NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1942250111|gb|QPP20640|]
View 

NADH dehydrogenase subunit 2, partial (mitochondrion) [Spilocuscus kraemeri]

Protein Classification

NADH dehydrogenase subunit 2( domain architecture ID 11475899)

NADH dehydrogenase subunit 2 is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ND2 MTH00105
NADH dehydrogenase subunit 2; Provisional
1-320 6.14e-157

NADH dehydrogenase subunit 2; Provisional


:

Pssm-ID: 177167 [Multi-domain]  Cd Length: 347  Bit Score: 442.75  E-value: 6.14e-157
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:MTH00105   13 LFLGTMITMISSHWLLAWIGLEMNMLAIIPILMKKHNPRSTEAATKYFLTQATASMLLMMAIIINLMYSGQWTITKLTNP 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00105   93 TASTLMTIALAMKLGLAPFHFWVPEVTQGIPLSSGMILLTWQKLAPLSILYQISPSINPNLLLTLAILSILIGGWGGLNQ 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00105  173 TQLRKILAYSSIAHMGWMTAILPYNPTLTLLNLLIYIIMTLTMFMLLMLNSSTTTLSLSHTWNKTPLMTSLILLTLLSLG 252
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMFPTTNNSKLQWPHPQTKTTNIIPPLTII 320
Cdd:MTH00105  253 GLPPLTGFMPKWMIIQELTKNNNIILPTLMAITALLNLYFYMRLIYSTSLTMFPSTNNMKMKWQFENTKPMTLLPTLIIL 332
 
Name Accession Description Interval E-value
ND2 MTH00105
NADH dehydrogenase subunit 2; Provisional
1-320 6.14e-157

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 177167 [Multi-domain]  Cd Length: 347  Bit Score: 442.75  E-value: 6.14e-157
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:MTH00105   13 LFLGTMITMISSHWLLAWIGLEMNMLAIIPILMKKHNPRSTEAATKYFLTQATASMLLMMAIIINLMYSGQWTITKLTNP 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00105   93 TASTLMTIALAMKLGLAPFHFWVPEVTQGIPLSSGMILLTWQKLAPLSILYQISPSINPNLLLTLAILSILIGGWGGLNQ 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00105  173 TQLRKILAYSSIAHMGWMTAILPYNPTLTLLNLLIYIIMTLTMFMLLMLNSSTTTLSLSHTWNKTPLMTSLILLTLLSLG 252
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMFPTTNNSKLQWPHPQTKTTNIIPPLTII 320
Cdd:MTH00105  253 GLPPLTGFMPKWMIIQELTKNNNIILPTLMAITALLNLYFYMRLIYSTSLTMFPSTNNMKMKWQFENTKPMTLLPTLIIL 332
NuoN COG1007
NADH:ubiquinone oxidoreductase subunit 2 (chain N) [Energy production and conversion];
2-285 7.62e-26

NADH:ubiquinone oxidoreductase subunit 2 (chain N) [Energy production and conversion];


Pssm-ID: 223939 [Multi-domain]  Cd Length: 475  Bit Score: 106.97  E-value: 7.62e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   2 LLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYP-NHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:COG1007   110 TLGMIVMASANNLLLLFIGLELLSLALYVLAALRrDSKRSSEAALKYFVLGALSSAFLLYGIALVYGATGSLSLSGIAAY 189
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSST-----------IMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMK-------IL 142
Cdd:COG1007   190 LNGGgeplglllglvFIIAGLGFKLSAVPFHMWTPDVYEGAPTPVTAFLSTAPKIAAFAVLLRIFVTAFGPdapdwylIF 269
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 143 IILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTIIMLINPTL----MLLNLIIYITATL-----TLFLTLNHSSIT 213
Cdd:COG1007   270 AIIAVASMLVGNFAALSQTNVKRLLAYSSIAHMGYLLVGLAAVTVGgyaaVLFYLLAYAFMSLgafgvVALLSSKEGGAE 349
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1942250111 214 KIKSLANLWNKSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRII 285
Cdd:COG1007   350 SISDLAGLSKRHPLLAALLTILMLSLAGIPPLAGFWGKFYVFLAAVQAGLWWLAVIAVLNSAISAYYYLRVV 421
Proton_antipo_M pfam00361
Proton-conducting membrane transporter; This is a family of membrane transporters that ...
11-274 4.70e-24

Proton-conducting membrane transporter; This is a family of membrane transporters that inlcudes some 7 of potentially 14-16 TM regions. In many instances the family forms part of complex I that catalyzes the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane, and in this context is a combination predominantly of subunits 2, 4, 5, 14, L, M and N. In many bacterial species these proteins are probable stand-alone transporters not coupled with oxidoreduction. The family in total represents homologs across the phyla.


Pssm-ID: 425636 [Multi-domain]  Cd Length: 291  Bit Score: 99.31  E-value: 4.70e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  11 SNHWLTAWMGLEINTLAIIPMMTY-PNHPRATESAIKYFLTQTTASMLLMFAII---NNAWTTNQWTLFQISDQTSSTI- 85
Cdd:pfam00361   1 ANDLLLMYLGWEAVLLPSYLLIGYwGKSPRSSEAGMKYFLLTLLGSSILLFGISlmyNYTGTLSFDELSKALTGGLNSSg 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  86 -------MTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILL-TWQKVAP-----TSLMYQISPSLNMKILIILAFSSTLL 152
Cdd:pfam00361  81 llllfllILVGFLFKSAQVPFHTWLPDAYEGAPTPVSALLAaTLVKAGGyglirRSLLYLPSSPFIQQILLILAIISMLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 153 GGWGGLNQTHLRKILAYSSIAHMGWMTIIMLINP----TLMLLNLIIYITATLTL-----FLTLNHSSITKIKSLANLWN 223
Cdd:pfam00361 161 GSLAALVQTDIKRLLAYSSISHMGYMLIALGAGTiygiQAAIFHLLTHGLFSAGLflcagSVIYRRVHTRNIRDYGGLAK 240
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1942250111 224 KSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSA 274
Cdd:pfam00361 241 TMPILALVFLVAMLSLAGLPPTAGFLGKFLILAAAVAASWIFLVLAGVVGS 291
NDH_I_N TIGR01770
proton-translocating NADH-quinone oxidoreductase, chain N; This model describes the 14th ...
2-314 1.80e-19

proton-translocating NADH-quinone oxidoreductase, chain N; This model describes the 14th (based on E. coli) structural gene, N, of bacterial and chloroplast energy-transducing NADH (or NADPH) dehydrogenases. This model does not describe any subunit of the mitochondrial complex I (for which the subunit composition is very different), nor NADH dehydrogenases that are not coupled to ion transport. The Enzyme Commission designation 1.6.5.3, for NADH dehydrogenase (ubiquinone), is applied broadly, perhaps unfortunately, even if the quinone is menaquinone (Thermus, Mycobacterium) or plastoquinone (chloroplast). For chloroplast members, the name NADH-plastoquinone oxidoreductase is used for the complex and this protein is designated as subunit 2 or B. This model also includes a subunit of a related complex in the archaeal methanogen, Methanosarcina mazei, in which F420H2 replaces NADH and 2-hydroxyphenazine replaces the quinone. [Energy metabolism, Electron transport]


Pssm-ID: 273795 [Multi-domain]  Cd Length: 468  Bit Score: 88.85  E-value: 1.80e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   2 LLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTY-PNHPRATESAIKYFLTQTTASMLLMF---AIINNAWTTNQWTLFQI 77
Cdd:TIGR01770 112 LLGIFLLVSSNDLLSIYLGLELQSLCFYVLAGLkRKSRFSTEAGLKYFILGAFSSGLLLFgisLIYGFTGSLNFEDLLLF 191
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  78 SDQTSSTI---------MTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSL-------NMKI 141
Cdd:TIGR01770 192 LSNGMLNIsllllgivlILVGLLFKLSAVPFHMWVPDVYEGAPTPVTAFFSIVPKIAIFAVFLRLFLYIlfgfseaWQIF 271
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 142 LIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGW----MTIIMLINPTLMLLNLIIYITATL------TLFLTLNHSS 211
Cdd:TIGR01770 272 LAIIAFLSMLIGNFGALAQKKVKRLLAYSSISHVGYiligLLAGTLEGIKAVLFYIFIYALMSLgafgvlSLLRSYKDEW 351
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 212 ITKIKSLANLWNKSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIymtaLT 291
Cdd:TIGR01770 352 IEYISDFAGLFKTNPILAILILIFMFSLAGIPPLAGFFGKFYVFFALLKSGLYWLAVIAVLTSVIGAFYYLRVV----KV 427
                         330       340
                  ....*....|....*....|...
gi 1942250111 292 MFPTTNNSKLQwPHPQTKTTNII 314
Cdd:TIGR01770 428 MYFDKPERRIP-SNPQSKAQSLL 449
 
Name Accession Description Interval E-value
ND2 MTH00105
NADH dehydrogenase subunit 2; Provisional
1-320 6.14e-157

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 177167 [Multi-domain]  Cd Length: 347  Bit Score: 442.75  E-value: 6.14e-157
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:MTH00105   13 LFLGTMITMISSHWLLAWIGLEMNMLAIIPILMKKHNPRSTEAATKYFLTQATASMLLMMAIIINLMYSGQWTITKLTNP 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00105   93 TASTLMTIALAMKLGLAPFHFWVPEVTQGIPLSSGMILLTWQKLAPLSILYQISPSINPNLLLTLAILSILIGGWGGLNQ 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00105  173 TQLRKILAYSSIAHMGWMTAILPYNPTLTLLNLLIYIIMTLTMFMLLMLNSSTTTLSLSHTWNKTPLMTSLILLTLLSLG 252
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMFPTTNNSKLQWPHPQTKTTNIIPPLTII 320
Cdd:MTH00105  253 GLPPLTGFMPKWMIIQELTKNNNIILPTLMAITALLNLYFYMRLIYSTSLTMFPSTNNMKMKWQFENTKPMTLLPTLIIL 332
ND2 MTH00135
NADH dehydrogenase subunit 2; Provisional
1-311 2.99e-120

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 177193 [Multi-domain]  Cd Length: 347  Bit Score: 349.87  E-value: 2.99e-120
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:MTH00135   13 LGLGTTLTFASSHWLLAWMGLEINTLAIIPLMAQHHHPRAVEATTKYFLTQATAAAMILFASTTNAWLTGQWDIQQMSHP 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSlNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00135   93 LPTTMITLALALKIGLAPLHFWLPEVLQGLDLTTGLILSTWQKLAPFALILQIAPT-NPTLLITLGLTSTLVGGWGGLNQ 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00135  172 TQLRKILAYSSIAHLGWMILVLQFSPSLTLLALLTYIIMTSSAFLTFKLNSSTKINTLATSWTKAPALTALTPLILLSLG 251
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMFPTTNNSKLQWPHPQTKTT 311
Cdd:MTH00135  252 GLPPLTGFMPKWLILQELTKQDLPLTATLAALSALLSLYFYLRLSYAMTLTISPNTLNGTTPWRLPSTQLT 322
ND2 MTH00070
NADH dehydrogenase subunit 2; Provisional
1-320 1.39e-112

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 177142 [Multi-domain]  Cd Length: 346  Bit Score: 330.34  E-value: 1.39e-112
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:MTH00070   13 LALGTMITLSSNHWFLAWMGLEINTLAIIPLMTKTHHPRATEAATKYFLTQASASALILFSSTINAWFTGEWTIMNMQTP 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00070   93 LPTIMLTIALMMKLGIAPFHFWLPEVLQGLDLTTGLILSTWQKLAPMALLIQISHLLNSNLLIIMGLLSTLIGGWGGLNQ 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00070  173 TQLRKIMAYSSIAHLGWMIIILTFSPHLTLLNLLIYLIMTSSMFLMLMNLNSTNINKLSSSWSKNPTLTSMMMLTLLSLG 252
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMFPTTNNSKLQWPHPqTKTTNIIPPLTII 320
Cdd:MTH00070  253 GLPPTTGFIPKWLILQELTKQNLTTLATLMALSALLSLFFYLRLSYAMSLTTSPNTSNSKLYWRFK-NKTNNLLSLTIIL 331
ND2 MTH00112
NADH dehydrogenase subunit 2; Provisional
1-320 2.60e-112

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 214423 [Multi-domain]  Cd Length: 346  Bit Score: 329.48  E-value: 2.60e-112
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:MTH00112   13 LILGTIITISSNHWLMAWTGLEINTLAIIPLISKPHHPRATEAATKYFLTQAAASALILFSSTTNAWNTGQWDITQLTNP 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00112   93 TSCTLLTLALAMKLGLAPFHFWLPEVLQGSTTTTALILSTWQKLAPLTLLLMTSNSLNPTLLLTLAILSTLIGGWGGLNQ 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00112  173 TQLRKIMAFSSIAHLGWMIAIITYSPKLTLLTFYIYILMTTPMFLTLNTTSTKTLKDMMTSWTKSPTLNTTLMLTLLSLA 252
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMFPTTNNSKLQW--PHPQTKTTNIIPPLT 318
Cdd:MTH00112  253 GLPPLTGFMPKWLILQELTKQNMTPTATIMAMLSLLSLFFYLRLTYISTITLPPNTTNMMMKWrtKPKKNTLTATLTTLS 332

                  ..
gi 1942250111 319 II 320
Cdd:MTH00112  333 TL 334
ND2 MTH00200
NADH dehydrogenase subunit 2; Provisional
1-303 2.25e-84

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 177246 [Multi-domain]  Cd Length: 347  Bit Score: 258.36  E-value: 2.25e-84
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:MTH00200   13 LGLGTLLTFSSSHWFLIWLGLEINTLAIIPLLIKQHHPRKVEATTKYFIIQATASALLLFGGLLNAWTSGQWGISEMLGP 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00200   93 LSETLILLALALKLGLAPGHFWVPDVLQGLSLQTGLILSTWQKLAPFALLIQLAPALNSNILLLLGLLSVLVGGWGGLNQ 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00200  173 TQLRKILAYSSIAHLGWLLSGLVYSPNLALLYLLLYVIITLTVFLLLNLLNSTKINSLSSSKTKNPILSMLLGLTLLSLG 252
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMFPTTNNSKLQW 303
Cdd:MTH00200  253 GLPPLTGFFPKWLILQELSKQGLFIYATILLLGSLLSLFFYLRLSYLTLLTLSPNQINMMSSW 315
ND2 MTH00041
NADH dehydrogenase subunit 2; Validated
1-295 3.76e-78

NADH dehydrogenase subunit 2; Validated


Pssm-ID: 177116 [Multi-domain]  Cd Length: 349  Bit Score: 242.53  E-value: 3.76e-78
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:MTH00041   13 IILGTIIVISSNHWFLIWLGLELNTLSIIPILSSNFSPRSVEATIKYFLVQAFSAAILLNGALIQAWLSGSWSINGPLNT 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00041   93 LSSIIITLALALKLGLAPCHFWFPDVLQGLPFLQGLIIATWQKIAPLILLISISNLLNSNILILCGILSVLVGGWGGLNQ 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00041  173 TQTRKILAFSSIAHLGWIIITSAYSPNASIIMFLIYIIINTSIFLIGNNFSLSTLSHLNKLSQLNPISAFLFILSILSLG 252
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMFPT 295
Cdd:MTH00041  253 GLPPLTGFLNKFISLYCLIQNNSILISIILIIGSLLSLFFYLRISFNTSLTLFPQ 307
ND2 MTH00144
NADH dehydrogenase subunit 2; Provisional
1-293 9.59e-55

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 214432 [Multi-domain]  Cd Length: 328  Bit Score: 181.62  E-value: 9.59e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTlfqisdq 80
Cdd:MTH00144   13 MVMGTLLSLSSSHWLGVWVGLEINLIGFLPLLVYKKKSSESESVVKYFIIQSLGSSLLIFGSLIMYNLSFSWF------- 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 tSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNM-KILIILAFSSTLLGGWGGLN 159
Cdd:MTH00144   86 -SMSLLLLGLCLKLGLFPFHFWVPSVMAGLSWLSCFLLLTWQKVAPLFLLSNFLDLYWLaYLLCVISVLSALVGSIGGLN 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 160 QTHLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLwNKSTPMTIVIILTLLSL 239
Cdd:MTH00144  165 QTQVRALLAYSSISHTGWMLVAILHGSWLMWMYFLIYIVSSGFLFFSLWSGDSGSMKDLGSL-KPSYKTGLSIISLLLSL 243
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1942250111 240 GGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMF 293
Cdd:MTH00144  244 GGLPPFLGFCSKLLVLISSMESSPLLLILLLLLGSLISLFFYLSVFFSSFLSSS 297
ND2 MTH00160
NADH dehydrogenase subunit 2; Provisional
1-300 3.37e-52

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 214442 [Multi-domain]  Cd Length: 335  Bit Score: 175.01  E-value: 3.37e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAwttnqwTLFQISDQ 80
Cdd:MTH00160   14 LIMGTLISISSNSWFGAWMGLEINLLSFIPLISNKKNLMSSESSLKYFLIQALASIILLFSIILNM------LNLMLFNN 87
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQIspsLNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00160   88 ISSMLINSSLLLKLGAAPFHFWFPEVMEGLSWINCFILMTWQKIAPLILLSYL---INNNFIIIIIILSAIIGAIGGLNQ 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00160  165 TSLRKILAYSSINHLGWMLSSMMISENLWLIYFLIYSIISLSIILLFNKFNIFFLNQLFNSNNKSKKIKFLLFLNLLSLG 244
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMTALTMFPTTNNSK 300
Cdd:MTH00160  245 GLPPFLGFLPKWIIIQLLISNNMFFLLFILIMSSLITLYFYLRISYSSLMLNYNKNKWNL 304
ND2 MTH00011
NADH dehydrogenase subunit 2; Validated
1-286 1.86e-42

NADH dehydrogenase subunit 2; Validated


Pssm-ID: 164587 [Multi-domain]  Cd Length: 330  Bit Score: 149.54  E-value: 1.86e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAiinnawTTNQWTLFQISDQ 80
Cdd:MTH00011   15 MTLGTLMALSSNNWLFLWMGMELNLLSFVPLMTSSKMNQESEAAVKYFLAQALGSGLLLLG------MTMMWSFPSLLKN 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMKILIILAFSSTLLGGWGGLNQ 160
Cdd:MTH00011   89 ITALMLLVSLMLKLGMAPCHFWFPSVMSSISWTLCLILSTWQKIAPLSILFFFTSHNILPMMTSMAAMSALAGGLGGMNQ 168
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSLG 240
Cdd:MTH00011  169 TQLRPLLAYSSIGHMGWMTMISVFSPSMAILYFMTYIIITTPLMLLFAYLNAFSTKFNSKISSMSQTTSMSLFIMLLSLG 248
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 1942250111 241 GLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIY 286
Cdd:MTH00011  249 GLPPFTGFMPKLMAIETLTSNSMILILLVLIVGSLMNLFYYLNLIF 294
ND2 MTH00197
NADH dehydrogenase subunit 2; Provisional
1-288 6.70e-37

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 177244 [Multi-domain]  Cd Length: 323  Bit Score: 134.80  E-value: 6.70e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAiinnawttNQWTLFQISDQ 80
Cdd:MTH00197    7 IFGGVLFSLSSSNWFLVWIGMELNLIGFIPLLSQNKSITENEGAMKYFLFQEFGSALLLMG--------GSLSFSNLYLS 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSSTIMTI-ALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPtsLMYQISPSLNMKILIILAFSSTLLGGWGGLN 159
Cdd:MTH00197   79 LLSVVLVIlGLLLKLGAFPFHFWVPSVMESLSWFNCFLLATWQKLAP--LLILAFNSSSFMGLLICSVLSSLIGGIGGMN 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 160 QTHLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITATLTLFLTLNHSSITKIKSLANLWNKSTPMTIVIILTLLSL 239
Cdd:MTH00197  157 QSNIRQLLAYSSIGHTGWMLMSLVYSPSIFMLYYLIYFVIMFMLFLFLSKNNLSSLNQQYSNPESMSSNLVFLGLSFLSL 236
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*....
gi 1942250111 240 GGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYMT 288
Cdd:MTH00197  237 GGLPPLSGFFLKWLILTSLLSSNISLITFMLILSTCFSLYYYLSLAYKS 285
NuoN COG1007
NADH:ubiquinone oxidoreductase subunit 2 (chain N) [Energy production and conversion];
2-285 7.62e-26

NADH:ubiquinone oxidoreductase subunit 2 (chain N) [Energy production and conversion];


Pssm-ID: 223939 [Multi-domain]  Cd Length: 475  Bit Score: 106.97  E-value: 7.62e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   2 LLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYP-NHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISDQ 80
Cdd:COG1007   110 TLGMIVMASANNLLLLFIGLELLSLALYVLAALRrDSKRSSEAALKYFVLGALSSAFLLYGIALVYGATGSLSLSGIAAY 189
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  81 TSST-----------IMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMK-------IL 142
Cdd:COG1007   190 LNGGgeplglllglvFIIAGLGFKLSAVPFHMWTPDVYEGAPTPVTAFLSTAPKIAAFAVLLRIFVTAFGPdapdwylIF 269
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 143 IILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTIIMLINPTL----MLLNLIIYITATL-----TLFLTLNHSSIT 213
Cdd:COG1007   270 AIIAVASMLVGNFAALSQTNVKRLLAYSSIAHMGYLLVGLAAVTVGgyaaVLFYLLAYAFMSLgafgvVALLSSKEGGAE 349
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1942250111 214 KIKSLANLWNKSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRII 285
Cdd:COG1007   350 SISDLAGLSKRHPLLAALLTILMLSLAGIPPLAGFWGKFYVFLAAVQAGLWWLAVIAVLNSAISAYYYLRVV 421
Proton_antipo_M pfam00361
Proton-conducting membrane transporter; This is a family of membrane transporters that ...
11-274 4.70e-24

Proton-conducting membrane transporter; This is a family of membrane transporters that inlcudes some 7 of potentially 14-16 TM regions. In many instances the family forms part of complex I that catalyzes the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane, and in this context is a combination predominantly of subunits 2, 4, 5, 14, L, M and N. In many bacterial species these proteins are probable stand-alone transporters not coupled with oxidoreduction. The family in total represents homologs across the phyla.


Pssm-ID: 425636 [Multi-domain]  Cd Length: 291  Bit Score: 99.31  E-value: 4.70e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  11 SNHWLTAWMGLEINTLAIIPMMTY-PNHPRATESAIKYFLTQTTASMLLMFAII---NNAWTTNQWTLFQISDQTSSTI- 85
Cdd:pfam00361   1 ANDLLLMYLGWEAVLLPSYLLIGYwGKSPRSSEAGMKYFLLTLLGSSILLFGISlmyNYTGTLSFDELSKALTGGLNSSg 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  86 -------MTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILL-TWQKVAP-----TSLMYQISPSLNMKILIILAFSSTLL 152
Cdd:pfam00361  81 llllfllILVGFLFKSAQVPFHTWLPDAYEGAPTPVSALLAaTLVKAGGyglirRSLLYLPSSPFIQQILLILAIISMLL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 153 GGWGGLNQTHLRKILAYSSIAHMGWMTIIMLINP----TLMLLNLIIYITATLTL-----FLTLNHSSITKIKSLANLWN 223
Cdd:pfam00361 161 GSLAALVQTDIKRLLAYSSISHMGYMLIALGAGTiygiQAAIFHLLTHGLFSAGLflcagSVIYRRVHTRNIRDYGGLAK 240
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1942250111 224 KSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSA 274
Cdd:pfam00361 241 TMPILALVFLVAMLSLAGLPPTAGFLGKFLILAAAVAASWIFLVLAGVVGS 291
ND2 MTH00196
NADH dehydrogenase subunit 2; Provisional
1-285 7.56e-22

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 214453 [Multi-domain]  Cd Length: 365  Bit Score: 94.71  E-value: 7.56e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAI-IPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTT---------- 69
Cdd:MTH00196    2 VALGILCLISSSNWLSVYLAIELQTLSLfILIAQNRGSGYSAEAGLKYFVLGALSSGLFLFGCALLCGTTgglhlsyinl 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  70 ---NQWTLFQISDQTSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMkiLIILA 146
Cdd:MTH00196   82 vlnSGQSFSSVSVPIGYLLIIVALLFKLSVAPFHMWAPDVYEGAPTKTTALLAIVPKLGIFSILVSIGLNVNI--LLIGG 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 147 FSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTIIMLINP----TLMLLNLIIYITATLTLFLTLNHSSITK--IKSLAN 220
Cdd:MTH00196  160 LFSLFVGAIGALNQTKIKRLLAYSGIGHMGFVLWGIEIGSfesiQASLVYLFIYIIMSICVFSIILALNVYKnlIIEFSG 239
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1942250111 221 LWNKSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRII 285
Cdd:MTH00196  240 LSRRLPILAITLALTFLSIAGIPPLVGFLGKWLILLSGVVYQYYLIFLLAVFCSVIAGVYYVRIV 304
PRK05777 PRK05777
NADH-quinone oxidoreductase subunit NuoN;
2-285 3.34e-21

NADH-quinone oxidoreductase subunit NuoN;


Pssm-ID: 235603 [Multi-domain]  Cd Length: 476  Bit Score: 93.73  E-value: 3.34e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   2 LLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPN-HPRATESAIKYFLTQTTASMLLMFAI-----------------I 63
Cdd:PRK05777  113 LLGMMVMVSANDLLTLFLGLELLSLPLYALAALRRdRRRSLEAAIKYFVLGALASGFLLYGMsllygatgslsfagiakA 192
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  64 NNAWTTNQWTLFqisdqTSSTIMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAP----TSLMYQISPSLNM 139
Cdd:PRK05777  193 LADGSGNSLLLL-----FGLVFLLVGLAFKLSAVPFHMWTPDVYEGAPTPVTAFLATAPKIAAfavlLRLLVVAFGGLSE 267
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 140 K---ILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTIIMLINPTL----MLLNLIIYITATL-----TLFLTL 207
Cdd:PRK05777  268 DwqqVLAIIAIASMLVGNLAALSQTNIKRLLAYSSIAHAGYLLVGLAAGTAEgysaVLFYLLAYLFMTLgafgvISLLRR 347
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1942250111 208 NHSSITKIKSLANLWNKSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRII 285
Cdd:PRK05777  348 KGGEAESISDFAGLSKRSPLLAAVMTIFMLSLAGIPPTAGFWGKFYVFEAAVEAGLWWLAVIGVLNSAIGAFYYLRVI 425
ND2 MTH00199
NADH dehydrogenase subunit 2; Provisional
1-287 3.69e-20

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 177245 [Multi-domain]  Cd Length: 460  Bit Score: 90.46  E-value: 3.69e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAI-IPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISD 79
Cdd:MTH00199  106 VALGSLLLVSSINWLSIYLAIELQTLTLfILVALKRDSAYSTEAGLKYFVLGAVSSGLFLFGCALLYGLTGETSIQGINS 185
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  80 QTSSTI----MTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNmkILIILAFSSTLLGGW 155
Cdd:MTH00199  186 ILTGDVgkilITISLLFKLSAAPFHMWAPDVYEGAPTITTALLATVPKIGVFSILVQIGPVTN--VVLICAVLSIIYGAI 263
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 156 GGLNQTHLRKILAYSSIAHMGWMTIIMLINP----TLMLLNLIIYITATLTLFLTLNHSSITK--IKSLANLWNKSTPMT 229
Cdd:MTH00199  264 GALNQTKIKRLLAYSGIGHMGFILFGVAIGSfesiQASLIYMIIYVIMSICSFSIILSLKLTKglIVEVSGLSRKNPVIA 343
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 1942250111 230 IVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYM 287
Cdd:MTH00199  344 LTLALTFLSIAGIPPLAGFLSKWLILLSGVSSGYYLICIIAVLSSVIAGVYYVRVVQI 401
NDH_I_N TIGR01770
proton-translocating NADH-quinone oxidoreductase, chain N; This model describes the 14th ...
2-314 1.80e-19

proton-translocating NADH-quinone oxidoreductase, chain N; This model describes the 14th (based on E. coli) structural gene, N, of bacterial and chloroplast energy-transducing NADH (or NADPH) dehydrogenases. This model does not describe any subunit of the mitochondrial complex I (for which the subunit composition is very different), nor NADH dehydrogenases that are not coupled to ion transport. The Enzyme Commission designation 1.6.5.3, for NADH dehydrogenase (ubiquinone), is applied broadly, perhaps unfortunately, even if the quinone is menaquinone (Thermus, Mycobacterium) or plastoquinone (chloroplast). For chloroplast members, the name NADH-plastoquinone oxidoreductase is used for the complex and this protein is designated as subunit 2 or B. This model also includes a subunit of a related complex in the archaeal methanogen, Methanosarcina mazei, in which F420H2 replaces NADH and 2-hydroxyphenazine replaces the quinone. [Energy metabolism, Electron transport]


Pssm-ID: 273795 [Multi-domain]  Cd Length: 468  Bit Score: 88.85  E-value: 1.80e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   2 LLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTY-PNHPRATESAIKYFLTQTTASMLLMF---AIINNAWTTNQWTLFQI 77
Cdd:TIGR01770 112 LLGIFLLVSSNDLLSIYLGLELQSLCFYVLAGLkRKSRFSTEAGLKYFILGAFSSGLLLFgisLIYGFTGSLNFEDLLLF 191
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  78 SDQTSSTI---------MTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVAPTSLMYQISPSL-------NMKI 141
Cdd:TIGR01770 192 LSNGMLNIsllllgivlILVGLLFKLSAVPFHMWVPDVYEGAPTPVTAFFSIVPKIAIFAVFLRLFLYIlfgfseaWQIF 271
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 142 LIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGW----MTIIMLINPTLMLLNLIIYITATL------TLFLTLNHSS 211
Cdd:TIGR01770 272 LAIIAFLSMLIGNFGALAQKKVKRLLAYSSISHVGYiligLLAGTLEGIKAVLFYIFIYALMSLgafgvlSLLRSYKDEW 351
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 212 ITKIKSLANLWNKSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIymtaLT 291
Cdd:TIGR01770 352 IEYISDFAGLFKTNPILAILILIFMFSLAGIPPLAGFFGKFYVFFALLKSGLYWLAVIAVLTSVIGAFYYLRVV----KV 427
                         330       340
                  ....*....|....*....|...
gi 1942250111 292 MFPTTNNSKLQwPHPQTKTTNII 314
Cdd:TIGR01770 428 MYFDKPERRIP-SNPQSKAQSLL 449
ND2 MTH00198
NADH dehydrogenase subunit 2; Provisional
3-180 1.27e-13

NADH dehydrogenase subunit 2; Provisional


Pssm-ID: 214454 [Multi-domain]  Cd Length: 607  Bit Score: 71.43  E-value: 1.27e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   3 LGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRAT---------ESAIKYFLTQTTASMLLMFAI-INNAWTTNQW 72
Cdd:MTH00198  199 LGGLLLIESANWLTIYLALEFQTLALFILAGEGSQPGSHfpspgntppESGLKYWILGAMSSGFYLFGCaLYFGFTGNEG 278
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  73 TLFQISDQTSST-------------IMTIALAMKLGLAPFHFWVPEVTQGIPLTSGMILLTWQKVapTSLMYQISPSLNM 139
Cdd:MTH00198  279 MLGTILSATLETtnielrqgslgylFITVAILFKLAAAPFHMWTPDVYEGAPTPTTALIAIIPKF--TVYILLTSLVITS 356
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 1942250111 140 KILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTI 180
Cdd:MTH00198  357 KLLLSVAIISLVVGAFGALNQTRIKRLLAYSGIGHIGFILI 397
ndhB CHL00049
NADH dehydrogenase subunit 2
39-197 1.22e-08

NADH dehydrogenase subunit 2


Pssm-ID: 176990 [Multi-domain]  Cd Length: 494  Bit Score: 56.17  E-value: 1.22e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  39 RATESAIKYFLTQTTASMLLMFA----------------IINNAWTTNQWTLFQISdqTSSTIMTIALAMKLGLAPFHFW 102
Cdd:CHL00049  159 RSNEATMKYLLMGGASSSILVYGfswlyglsggeielqeIVNGLINTQMYNSPGIS--IALIFITVGIGFKLSLAPFHQW 236
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 103 VPEVTQGIPLTSGMILLTWQKVAPTSLMYQIS----PSLNMK---ILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHM 175
Cdd:CHL00049  237 TPDVYEGSPTPVVAFLSVTSKVAASALATRIFdipfYFSSNEwhlLLEILAILSMILGNLIAITQTSMKRMLAYSSIGQI 316
                         170       180
                  ....*....|....*....|....*..
gi 1942250111 176 GWMTI-IMLINP----TLMLLNLIIYI 197
Cdd:CHL00049  317 GYVIIgIIVGDSndgyASMITYMLFYI 343
NuoM COG1008
NADH:ubiquinone oxidoreductase subunit 4 (chain M) [Energy production and conversion];
37-180 2.04e-08

NADH:ubiquinone oxidoreductase subunit 4 (chain M) [Energy production and conversion];


Pssm-ID: 223940 [Multi-domain]  Cd Length: 497  Bit Score: 55.29  E-value: 2.04e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  37 HPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTlFQISDQTSSTI-----------MTIALAMKLGLAPFHFWVPE 105
Cdd:COG1008   155 GKRRIYAATKFFLYTLLGSLFMLLAFLYLYFLTGSPT-FDILELLALNLplgvqtllflgFLIAFAVKMPLFPLHTWLPD 233
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 106 V-----TQGIPLTSGMILltwqKVAPTSL------MYQISPSLNMKILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAH 174
Cdd:COG1008   234 AhveapTAGSVILAGILL----KMGGYGLlrfslpLFPDASAYFAPLLVALGVISIIYGALVAFAQTDIKRLIAYSSISH 309

                  ....*.
gi 1942250111 175 MGWMTI 180
Cdd:COG1008   310 MGFVTL 315
NDH_I_M TIGR01972
proton-translocating NADH-quinone oxidoreductase, chain M; This model describes the 13th ...
43-180 9.07e-08

proton-translocating NADH-quinone oxidoreductase, chain M; This model describes the 13th (based on E. coli) structural gene, M, of bacterial NADH dehydrogenase I, as well as chain 4 of the corresponding mitochondrial complex I and of the chloroplast NAD(P)H dehydrogenase complex. [Energy metabolism, Electron transport]


Pssm-ID: 273903 [Multi-domain]  Cd Length: 481  Bit Score: 53.40  E-value: 9.07e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  43 SAIKYFLTQTTASMLLMFAIINNAWTT------NQWTLFQISDQTSSTIMT---IALAMKLGLAPFHFWVPEV-----TQ 108
Cdd:TIGR01972 157 AAMKFFLYTLAGSLLMLLAILGLYFLGggtfdlLELLNLPLPFGVQTWLFLaffIAFAVKVPLFPLHTWLPDAhveapTA 236
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1942250111 109 GIPLTSGMILltwqKVAPTSLM---YQISPSLN---MKILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTI 180
Cdd:TIGR01972 237 GSVILAGVLL----KMGTYGFLrfnLPLFPDASlyfAPVLAALGVIAIIYGALIALAQTDIKRLIAYSSISHMGFVLL 310
NuoL COG1009
NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA ...
34-180 2.35e-07

NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit [Energy production and conversion, Inorganic ion transport and metabolism];


Pssm-ID: 223941 [Multi-domain]  Cd Length: 606  Bit Score: 52.30  E-value: 2.35e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  34 YPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQI------SDQTSSTIMTIALAMKLGLA-------PFH 100
Cdd:COG1009   148 WYSRPSARRAARKAFLVTRVGDLGLLLGIILLYLLTGTTLLSEElfaaalFADISPPLLTLILLLLLLGAfgksaqfPFH 227
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 101 FWVPEVTQG-IP----------LTSGMILltwqkVAPTSLMYQISPSLNMKILIILAFSStLLGGWGGLNQTHLRKILAY 169
Cdd:COG1009   228 TWLPDAMEGpTPvsallhaatmVKAGVYL-----LARLSPLFALSPEALWLVILVGAVTA-LLAALIALVQNDIKRILAY 301
                         170
                  ....*....|.
gi 1942250111 170 SSIAHMGWMTI 180
Cdd:COG1009   302 STISQLGYMFV 312
PRK08375 PRK08375
putative monovalent cation/H+ antiporter subunit D; Reviewed
21-286 7.96e-07

putative monovalent cation/H+ antiporter subunit D; Reviewed


Pssm-ID: 236251 [Multi-domain]  Cd Length: 487  Bit Score: 50.26  E-value: 7.96e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  21 LEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQISD--------QTSSTIMTIALAM 92
Cdd:PRK08375  135 LEIMSLSSYALVAMGGDRRALAAARKYLIVGLIGSTFLLIGVGLLYGVTGTLNMADLAGalaenptvVTAFGFVLLALAL 214
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  93 KLGLAPFHFWVPEV-TQGIPLTSGMILLTWQKVAPTSLM----------YQISPSLNMkILIILAFSSTLLGGWGGLNQT 161
Cdd:PRK08375  215 KAAVFPLHTWLPRAyPAAPPVVTALLSGLVTKVAVYALIriyftvfggdFRFALGLGW-LLAVLALLSMLVGSLAALGQD 293
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 162 HLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYItatltlfltLNHS-----------------SITKIKSLANLwNK 224
Cdd:PRK08375  294 DVKRVLAYSTVSQMGYILLGLALLTPLALAAGLLHL---------LHHAlmkgalflaagaievtyGTRRLSELSGL-GR 363
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1942250111 225 STPMTIVIILTLLSLGGLPPLT-GFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIY 286
Cdd:PRK08375  364 RMPLTAAAFAVASLSLIGVPPTsGFVSKWYLVVGAVEAGQWLVLAVLLASSLLALLYFLRIWY 426
HyfB COG0651
Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit [Energy ...
1-284 1.16e-06

Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit [Energy production and conversion, Inorganic ion transport and metabolism];


Pssm-ID: 223724 [Multi-domain]  Cd Length: 504  Bit Score: 50.04  E-value: 1.16e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTLFQ---- 76
Cdd:COG0651   115 LLAGMLGAFLTGDLFNLYVFFEIMTLSSYFLVAHYGGRRRQASAGFKYLILGHIGTLLLLIGVGLLYAATGTLNFAdial 194
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  77 -ISDQTSSTIMTIALA-------MKLGLAPFHFWVPEVTQGIP---------LTSGMILLTWQKVAPTSLMYQISPSLNM 139
Cdd:COG0651   195 kLSSELDPGLGIAAFLllligfgVKAGLFPLHFWLPDAHSEAPspvsallsgVLVKVGVYGILRILYLVFPLLGGAYLWG 274
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 140 KILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYIT-----------ATLTLFLTLN 208
Cdd:COG0651   275 NLLIALGILTILFGVLYALLQKDIKRLLAYSTVSQMGYILLGLGIGTPLGLAGAIFHLLnhalvkallflGAGAVLYRTG 354
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 209 HSSITKIKSLANLWNKSTPMTIVIILTllsLGGLPPLTGFMPKWLILQELITHNN-----ITMATLMALSALLNLFFYMR 283
Cdd:COG0651   355 TRDLEKLGGLAKRMPLTAVAFLIGALS---LAGLPPFNGFISKFLLIQALFKANAllailIILAALILLASLATFISLAR 431

                  .
gi 1942250111 284 I 284
Cdd:COG0651   432 I 432
NADH_dehy_S2_C pfam06444
NADH dehydrogenase subunit 2 C-terminus; This family consists of the C-terminal region ...
279-320 1.80e-06

NADH dehydrogenase subunit 2 C-terminus; This family consists of the C-terminal region specific to the eukaryotic NADH dehydrogenase subunit 2 protein and is found in conjunction with pfam00361.


Pssm-ID: 428946 [Multi-domain]  Cd Length: 51  Bit Score: 44.17  E-value: 1.80e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 1942250111 279 FFYMRIIYMTALTMFPTTNNSKLQWPHPQTKTTNIIPPLTII 320
Cdd:pfam06444   1 FFYLRLSYSTTLTLFPNTNNSKMKWRFNSTKNTLLLPTLTTL 42
PRK08168 PRK08168
NADH-quinone oxidoreductase subunit L;
1-178 2.43e-06

NADH-quinone oxidoreductase subunit L;


Pssm-ID: 236171 [Multi-domain]  Cd Length: 516  Bit Score: 48.93  E-value: 2.43e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLT---AWM--GLEINTLaiipMMTYPNHPRATESAIKYFLTQTTASMLLMFAIINNAWTTNQWTL- 74
Cdd:PRK08168  109 VLAAVHLLVLSDHLLVliaAWAaiSLALHRL----LCFYPDRPFARLAAHKKFIADRLAELLLLAAAALAYLEVGSLSLs 184
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  75 ---FQISDQTSSTIMTIAlAMKLGLA--------PFHFWVPEVTQ-----------GIPLTSGMILLtwqKVAPtslMYQ 132
Cdd:PRK08168  185 alwAHLAAQGASPSLQAA-ALLLVLAvilktaqlPVHGWLIQVMEaptpvsallhaGVVNLGGFVLI---RFAP---LLE 257
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*.
gi 1942250111 133 ISPSLNMkILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWM 178
Cdd:PRK08168  258 QAPPARW-LLVLVGLATAVLAGLVMLTRISIKVRLAWSTVAQMGFM 302
PRK02504 PRK02504
NAD(P)H-quinone oxidoreductase subunit N;
38-197 7.36e-06

NAD(P)H-quinone oxidoreductase subunit N;


Pssm-ID: 235044 [Multi-domain]  Cd Length: 513  Bit Score: 47.35  E-value: 7.36e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  38 PRATESAIKYFLTQTTASMLLMFAI---------------INNAWTTNQWTLFQISdqtssTIMTIA-LAMKLGLAPFHF 101
Cdd:PRK02504  157 PRSNEAALKYLLIGAASSAIFLYGSsllyglsggstqlsaIALALITSPSLGLALA-----LVFVIAgIAFKISAVPFHQ 231
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 102 WVPEVTQGIPLTSGMILLTWQKVAPTSL----MYQISPSLNMK---ILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAH 174
Cdd:PRK02504  232 WTPDVYEGSPTPVVAFLSVGSKAAGFALairlLVTAFPSFDEQwklLFTALAILSMVLGNVVALAQTSMKRMLAYSSIGQ 311
                         170       180
                  ....*....|....*....|....*..
gi 1942250111 175 MGWMTIIMLINP----TLMLLNLIIYI 197
Cdd:PRK02504  312 AGFVMIGLVAGTeagyASMVFYLLAYL 338
PRK08376 PRK08376
putative monovalent cation/H+ antiporter subunit D; Reviewed
21-286 7.71e-06

putative monovalent cation/H+ antiporter subunit D; Reviewed


Pssm-ID: 236252 [Multi-domain]  Cd Length: 521  Bit Score: 47.40  E-value: 7.71e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  21 LEINTLAIIPMMTYPNH-PRATESAIKYFLTQTTASMLLMFAI---------INNAWTTNQWTL-FQISDQTSSTIMTIA 89
Cdd:PRK08376  150 LEIMSIASYALVAFRNDtWEAIEAGIKYMFVGSLASSMVLLGIallygqygtLNMAYLAVKMSEnPTVVAKIALALFIAG 229
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  90 LAMKLGLAPFHFWVPEVTQGIPLTSGMILLTwQKVAPTSLMYQIS-----PSLNMK----ILIILAFSSTLLGGWGGLNQ 160
Cdd:PRK08376  230 LAMKSGAVPVHMWLPDAYPAAPSSISAMLLV-IKQAGLYALARVLfsiygPAINLAtvgwVIIILGCLTMFVGVAMAVVQ 308
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTI-------------------IMLINPTLMLLNLIIYITATLTLFLTLNHSSITK-IKSLAN 220
Cdd:PRK08376  309 KDVKRLLAYHSVSQIGYMLLglgvglaalgdpamasygeIALAGGIYHIVNHALYKALLFLTAGAVIYETGTRnLNELGG 388
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1942250111 221 LWNKSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSAlLNLFFYMRIIY 286
Cdd:PRK08376  389 LARTMPKTTIAFLIGAAAIVGLPPFNGFASKWLIYESSALFNPILGVIAMIGSV-LTLASFVKVFH 453
PRK12667 PRK12667
putative monovalent cation/H+ antiporter subunit D; Reviewed
32-287 5.24e-05

putative monovalent cation/H+ antiporter subunit D; Reviewed


Pssm-ID: 237167 [Multi-domain]  Cd Length: 520  Bit Score: 44.58  E-value: 5.24e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  32 MTYPNHPRATESAIKYFLTQTTASMLLMFAII---NNAWTTNQWTLFQISDQTSST------------------IMTIAL 90
Cdd:PRK12667  154 AYYRDRGDAVEAAIKYALIGAVGTTLYFLALAflyATFGTLNMADLSAKIRGLSFPltgglagnpplalgvalaLALWAF 233
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  91 AMKLGLAPFHFWVPEVTQGIP-----LTSGMILltwqKVAPTSLM------YQISPSLN------MKILIILAFSSTLLG 153
Cdd:PRK12667  234 TIKAAIFPNHFWLPDAHPAAPspvsaMLSGLVV----NVGAYAIIrflytiFGISPSLIdfraalSPILIILGAVSAIIG 309
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 154 GWGGLNQTHLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYI--------TATLTLFLTLNHSSITKIKSLANLWNKS 225
Cdd:PRK12667  310 ALMMVVQKDVKRLLAYSTISHMGYIFMGIGIGTQLGLAAALFHIinhaiaksLLFLASGVFIHAAGTRDIDELAGLGRKM 389
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1942250111 226 TPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRIIYM 287
Cdd:PRK12667  390 PIASFAFLIGALSLVGIPPLNGFFSKLLLFNALLESGFYLPALVLLIASAISLVGYFRAWYS 451
PRK08676 PRK08676
hydrogenase membrane subunit; Validated
1-197 8.33e-05

hydrogenase membrane subunit; Validated


Pssm-ID: 181537 [Multi-domain]  Cd Length: 485  Bit Score: 43.98  E-value: 8.33e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   1 LLLGTSLTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTA------SMLLMFAIINNAWTTNQWTL 74
Cdd:PRK08676  111 LLSVITFAFFSDNLALFWIFAELTTVFSAMLIAILSARENIDAALKYIFIASTAmifafiGLIFLFSLTRQALGTGTLNW 190
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  75 FQISDQT----------SSTIMTIALAMKLGLAPFHFWVPE-----------VTQGIPLTSGM--ILLTWQKVAPTSLMY 131
Cdd:PRK08676  191 TELAAHAsllspsvlgaSFLFIFIGFLAKSGLVPFHTWLPAayakapsvvsaLLSGTVLNIGIygILRLSALLRQSGAAE 270
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1942250111 132 QISPslnmkILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYI 197
Cdd:PRK08676  271 QFSN-----VLIGLGIFSIAVAAFSMLSQRNLKKLIAFSSIEHMGLMLLGIGIGTPLALFWMLFHM 331
PRK05846 PRK05846
NADH:ubiquinone oxidoreductase subunit M; Reviewed
44-180 3.15e-04

NADH:ubiquinone oxidoreductase subunit M; Reviewed


Pssm-ID: 235622 [Multi-domain]  Cd Length: 497  Bit Score: 42.11  E-value: 3.15e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  44 AIKYFLTQTTASMLLMFAIINNAWTTNQWT-LFQISDQTSSTIMT-----------IALAMKLGLAPFHFWVPEV----- 106
Cdd:PRK05846  163 ATKFFLYTLLGSLLMLVAIIYLVVVYYNATgTFDIADLLNLPLPPgvqywlflaffIAFAVKMPMFPLHTWLPDAhvqap 242
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 107 TQGIPLTSGMILltwqKVAPTSL---MYQISPSLN---MKILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTI 180
Cdd:PRK05846  243 TAGSVLLAGILL----KMGAYGLlrfSLPLFPDAShefAPIIITLGVIAIIYGALVALAQTDIKKLIAYSSISHMGFVTL 318
ND4 MTH00226
NADH dehydrogenase subunit 4; Provisional
47-183 3.32e-04

NADH dehydrogenase subunit 4; Provisional


Pssm-ID: 214466 [Multi-domain]  Cd Length: 505  Bit Score: 42.22  E-value: 3.32e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  47 YFLTQTTASMLLMFAIINNAWTTNQWTLFQ----ISDQTSSTI---MTIALAMKLGLAPFHFWVPEVTQGIPLTSGM--- 116
Cdd:MTH00226  190 YTLIGSVLMLLCLFSLYNIHGTTDYLTLAScshvVSEQTQKWIflgIFLAMAVKIPIFPFHIWLPKAHVEAPVAGSVlla 269
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1942250111 117 -ILLTWQKVAPTSLMYQISP--SLNMKILII-LAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTIIML 183
Cdd:MTH00226  270 gILLKLGGYGLVRLSWPILPlgAQNLAPAVIaMGIVGIVYGSFATCRQIDVKRLVAYSSVAHMGLVSITLV 340
PRK12662 PRK12662
putative monovalent cation/H+ antiporter subunit D; Reviewed
9-320 6.41e-04

putative monovalent cation/H+ antiporter subunit D; Reviewed


Pssm-ID: 183662 [Multi-domain]  Cd Length: 492  Bit Score: 41.26  E-value: 6.41e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   9 LFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAI---INNAWTTNQWTLFQI-------- 77
Cdd:PRK12662  127 LVSNDVFNIYVFLEISSISSYVLVAMGRDKKALVAAFEYLIIGTIGATFYLIGIgflYAITGTLNMGDMFLIiqdlptnr 206
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  78 SDQTSSTIMTIALAMKLGLAPFHFWVPEVTQGIP----------LTSGMILL---TWQKVAPTSLMYQISPSLNMkiLII 144
Cdd:PRK12662  207 AIQIGVLFIMVGLFIKAALFPFHKWLIQAYSEAPsfisvffsgtSTKVMIYLiirIVYDVFKANFVFTTLPFNNV--FMI 284
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 145 LAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTIIMLINPTLMLLNLIIYITatltlfltlNHSSI------------ 212
Cdd:PRK12662  285 LAALAIVFGSVLAILSKDIKRIFAYSSISHIGYIILAVSLNTYYGLAAAVAYIV---------NHSIVksalfmvsgsis 355
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 213 -----TKIKSLANLWNKSTPMTIVIILTLLSLGGLPPLTGFMPKWLILQELITHNNITMATLMALSALLNLFFYMRII-- 285
Cdd:PRK12662  356 yhfgtTKLEDCLNLWKSMPKITLAFVLLSLSLIGMPPTSGFVAKWYILDAFIKSNAWIGLVVLLVGSGLSVIYVWKIVea 435
                         330       340       350
                  ....*....|....*....|....*....|....*.
gi 1942250111 286 -YMTALTMFPTTNNSKLQWPHPQTKTTNIIPPLTII 320
Cdd:PRK12662  436 lYFESRMVESKANDKAFKTPNAMVLCIWIMAILSII 471
PRK06458 PRK06458
hydrogenase 4 subunit F; Validated
7-180 6.45e-04

hydrogenase 4 subunit F; Validated


Pssm-ID: 235805 [Multi-domain]  Cd Length: 490  Bit Score: 41.07  E-value: 6.45e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111   7 LTLFSNHWLTAWMGLEINTLAIIPMMTYPNHPRATESAIKYFLTQTTASMLLMFAII----------NNAWTTNQWT-LF 75
Cdd:PRK06458  123 LALTSNNLGLMWVAIEATTLSSALLVGIYRTRASLEAAWKYIIICSVGVAFALFGTIlvyanaatvmGDGEMAILWTeLL 202
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  76 QISDQTSSTIMTIALAM-------KLGLAPFHFWVPEVTQGIP-----LTSGMILltwqKVAPTSLM-------YQISPS 136
Cdd:PRK06458  203 KHASLLDPTLMKLAFVFlligfgtKVGLFPMHAWLPDAHSEAPspvsaLLSGVLL----NVALYAVLryyilidAAIGSD 278
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 1942250111 137 LNMKILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTI 180
Cdd:PRK06458  279 FPGRLLLIFGLLSVLVAAFFLLRQRDIKRLFAYSSIEHMGLIAF 322
PRK12644 PRK12644
putative monovalent cation/H+ antiporter subunit A; Reviewed
49-275 1.06e-03

putative monovalent cation/H+ antiporter subunit A; Reviewed


Pssm-ID: 237154 [Multi-domain]  Cd Length: 965  Bit Score: 40.68  E-value: 1.06e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  49 LTQTTA---SMLLMFAIINNAWTTnqwtlFQIS----DQTSSTIMTIALAM-------KLGLAPFHFWVPE--------- 105
Cdd:PRK12644  163 LLVTTAgglAMLVGIIILGQAAGT-----YRLSellaDPPTGPAVSVAVVLilvgalsKSAIVPFHFWLPGamaaptpvs 237
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 106 --------VTQGIPLtsgmilltwqkVAPTSLMYQISPSLNMkILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGW 177
Cdd:PRK12644  238 aylhaaamVKAGIYL-----------VARLAPGFADVPVWRP-TVLVLGLATMLLGGWRALRQHDLKLILAYGTVSQLGF 305
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 178 MTII--------------MLI-----NPTLMLLNLIIyitatltlfltlNHSSITK-IKSLANLWNKSTPMTIVIILTLL 237
Cdd:PRK12644  306 LTVLvgigtrdaalaglaMLLahalfKAALFLVVGII------------DHSTGTRdIRKLSGLGRRQPVLAVVAALAAA 373
                         250       260       270
                  ....*....|....*....|....*....|....*...
gi 1942250111 238 SLGGLPPLTGFMPKWLILQELITHNNITMATLMALSAL 275
Cdd:PRK12644  374 SMAGLPPLLGFVAKEAALEAVLHDGALGPAGPVVLAGI 411
ND5 MTH00020
NADH dehydrogenase subunit 5; Reviewed
40-320 1.62e-03

NADH dehydrogenase subunit 5; Reviewed


Pssm-ID: 214400 [Multi-domain]  Cd Length: 610  Bit Score: 40.06  E-value: 1.62e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  40 ATESAIKYFLTQTTASM---LLMFAIINNAWTTNQWTLFQ-ISDQTSSTIMTIALAMKLGLAP------FHFWVPEVTQG 109
Cdd:MTH00020  160 ANKAAIKAMLVNRVGDIgllLAMFLLWDRFGSLDFSSVFNmVVSAPSSDITLICLFLFIGAVGksaqlgLHTWLPDAMEG 239
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 110 IPLTSGMILLTWQKVAPTSLMYQISP-----SLNMKILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMTIIMLI 184
Cdd:MTH00020  240 PTPVSALIHAATMVTAGVFLLIRSSPlfeqaPLALIIVTIVGSLTVFFAATVGLVQNDLKKVIAYSTCSQLGYMVVACGL 319
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 185 NP-TLMLLNLI--------IYITATLTLFLTLNHSSITKIKSLAnlwnKSTPMT-IVIILTLLSLGGLPPLTGFMPKWLI 254
Cdd:MTH00020  320 SHySISLFHLMnhaffkalLFLSAGSVIHALSDEQDMRKMGGLI----SFLPLTyIFFLIGSLSLMGFPYLTGFYSKDLI 395
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1942250111 255 LQELITHNNITMAT-LMALSALLNLFFYMRIIYMTALTmfpTTNNSKLQWPHPQTKTTNIIPPLTII 320
Cdd:MTH00020  396 LELAFGQYYLIFAYwLGCFSALLTAFYSIRLIYLTFLS---NTNLKKAVFFHLHEGDWNLLLPLGIL 459
PRK12561 PRK12561
NAD(P)H-quinone oxidoreductase subunit 4; Provisional
88-180 1.83e-03

NAD(P)H-quinone oxidoreductase subunit 4; Provisional


Pssm-ID: 237137 [Multi-domain]  Cd Length: 504  Bit Score: 40.01  E-value: 1.83e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  88 IALAMKLGLAPFHFWVP----EVTQGIPLTSGMILLTWQKVAPTSLMYQISPSLNMK---ILIILAFSSTLLGGWGGLNQ 160
Cdd:PRK12561  193 IAFGVKLPIFPLHTWLPdahgEASAPVSMILAGVLLKMGGYALIRFNVQMLPDAHVYfapALAILGVVNIIYGALNAFAQ 272
                          90       100
                  ....*....|....*....|
gi 1942250111 161 THLRKILAYSSIAHMGWMTI 180
Cdd:PRK12561  273 DNVKRRLAYSSVSHMGFVLL 292
PRK06473 PRK06473
NADH-quinone oxidoreductase subunit M;
88-178 3.42e-03

NADH-quinone oxidoreductase subunit M;


Pssm-ID: 235810 [Multi-domain]  Cd Length: 500  Bit Score: 38.91  E-value: 3.42e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  88 IALAMKLGLAPFHFWVPE--VTQGIPLTS-------------------GMILLTWQKVAPTslmyqispslnmkiLIILA 146
Cdd:PRK06473  213 VGFGIKIPLVPFHTWLPDahVEASTPVSVllagvllklgtygllrfgvGLFPEAWVYLAPW--------------LATWA 278
                          90       100       110
                  ....*....|....*....|....*....|..
gi 1942250111 147 FSSTLLGGWGGLNQTHLRKILAYSSIAHMGWM 178
Cdd:PRK06473  279 VVSVLYGASCAIAQKDMKKMVAYSSIGHMGYI 310
ND5 MTH00210
NADH dehydrogenase subunit 5; Provisional
39-320 8.70e-03

NADH dehydrogenase subunit 5; Provisional


Pssm-ID: 177253 [Multi-domain]  Cd Length: 616  Bit Score: 37.68  E-value: 8.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  39 RATESAIKYFLTQTTASM---LLMFAIINNAWTTNQWTLFQI----SDQTSSTIMTIALAM-------KLGLapfHFWVP 104
Cdd:MTH00210  159 KANKAAIKAMLINRVGDIglvLAMIMILKEFGTLEFSTISSLlvtnINKESLTIICLLLFIgavgksaQLGL---HTWLP 235
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 105 EVTQGIPLTSGMILLTWQKVAPTSLMYQISP-----SLNMKILIILAFSSTLLGGWGGLNQTHLRKILAYSSIAHMGWMT 179
Cdd:MTH00210  236 DAMEGPTPVSALIHAATMVTAGVFLIIRSGPlfegsPLALTIVTILGALTAFFAATVGVVQNDLKKVIAYSTCSQLGYMV 315
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111 180 IIM-LINPTLMLLNLI--------IYITATLTLFLTLNHSSITKIKSLAnlwnKSTPMTIVIILT-LLSLGGLPPLTGFM 249
Cdd:MTH00210  316 MVCgISNYSTSLFHLMnhaffkalLFLSAGSVIHAVSDEQDMRKMGGLI----KSIPFTYVMILIgSLSLMGFPYLTGFY 391
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1942250111 250 PKWLILQELITHNNITMAT-LMALSALLNLFFYMRIIYMTALTmfpTTNNSKLQWPHPQTKTTNIIPPLTII 320
Cdd:MTH00210  392 SKDLILELTYDKYYIAFAYwLGSFSALLTAFYSIRLIYLTFIT---NTNSKKEVFIGVHESSWNITFPLLLL 460
PRK08667 PRK08667
hydrogenase membrane subunit; Validated
31-176 9.55e-03

hydrogenase membrane subunit; Validated


Pssm-ID: 236331 [Multi-domain]  Cd Length: 644  Bit Score: 37.79  E-value: 9.55e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1942250111  31 MMTYPNHPRATESAIKYF-LTQ-TTASMLLMFAIINNAWTTNQWTLFQISDQTSSTIMT---IALAMKLGLAPFHFWVPE 105
Cdd:PRK08667  151 VMNDYQEEETQRAGIFYFvMTQlSTVFLMLGIIVLFIQTGSFELSPLGASAGILSLVFLllfLGFGIKAGIIPFHKWLPY 230
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1942250111 106 VTQGIP-----LTSGMILLTWQKVAPTSLMYQISPSLNMKILIILAFS-STLLGGWGGLNQTHLRKILAYSSIAHMG 176
Cdd:PRK08667  231 AHPASPsnvsaLMSGVMLKVAVYGLVRFLMDVLSPELWWGVLILLAGSiSALLGVIYALKEHDLKGLLAYSSIENIG 307
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH