NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|189521633|ref|XP_001922491|]
View 

CD44 antigen [Danio rerio]

Protein Classification

Xlink domain-containing protein (domain architecture ID 11087189)

Xlink domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Xlink pfam00193
Extracellular link domain;
33-122 6.31e-27

Extracellular link domain;


:

Pssm-ID: 425515  Cd Length: 93  Bit Score: 102.62  E-value: 6.31e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633   33 GVFHIEGIS-RYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWIDGQNVTFLPHINGPNCDSSSAEI---TF 108
Cdd:pfam00193   1 GVFHLRSPSgRYKLTFEEAQAACEAQGATLATPEQLYAAWKAGLDQCDAGWLADGSVRYPITTPRPNCGGNLPGVrqyGF 80
                          90
                  ....*....|....
gi 189521633  109 HAKAGEfLSDVYCF 122
Cdd:pfam00193  81 RDPTSE-RYDAYCY 93
 
Name Accession Description Interval E-value
Xlink pfam00193
Extracellular link domain;
33-122 6.31e-27

Extracellular link domain;


Pssm-ID: 425515  Cd Length: 93  Bit Score: 102.62  E-value: 6.31e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633   33 GVFHIEGIS-RYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWIDGQNVTFLPHINGPNCDSSSAEI---TF 108
Cdd:pfam00193   1 GVFHLRSPSgRYKLTFEEAQAACEAQGATLATPEQLYAAWKAGLDQCDAGWLADGSVRYPITTPRPNCGGNLPGVrqyGF 80
                          90
                  ....*....|....
gi 189521633  109 HAKAGEfLSDVYCF 122
Cdd:pfam00193  81 RDPTSE-RYDAYCY 93
Link_domain_CD44_like cd03516
This domain is a hyaluronan (HA)-binding domain. It is found in CD44 receptor and mediates ...
29-131 2.11e-19

This domain is a hyaluronan (HA)-binding domain. It is found in CD44 receptor and mediates adhesive interactions during inflammatory leukocyte homing and tumor metastasis. It also plays an important role in arteriogenesis. The functional HA-binding domain of CD44 is an extended domain comprised of a single link module flanked with N-and C- extensions. These extensions are essential for folding and for functional activity. This group also contains the cell surface retention sequence (CRS) binding protein-1 (CRSBP-1) and lymph vessel endothelial receptor-1 (LYVE-1). CRSBP-1 is a cell surface binding protein for the CRS motif of PDGF-BB (platelet-derived growth factor-BB) and is responsible for the cell surface retention of PDGF-BB in SSV-transformed cells. CRSBP-1 may play a role in autocrine regulation of cell growth mediated by CRS containing growth regulators. LYVE-1 is preferentially expressed on the lymphatic endothelium and is used as a molecular marker for the detection and characterization of lymphatic vessels in tumors.


Pssm-ID: 239593  Cd Length: 144  Bit Score: 83.66  E-value: 2.11e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633  29 CSFAGVFHIEGISRYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWIDGQNVtFLPHIN-GPNCdssSAEIT 107
Cdd:cd03516    3 CRIMGVFLVEKNGRYSLNFTEAKEACRALGLTLASKAQVETALKFGFETCRYGWVEDGFV-VIPRIDpNPLC---GKNGT 78
                         90       100
                 ....*....|....*....|....*...
gi 189521633 108 FHAKAGEFLS---DVYCFDPSDS-SPNC 131
Cdd:cd03516   79 GVYILNSNLSsryDAYCYNSSDTwINSC 106
LINK smart00445
Link (Hyaluronan-binding);
31-122 1.08e-16

Link (Hyaluronan-binding);


Pssm-ID: 214667  Cd Length: 94  Bit Score: 74.69  E-value: 1.08e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633    31 FAGVFHIEGISRYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWIDGQNVTFLPHINGPNCdssSAEIT--- 107
Cdd:smart00445   1 DGGVFHVEKNGRYKLTFAEAREACRAQGATLATVGQLYAAWQDGFDTCDAGWLADGSVRYPIITPRPRC---GGNLPgvr 77
                           90
                   ....*....|....*...
gi 189521633   108 ---FHAKAGEFlsDVYCF 122
Cdd:smart00445  78 qygFPDPTSRY--DAYCF 93
 
Name Accession Description Interval E-value
Xlink pfam00193
Extracellular link domain;
33-122 6.31e-27

Extracellular link domain;


Pssm-ID: 425515  Cd Length: 93  Bit Score: 102.62  E-value: 6.31e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633   33 GVFHIEGIS-RYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWIDGQNVTFLPHINGPNCDSSSAEI---TF 108
Cdd:pfam00193   1 GVFHLRSPSgRYKLTFEEAQAACEAQGATLATPEQLYAAWKAGLDQCDAGWLADGSVRYPITTPRPNCGGNLPGVrqyGF 80
                          90
                  ....*....|....
gi 189521633  109 HAKAGEfLSDVYCF 122
Cdd:pfam00193  81 RDPTSE-RYDAYCY 93
Link_domain_CD44_like cd03516
This domain is a hyaluronan (HA)-binding domain. It is found in CD44 receptor and mediates ...
29-131 2.11e-19

This domain is a hyaluronan (HA)-binding domain. It is found in CD44 receptor and mediates adhesive interactions during inflammatory leukocyte homing and tumor metastasis. It also plays an important role in arteriogenesis. The functional HA-binding domain of CD44 is an extended domain comprised of a single link module flanked with N-and C- extensions. These extensions are essential for folding and for functional activity. This group also contains the cell surface retention sequence (CRS) binding protein-1 (CRSBP-1) and lymph vessel endothelial receptor-1 (LYVE-1). CRSBP-1 is a cell surface binding protein for the CRS motif of PDGF-BB (platelet-derived growth factor-BB) and is responsible for the cell surface retention of PDGF-BB in SSV-transformed cells. CRSBP-1 may play a role in autocrine regulation of cell growth mediated by CRS containing growth regulators. LYVE-1 is preferentially expressed on the lymphatic endothelium and is used as a molecular marker for the detection and characterization of lymphatic vessels in tumors.


Pssm-ID: 239593  Cd Length: 144  Bit Score: 83.66  E-value: 2.11e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633  29 CSFAGVFHIEGISRYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWIDGQNVtFLPHIN-GPNCdssSAEIT 107
Cdd:cd03516    3 CRIMGVFLVEKNGRYSLNFTEAKEACRALGLTLASKAQVETALKFGFETCRYGWVEDGFV-VIPRIDpNPLC---GKNGT 78
                         90       100
                 ....*....|....*....|....*...
gi 189521633 108 FHAKAGEFLS---DVYCFDPSDS-SPNC 131
Cdd:cd03516   79 GVYILNSNLSsryDAYCYNSSDTwINSC 106
LINK smart00445
Link (Hyaluronan-binding);
31-122 1.08e-16

Link (Hyaluronan-binding);


Pssm-ID: 214667  Cd Length: 94  Bit Score: 74.69  E-value: 1.08e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633    31 FAGVFHIEGISRYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWIDGQNVTFLPHINGPNCdssSAEIT--- 107
Cdd:smart00445   1 DGGVFHVEKNGRYKLTFAEAREACRAQGATLATVGQLYAAWQDGFDTCDAGWLADGSVRYPIITPRPRC---GGNLPgvr 77
                           90
                   ....*....|....*...
gi 189521633   108 ---FHAKAGEFlsDVYCF 122
Cdd:smart00445  78 qygFPDPTSRY--DAYCF 93
Link_Domain cd01102
The link domain is a hyaluronan (HA)-binding domain. It functions to mediate adhesive ...
33-122 5.00e-14

The link domain is a hyaluronan (HA)-binding domain. It functions to mediate adhesive interactions during inflammatory leukocyte homing and tumor metastasis. It is found in the CD44 receptor and in human TSG-6. TSG-6 is the protein product of the tumor necrosis factor-stimulated gene-6. TSG-6 has a strong anti-inflammatory effect in models of acute inflammation and autoimmune arthritis and plays an essential role in female fertility. This group also contains the link domains of the chondroitin sulfate proteoglycan core proteins (CSPG) including aggrecan, versican, neurocan, and brevican and the link domains of the vertebrate HAPLN (HA and proteoglycan binding link) protein family. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggregates in which other CSPGs substitute for aggregan might contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN gene family are physically linked adjacent to CSPG genes. TSG-6 contains a single link module which supports high affinity binding with HA. The functional HA-binding domain of CD44 is an extended domain comprised of a link module flanked with N-and C- extensions. These extensions are essential for folding and functional activity. CSPGs are characterized by an N-terminal globular domain (G1 domain) containing two contiguous link modules (modules 1 and 2). Both link modules of the G1 domain of the CSPG aggrecan are involved in interaction with HA. Aggrecan in addition contains a second globular domain (G2) which contains link modules 3 and 4 which lack HA-binding activity. HAPLNs contain two contiguous link modules.


Pssm-ID: 238534  Cd Length: 92  Bit Score: 67.06  E-value: 5.00e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633  33 GVFHIEGIS-RYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWI-DGQNVTflPHIN-GPNCDSSSAEI--- 106
Cdd:cd01102    1 VVFHLESQNgRYKLTFAEAALACKARGAHLATPGQLEAAWQDGFDVCTAGWLaDGSVRY--PIVTsRPNCGGRNPGVrsy 78
                         90
                 ....*....|....*.
gi 189521633 107 TFHAKAGEFlsDVYCF 122
Cdd:cd01102   79 GNPAPSGRY--DAYCF 92
Link_domain_CSPGs_modules_1_3 cd03517
Link_domain_CSPGs_modules_1_3; this extracellular link domain is found in the first and third ...
34-122 1.53e-10

Link_domain_CSPGs_modules_1_3; this extracellular link domain is found in the first and third link modules of the chondroitin sulfate proteoglycan core protein (CSPG) aggrecan. In addition, it is found in the first link module of three other CSPGs: versican, neurocan, and brevican. The link domain is a hyaluronan (HA)-binding domain. CSPGs are characterized by an N-terminal globular domain (G1 domain) containing two contiguous link modules (modules 1 and 2). Both link modules of the G1 domain of aggrecan are involved in interaction with HA. In addition, aggrecan contains a second globular domain (G2) which contains link modules 3 and 4. G2 appears to lack HA-binding activity. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.


Pssm-ID: 239594  Cd Length: 95  Bit Score: 57.42  E-value: 1.53e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633  34 VFHI-EGISRYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWIDGQNVTFLPHINGPNC----DSSSAEITF 108
Cdd:cd03517    2 VFHYrDATARYALTFPRAQRACLDISAQIATPEQLLAAYEDGFEQCDAGWLADQTVRYPIQTPREGCygdmDGFPGVRNY 81
                         90
                 ....*....|....
gi 189521633 109 HAKAGEFLSDVYCF 122
Cdd:cd03517   82 GVRDPDELYDVYCY 95
Link_domain_TSG_6_like cd03515
This is the extracellular link domain of the type found in human TSG-6. The link domain is a ...
33-122 5.07e-10

This is the extracellular link domain of the type found in human TSG-6. The link domain is a hyaluronan (HA)-binding domain. TSG-6 is the protein product of tumor necrosis factor-stimulated gene-6. TSG-6 is up-regulated in inflammatory lesions and in the ovary during ovulation. It has a strong anti-inflammatory and chondroprotective effect in models of acute inflammation and autoimmune arthritis and plays an essential role in female fertility. Also included in this group are the stabilins: stabilin-1 (FEEL-1, CLEVER-1) and stabilin-2 (FEEL-2). Stabilin-2 functions as the major liver and lymph node-scavenging receptor for HA and related glycosaminoglycans. Stabilin-2 is a scavenger receptor with a broad range of ligands including advanced glycation end (AGE) products, acetylated low density lipoprotein and procollagen peptides. In contrast, stabilin-1 does not bind HA, but binds acetylated low density lipoprotein and AGEs with lower affinity. As AGEs accumulate in vascular tissues during aging and diabetes, these receptors may be implicated in the pathologies of these states. Both stabilins are present in the early endocytic pathway in hepatic sinusoidal epithelium associating with clathrin/AP-2. Stabilin-1 is expressed in macrophages. Stabilin-2 is absent from the latter. In macrophages: stabilin-1 is involved in trafficking between early/sorting endosomes and the trans-Golgi network. Stabilin-1 has also been implicated in angiogenesis and possibly leucocyte trafficking. Both stabilins bind gram-positive and gram-negative bacteria. TSG-6 and stabilins contain a single link module which supports high affinity binding to HA.


Pssm-ID: 239592  Cd Length: 93  Bit Score: 55.93  E-value: 5.07e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189521633  33 GVFHIEGIS-RYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWIDGQNVTFLPHINGPNCDSSSAEIT---F 108
Cdd:cd03515    1 GVFHLRSRSgKYKLTYTEAKAACEAEGAHLATYSQLSAAQQLGFHLCAAGWLAKGRVGYPIVFPSANCGFGHVGIVdygP 80
                         90
                 ....*....|....
gi 189521633 109 HAKAGEfLSDVYCF 122
Cdd:cd03515   81 RLNLSE-RWDAYCY 93
Link_domain_CSPGs_modules_2_4 cd03520
Link_domain_CSPGs_modules_2_4; this link domain is found in the second and fourth link modules ...
34-85 1.99e-07

Link_domain_CSPGs_modules_2_4; this link domain is found in the second and fourth link modules of the chondroitin sulfate proteoglycan core protein (CSPG) aggrecan and, in the second link module of three other CSPGs: versican, neurocan, and brevican. The link domain is a hyaluronan (HA)-binding domain. CSPGs are characterized by an N-terminal globular domain (G1 domain) containing two contiguous link modules (modules 1 and 2). Both link modules of the G1 domain of aggrecan are involved in interaction with HA. Aggrecan in addition contains a second globular domain (G2) having link modules 3 and 4 which lack HA-binding activity. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggregan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.


Pssm-ID: 239597  Cd Length: 96  Bit Score: 48.46  E-value: 1.99e-07
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
gi 189521633  34 VFHIEGISRysLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWI-DG 85
Cdd:cd03520    2 VFYATAPEK--FTFQEARAECRSLGAVLATTGQLYAAWRQGLDQCDPGWLaDG 52
Link_domain_HAPLN_module_1 cd03518
Link_domain_HAPLN_module_1; this link domain is found in the first link module of proteins ...
42-85 1.87e-06

Link_domain_HAPLN_module_1; this link domain is found in the first link module of proteins similar to the vertebrate HAPLN (hyaluronan/HA and proteoglycan binding link) protein family which includes cartilage link protein. The link domain is a HA-binding domain. HAPLNs contain two contiguous link modules. Both link modules of cartilage link protein are involved in interaction with HA. In cartilage, a chondroitin sulfate proteoglycan core protein (CSPG) aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggregates with other CSPGs substituting for aggregan may contribute to the structural integrity of many different tissues. Members of the vertebrate HAPLN gene family are physically linked adjacent to CSPG genes.


Pssm-ID: 239595  Cd Length: 95  Bit Score: 45.88  E-value: 1.87e-06
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
gi 189521633  42 RYSLTFQKAGELCQSLGYRLATQEQVTEAYKKGLRTCRYGWI-DG 85
Cdd:cd03518   11 RYNLNFHEAQQACEEQDATLASFEQLYQAWTEGLDWCNAGWLsDG 55
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH