_A-box cd07765
KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression ...
22-59 1.06e-14

KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression module, found in a subgroup of the zinc finger proteins (ZFPs) of the C2H2 family, KRAB-ZFPs. KRAB-ZFPs comprise the largest group of transcriptional regulators in mammals, and are only found in tetrapods. These proteins have been shown to play important roles in cell differentiation and organ development, and in regulating viral replication and transcription. A KRAB domain may consist of an A-box, or of an A-box plus either a B-box, a divergent B-box (b), or a C-box. Only the A-box is included in this model. The A-box is needed for repression, the B- and C- boxes are not. KRAB-ZFPs have one or two KRAB domains at their amino-terminal end, and multiple C2H2 zinc finger motifs at their C-termini. Some KRAB-ZFPs also contain a SCAN domain which mediates homo- and hetero-oligomerization. The KRAB domain is a protein-protein interaction module which represses transcription through recruiting corepressors. A key mechanism appears to be the following: KRAB-AFPs tethered to DNA recruit, via their KRAB domain, the repressor KAP1 (KRAB-associated protein-1, also known as transcription intermediary factor 1 beta , KRAB-A interacting protein , and tripartite motif protein 28). The KAP1/ KRAB-AFP complex in turn recruits the heterochromatin protein 1 (HP1) family, and other chromatin modulating proteins, leading to transcriptional repression through heterochromatin formation.


Pssm-ID: 143639  Cd Length: 40  Bit Score: 66.42  E-value: 1.06e-14
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 1783658069  22 VTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNIT 59
Cdd:cd07765     1 VTFEDVAVYFSQEEWELLDPAQRDLYRDVMLENYENLV 38
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
119-271 9.42e-09

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 55.86  E-value: 9.42e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 119 KPYECNQCGKAFSQHSRLQYHKRS--HTGE--KPYKC--NQCGKAYGHHSSLQYHKRRHTGEKPYHC--NQCDKAFS--- 187
Cdd:COG5048   288 LPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCpySLCGKLFSRNDALKRHILLHTSISPAKEklLNSSSKFSpll 367
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 188 --EHSSLEYHKITHLGEKPYECD--QCGKAFAWQSSLNIHKRTHSGEKPYECN--ECGKAFTHHASLQSHKRIHTGEKPY 261
Cdd:COG5048   368 nnEPPQSLQQYKDLKNDKKSETLsnSCIRNFKRDSNLSLHIITHLSFRPYNCKnpPCSKSFNRHYNLIPHKKIHTNHAPL 447
                         170
                  ....*....|
gi 1783658069 262 QCDQCGKAFA 271
Cdd:COG5048   448 LCSILKSFRR 457
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
6-228 1.09e-06

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 49.33  E-value: 1.09e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069   6 DINTTQGFRVIGLQDAVTYDDVRVNFTEEEWD--LLDPSQKS---LYEEVMLETYQNITaigykwEDHHIEEYcqsSRRH 80
Cdd:COG5189   235 DIGHMMDTHQFYLEDVDLMDDDILGPSNEEMLykYISPSQGSaelFEESSLGFDYEFIH------KSVGNKEI---RGGI 305
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069  81 ERHERIHIGEKPYERNQCGKAFASDNHLQIhkrtnteekpyecnqcgkafSQHSRLQYHKrshtGEKPYKCN--QCGKAY 158
Cdd:COG5189   306 STGEMIDVRKLPCTNSSSNGKLAHGGERNI--------------------DTPSRMLKVK----DGKPYKCPveGCNKKY 361
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 159 GHHSSLQYHKrrhtgeKPYHCNQcdkAFSEHSSLEYHKITHLGEKPYECDQCGKAFAWQSSLNIHkRTHS 228
Cdd:COG5189   362 KNQNGLKYHM------LHGHQNQ---KLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYH-RKHS 421
zf-H2C2_2 pfam13465
Zinc-finger double domain;
247-272 8.99e-05

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 38.87  E-value: 8.99e-05
                          10        20
                  ....*....|....*....|....*.
gi 1783658069 247 SLQSHKRIHTGEKPYQCDQCGKAFAH 272
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
115-292 4.16e-04

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 41.61  E-value: 4.16e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 115 NTEEKPYECNQCGKAFSQHSRLQYHKRSHTG-EKPYKCNQCGKAYGHHSSLQYHKR--RHTGE--KPYHC--NQCDKAFS 187
Cdd:COG5048   255 SSASESPRSSLPTASSQSSSPNESDSSSEKGfSLPIKSKQCNISFSRSSPLTRHLRsvNHSGEslKPFSCpySLCGKLFS 334
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 188 EHSSLEYHKITHLGEKPYEC--DQCGKAF-----AWQSSLNIHKRTHSGEKPYEC--NECGKAFTHHASLQSHKRIHTGE 258
Cdd:COG5048   335 RNDALKRHILLHTSISPAKEklLNSSSKFspllnNEPPQSLQQYKDLKNDKKSETlsNSCIRNFKRDSNLSLHIITHLSF 414
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1783658069 259 KPYQCD--QCGKAFAHQTSLQCHKRTHTGEKPYECN 292
Cdd:COG5048   415 RPYNCKnpPCSKSFNRHYNLIPHKKIHTNHAPLLCS 450
zf-H2C2_2 pfam13465
Zinc-finger double domain;
163-187 4.77e-04

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 36.56  E-value: 4.77e-04
                          10        20
                  ....*....|....*....|....*
gi 1783658069 163 SLQYHKRRHTGEKPYHCNQCDKAFS 187
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFK 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
219-244 1.35e-03

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 35.40  E-value: 1.35e-03
                          10        20
                  ....*....|....*....|....*.
gi 1783658069 219 SLNIHKRTHSGEKPYECNECGKAFTH 244
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
135-160 2.02e-03

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 35.02  E-value: 2.02e-03
                          10        20
                  ....*....|....*....|....*.
gi 1783658069 135 RLQYHKRSHTGEKPYKCNQCGKAYGH 160
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
200-284 2.23e-03

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 39.32  E-value: 2.23e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 200 LGEKPYECD--QCGKAFAWQSSLNIHKRThsgekpyecNECGKAFTHHASLQSHKRIHTGEKPYQCDQCGKAFAHQTSLQ 277
Cdd:COG5189   345 KDGKPYKCPveGCNKKYKNQNGLKYHMLH---------GHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLK 415

                  ....*..
gi 1783658069 278 CHkRTHT 284
Cdd:COG5189   416 YH-RKHS 421
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
119-210 3.96e-03

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 38.52  E-value: 3.96e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1783658069 119 KPYECNQCGKAFSQHSRLQYHKRSHTGEKPYKCNQ--CGKAYGHHSSLQYHKRRHTGEKPYhcNQCDKAFSEHSSLEYHK 196
Cdd:COG5048    32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYsgCDKSFSRPLELSRHLRTHHNNPSD--LNSKSLPLSNSKASSSS 109
                          90
                  ....*....|....
gi 1783658069 197 ITHLGEKPYECDQC 210
Cdd:COG5048   110 LSSSSSNSNDNNLL 123
zf-H2C2_2 pfam13465
Zinc-finger double domain;
191-215 5.08e-03

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 33.86  E-value: 5.08e-03
                          10        20
                  ....*....|....*....|....*
gi 1783658069 191 SLEYHKITHLGEKPYECDQCGKAFA 215
Cdd:pfam13465   1 NLKRHMRKHTGEKPYKCPECGKSFK 25
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
231-269 7.05e-03

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 37.75  E-value: 7.05e-03
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1783658069 231 KPYECNECGKAFTHHASLQSHKRIHTGEKPYQCDQCGKA 269
Cdd:COG5048    32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCD 70
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH